SMED30022666

Overview
NameSMED30022666
Smed IDSMED30022666
Length (bp)496
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022666 (SMED30022666) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022666 (SMED30022666) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022666 (SMED30022666) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022666 (SMED30022666) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022666

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022666h1SMcG0005835 Contig7058newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022666h1SMcG0005835 Contig7058uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022666h1SMcG0005836 Contig7058newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022666h1SMcG0005836 Contig7058uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30022666 SmedASXL_012879SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30022666h1SMcG0005823 Contig19411newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022666h1SMcG0005823 Contig19411uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022666h1SMcG0005817 Contig10395newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022666h1SMcG0005817 Contig10395uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022666h1SMcG0005834 Contig10395newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022666h1SMcG0005834 Contig10395uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30022666h1SMcG0005817 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022666h1SMcG0005817 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022666h1SMcG0005817 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022666h1SMcG0005817 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022666h1SMcG0005817 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30022666h1SMcG0005817 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022666h1SMcG0005823 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022666h1SMcG0005823 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022666h1SMcG0005823 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022666h1SMcG0005823 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022666h1SMcG0005823 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30022666h1SMcG0005823 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022666 dd_Smed_v4_23695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022666h1SMcG0005817 dd_Smed_v6_16570_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022666h1SMcG0005823 OX_Smed_1.0.12815ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022666h1SMcG0005817 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022666h1SMcG0005823 dd_Smed_v4_20102_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022666h1SMcG0005823 dd_Smed_v4_5097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022666 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005332:38212..38707 -2354
v31.012180:7048..7558 -2138
v31.012180:7278..7795 -506
Homology
BLAST of SMED30022666 vs. Planmine SMEST
Match: SMESG000038528.1 (SMESG000038528.1)

HSP 1 Score: 228.409 bits (581), Expect = 2.306e-70
Identity = 152/165 (92.12%), Postives = 159/165 (96.36%), Query Frame = 1
Query:    1 NSQLENEMEINKRKIEEISKDYQLKMENSXXXXXXXXXXXXXXXXXCKISQLETPNKYQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSEEERTNLQSGNYQLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            NSQ +NE+++NKRKIEEI+KDYQLKMENSNNSIEKLKLELKNKDNECKISQLET NKYQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMNDLN S+NNLILKLNQSEEERTNLQSGNYQLESELKE DKIKNKL KDYDDCKAELQRSA+RN QLEN
Sbjct:  723 NSQFKNEIDVNKRKIEEITKDYQLKMENSNNSIEKLKLELKNKDNECKISQLETANKYQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMNDLNKSMNNLILKLNQSEEERTNLQSGNYQLESELKELDKIKNKLHKDYDDCKAELQRSAERNLQLEN 887          

HSP 2 Score: 57.3806 bits (137), Expect = 6.035e-10
Identity = 55/129 (42.64%), Postives = 79/129 (61.24%), Query Frame = 1
Query:  148 SQLETPNKYQTNINKRPY--SAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSEEERTNLQSGNY-----------QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            SQLE+ N +++ +++  +  +AE   QL+NE    K K EE T D Q KM DLN SI  L L+L+QSE +  +LQ+ N            QL+SELK+SD+    L +D++DCK +L+ S +RNSQL N
Sbjct:  522 SQLESTNLFKSQMDRNRFENNAELIKQLENEKETDKRKVEEITKDFQLKMEDLNRSIEKLKLELSQSENKFQSLQNDNNNIISGFTAQIEQLQSELKKSDRKMRILQRDFEDCKGKLKHSQERNSQLVN 650          

HSP 3 Score: 57.3806 bits (137), Expect = 6.151e-10
Identity = 65/202 (32.18%), Postives = 86/202 (42.57%), Query Frame = 1
Query:    7 QLENEMEINKRKIEEISKDYQLKMEN----------------SXXXXXXXXXXXXXXXXXCKISQLETPNK------------YQTNINKRPYSAESTGQLQNENARVKSKN---EEFTIDCQSKMXXXXXXXXXXXXXXXQSEEERTNLQSGNYQLESE--------LKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            QLENE E +KRK+EEI+KD+QLKME+                +     +            +I QL++  K            ++    K  +S E   QL NEN  VK K+   EE    CQ KM                      NL + N  L+ E        LKES     +L +D DDCKAELQRS ++NSQ +N
Sbjct:  548 QLENEKETDKRKVEEITKDFQLKMEDLNRSIEKLKLELSQSENKFQSLQNDNNNIISGFTAQIEQLQSELKKSDRKMRILQRDFEDCKGKLKHSQERNSQLVNENETVKRKSHQIEESDKGCQLKM---------------------MNLNTSNKNLKLELNQLQNKMLKESYATNTRLHQDCDDCKAELQRSEEKNSQFKN 728          

HSP 4 Score: 46.595 bits (109), Expect = 2.556e-6
Identity = 22/28 (78.57%), Postives = 25/28 (89.29%), Query Frame = 1
Query:    1 NSQLENEMEINKRKIEEISKDYQLKMEN 84
            N QLENEMEINKRK+EEI KD+QLK+ N
Sbjct:  882 NLQLENEMEINKRKLEEIKKDFQLKLHN 909          
BLAST of SMED30022666 vs. Planmine SMEST
Match: SMESG000047799.1 (SMESG000047799.1)

HSP 1 Score: 212.231 bits (539), Expect = 1.138e-65
Identity = 146/170 (85.88%), Postives = 156/170 (91.76%), Query Frame = 1
Query:    1 NSQLENEMEINKRKIEEISKDYQLKMENSXXXXXX-----XXXXXXXXXXXCKISQLETPNKYQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSEEERTNLQSGNYQLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            NSQ +NE+++NKRKIEEI+KDYQLKMENSNNSIEK      +LELKNKDNECKISQLETPNKYQTNIN+RPYSAE TGQLQNENARVKSKNEE TIDCQSKMNDLNN INNLIL+LNQ EE+ TNLQSGNYQLESELKESDKIKNKL KDYDDCKAELQRSA+RN QLEN
Sbjct:  462 NSQFKNEIDVNKRKIEEITKDYQLKMENSNNSIEKLKLELDRLELKNKDNECKISQLETPNKYQTNINQRPYSAEPTGQLQNENARVKSKNEEITIDCQSKMNDLNNCINNLILELNQLEEKCTNLQSGNYQLESELKESDKIKNKLHKDYDDCKAELQRSAERNLQLEN 631          

HSP 2 Score: 47.7506 bits (112), Expect = 9.555e-7
Identity = 23/28 (82.14%), Postives = 26/28 (92.86%), Query Frame = 1
Query:    1 NSQLENEMEINKRKIEEISKDYQLKMEN 84
            N QLENEMEINKRKIEEI KD+QLK++N
Sbjct:  626 NLQLENEMEINKRKIEEIKKDFQLKLDN 653          

HSP 3 Score: 45.8246 bits (107), Expect = 5.468e-6
Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = 1
Query:  379 QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            +LES LKES     +L KD DDCKAELQRS +RNSQ +N
Sbjct:  429 KLESVLKESYTTNRRLHKDCDDCKAELQRSEERNSQFKN 467          

HSP 4 Score: 45.4394 bits (106), Expect = 6.243e-6
Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = 1
Query:  379 QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLE 492
            QLESELKE + I  +L +D+DDCK +L +S +RNSQLE
Sbjct:  220 QLESELKELEGINLRLQQDFDDCKVKLNQSQRRNSQLE 257          
BLAST of SMED30022666 vs. Planmine SMEST
Match: SMESG000036102.1 (SMESG000036102.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.191e-11
Identity = 84/201 (41.79%), Postives = 109/201 (54.23%), Query Frame = 1
Query:    7 QLENEMEINKRKIEEISKDYQLKMENSXXXXXXXXXXXXXXXXXCK----------------ISQLETPNK------------YQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSE------EERTNLQSGNY----QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            QLENE E +KRK+EEI KD+QLKMEN N SIEKLKL+L   +N+ K                I QL++  K            ++    K  +S E   QL+NE A  K   EE T D Q K  D N SI  L L+L+QSE      +   N++SG      QL+S LKESD+    L +D++DCK +L+ S +RN QLEN
Sbjct:  495 QLENEKETDKRKVEEIIKDFQLKMENLNRSIEKLKLQLSQSENKFKSLQNENDNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLENEMAVNKRTIEEITKDFQLKKEDSNRSIEKLKLQLSQSENKCKSLQNENNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLEN 695          

HSP 2 Score: 55.4546 bits (132), Expect = 2.356e-9
Identity = 54/129 (41.86%), Postives = 77/129 (59.69%), Query Frame = 1
Query:  148 SQLETPNKYQTNINKRPY--SAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSEE-------ERTNLQSGNY----QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            SQLE+ N +++ +++  +  +AE   QL+NE    K K EE   D Q KM +LN SI  L L+L+QSE        E  N++SG      QL+S LKESD+    L +D++DCK +L+ S +RN QLEN
Sbjct:  469 SQLESANLFKSQMDRNRFENNAELIKQLENEKETDKRKVEEIIKDFQLKMENLNRSIEKLKLQLSQSENKFKSLQNENDNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLEN 597          

HSP 3 Score: 46.9802 bits (110), Expect = 2.025e-6
Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 1
Query:    1 NSQLENEMEINKRKIEEISKDYQLKMENS 87
            N QLENEM +NKR IEEI+KD+QLKME+S
Sbjct:  690 NLQLENEMAVNKRTIEEITKDFQLKMEDS 718          

HSP 4 Score: 45.8246 bits (107), Expect = 4.572e-6
Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 1
Query:  379 QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLE 492
            QL+S LKES  I  +L +D+DDCK +L  S +RNSQLE
Sbjct:  273 QLQSALKESKGINGRLQQDFDDCKVKLNHSQRRNSQLE 310          

HSP 5 Score: 45.8246 bits (107), Expect = 5.473e-6
Identity = 73/194 (37.63%), Postives = 103/194 (53.09%), Query Frame = 1
Query:    1 NSQLENEMEINKRKIEEISKDYQLKMENSXXXXXXXXXXXXXXXXXCK---------------ISQLETPNK------------YQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSEEERTNLQSGN-----------YQLESELKESDKIKNKLLKDYDDCKAELQRS 468
            N QLENEM +NKR IEEI+KD+QLK E+SN SIEKLKL+L   +N+CK               I QL++  K            ++    K  +S E   QL+NE A  K   EE T D Q KM D N+S   ++L+LN+SE++  +LQ+ N            +LE  +K+ ++ +  L   YD+CK    +S
Sbjct:  592 NLQLENEMAVNKRTIEEITKDFQLKKEDSNRSIEKLKLQLSQSENKCKSLQNENNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLENEMAVNKRTIEEITKDFQLKMEDSNSSNEKMLLQLNRSEDKCKSLQNENDNDKSHFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQS 785          
BLAST of SMED30022666 vs. Planmine SMEST
Match: SMESG000036102.1 (SMESG000036102.1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.436e-11
Identity = 84/201 (41.79%), Postives = 109/201 (54.23%), Query Frame = 1
Query:    7 QLENEMEINKRKIEEISKDYQLKMENSXXXXXXXXXXXXXXXXXCK----------------ISQLETPNK------------YQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSE------EERTNLQSGNY----QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            QLENE E +KRK+EEI KD+QLKMEN N SIEKLKL+L   +N+ K                I QL++  K            ++    K  +S E   QL+NE A  K   EE T D Q K  D N SI  L L+L+QSE      +   N++SG      QL+S LKESD+    L +D++DCK +L+ S +RN QLEN
Sbjct:  495 QLENEKETDKRKVEEIIKDFQLKMENLNRSIEKLKLQLSQSENKFKSLQNENDNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLENEMAVNKRTIEEITKDFQLKKEDSNRSIEKLKLQLSQSENKCKSLQNENNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLEN 695          

HSP 2 Score: 55.4546 bits (132), Expect = 2.853e-9
Identity = 54/129 (41.86%), Postives = 77/129 (59.69%), Query Frame = 1
Query:  148 SQLETPNKYQTNINKRPY--SAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSEE-------ERTNLQSGNY----QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            SQLE+ N +++ +++  +  +AE   QL+NE    K K EE   D Q KM +LN SI  L L+L+QSE        E  N++SG      QL+S LKESD+    L +D++DCK +L+ S +RN QLEN
Sbjct:  469 SQLESANLFKSQMDRNRFENNAELIKQLENEKETDKRKVEEIIKDFQLKMENLNRSIEKLKLQLSQSENKFKSLQNENDNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLEN 597          

HSP 3 Score: 46.9802 bits (110), Expect = 2.381e-6
Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 1
Query:    1 NSQLENEMEINKRKIEEISKDYQLKMENS 87
            N QLENEM +NKR IEEI+KD+QLKME+S
Sbjct:  690 NLQLENEMAVNKRTIEEITKDFQLKMEDS 718          

HSP 4 Score: 45.8246 bits (107), Expect = 5.427e-6
Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 1
Query:  379 QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLE 492
            QL+S LKES  I  +L +D+DDCK +L  S +RNSQLE
Sbjct:  273 QLQSALKESKGINGRLQQDFDDCKVKLNHSQRRNSQLE 310          

HSP 5 Score: 45.4394 bits (106), Expect = 7.277e-6
Identity = 73/194 (37.63%), Postives = 103/194 (53.09%), Query Frame = 1
Query:    1 NSQLENEMEINKRKIEEISKDYQLKMENSXXXXXXXXXXXXXXXXXCK---------------ISQLETPNK------------YQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSEEERTNLQSGN-----------YQLESELKESDKIKNKLLKDYDDCKAELQRS 468
            N QLENEM +NKR IEEI+KD+QLK E+SN SIEKLKL+L   +N+CK               I QL++  K            ++    K  +S E   QL+NE A  K   EE T D Q KM D N+S   ++L+LN+SE++  +LQ+ N            +LE  +K+ ++ +  L   YD+CK    +S
Sbjct:  592 NLQLENEMAVNKRTIEEITKDFQLKKEDSNRSIEKLKLQLSQSENKCKSLQNENNIKSGFAAQIEQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLENEMAVNKRTIEEITKDFQLKMEDSNSSNEKMLLQLNRSEDKCKSLQNENDNDKSHFSGQIGKLELIIKQINEERQILQNKYDECKLRFNQS 785          
BLAST of SMED30022666 vs. Planmine SMEST
Match: SMESG000054716.1 (SMESG000054716.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.466e-10
Identity = 57/131 (43.51%), Postives = 73/131 (55.73%), Query Frame = 1
Query:  142 KISQLETPNKY--QTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMXXXXXXXXXXXXXXXQSEEERTNLQSGNY-----------QLESELKESDKIKNKLLKDYDDCKAELQRSAKRNSQLEN 495
            K+SQLE  N +  Q  IN     AE   QLQN+    K K EE   D Q KM D N SI  L L+L+QSE +  +LQ+ N            QL+S LKESD+    L +D++DCK +L+ S +RNSQL N
Sbjct:  256 KLSQLEYANHFKSQIGINHCANCAELIKQLQNQKETDKRKIEEIKKDFQLKMEDSNRSIEKLKLELSQSENKFQSLQNDNNNIISGFATQIEQLQSALKESDRKMRILQRDFEDCKGKLKHSQERNSQLVN 386          
The following BLAST results are available for this feature:
BLAST of SMED30022666 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022666 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038528.12.306e-7092.12SMESG000038528.1[more]
SMESG000047799.11.138e-6585.88SMESG000047799.1[more]
SMESG000036102.12.191e-1141.79SMESG000036102.1[more]
SMESG000036102.12.436e-1141.79SMESG000036102.1[more]
SMESG000054716.11.466e-1043.51SMESG000054716.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022666 ID=SMED30022666|Name=SMED30022666|organism=Schmidtea mediterranea sexual|type=transcript|length=496bp
AATTCACAATTGGAAAATGAAATGGAGATAAATAAAAGAAAAATTGAAGA
AATCTCAAAAGATTATCAGTTGAAAATGGAGAATTCAAATAATTCTATTG
AGAAGCTGAAATTGGAATTGAAAAACAAAGATAATGAGTGCAAAATTTCA
CAATTGGAAACACCAAATAAATATCAAACTAACATAAATAAACGTCCGTA
TTCTGCAGAATCGACAGGACAATTGCAAAATGAAAACGCGAGAGTTAAAA
GTAAAAATGAAGAATTTACAATTGATTGCCAATCGAAAATGAATGATTTA
AATAATAGTATTAATAATCTGATATTGAAATTGAATCAATCGGAAGAGGA
ACGCACAAACTTGCAGAGTGGAAATTATCAATTGGAATCAGAATTGAAGG
AATCAGATAAAATAAAAAACAAATTACTTAAGGATTATGACGATTGTAAA
GCGGAATTGCAACGTTCAGCGAAGAGAAATTCACAATTGGAAAATG
back to top

protein sequence of SMED30022666-orf-1

>SMED30022666-orf-1 ID=SMED30022666-orf-1|Name=SMED30022666-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
NSQLENEMEINKRKIEEISKDYQLKMENSNNSIEKLKLELKNKDNECKIS
QLETPNKYQTNINKRPYSAESTGQLQNENARVKSKNEEFTIDCQSKMNDL
NNSINNLILKLNQSEEERTNLQSGNYQLESELKESDKIKNKLLKDYDDCK
AELQRSAKRNSQLEN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR009605DUF1216
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..53
NoneNo IPR availableCOILSCoilCoilcoord: 97..165
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 84..137
IPR009605Domain of unknown function DUF1216PFAMPF06746DUF1216coord: 79..143
e-value: 1.0E-4
score: 22.3