Stromal interaction molecule 1

Overview
NameStromal interaction molecule 1
Smed IDSMED30022653
Length (bp)2011
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Stromal interaction molecule 1 (SMED30022653) t-SNE clustered cells

Violin plots show distribution of expression levels for Stromal interaction molecule 1 (SMED30022653) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Stromal interaction molecule 1 (SMED30022653) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Stromal interaction molecule 1 (SMED30022653) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022653

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022653SMESG000081265.1 dd_Smed_v4_12888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022653SMESG000081265.1 dd_Smed_v4_12888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Stromal interaction molecule 1 vs. Ensembl Human
Match: STIM1 (stromal interaction molecule 1 [Source:HGNC Symbol;Acc:HGNC:11386])

HSP 1 Score: 170.629 bits (431), Expect = 4.297e-45
Identity = 142/481 (29.52%), Postives = 236/481 (49.06%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQNSN 1654
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  +++ WL   VELPQYE  F  L+L+G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ  +
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRGS 516          
BLAST of Stromal interaction molecule 1 vs. Ensembl Human
Match: STIM1 (stromal interaction molecule 1 [Source:HGNC Symbol;Acc:HGNC:11386])

HSP 1 Score: 169.088 bits (427), Expect = 8.639e-44
Identity = 142/478 (29.71%), Postives = 235/478 (49.16%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQ 1645
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  +++ WL   VELPQYE  F  L+L+G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQ 513          
BLAST of Stromal interaction molecule 1 vs. Ensembl Human
Match: STIM1 (stromal interaction molecule 1 [Source:HGNC Symbol;Acc:HGNC:11386])

HSP 1 Score: 169.859 bits (429), Expect = 1.171e-43
Identity = 142/478 (29.71%), Postives = 235/478 (49.16%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRS-----QHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQ 1645
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  +++ WL   VELPQYE  F  L+L+G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS     + E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQ 513          
BLAST of Stromal interaction molecule 1 vs. Ensembl Human
Match: STIM2 (stromal interaction molecule 2 [Source:HGNC Symbol;Acc:HGNC:19205])

HSP 1 Score: 162.155 bits (409), Expect = 8.235e-42
Identity = 124/414 (29.95%), Postives = 204/414 (49.28%), Query Frame = 2
Query:  266 ACVNNHSKC--NKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ---LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSRSQH---EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
             C++    C   +D     A+  +H Q+DDDK+G I++ ES +F+ E +       K    H+ D HI  +DLW  WK+SE +NWT  D + WL   VELPQYE  F    + G++L R+   E  F+++ +KI +  HR+K+ +KA+D VLFG + R     +    +  ++   V    +   QN  SK  V  M   L+ +   E+SL +L+E+LE  +        E Q +E +   EI  A      +   RE   C+ SR Q+   E+ ++R AL +A+ +    +R S S             L   LQLT  +E+Q    K    + Q +   +  +K+ KK++   G+  + HSS +D+++      K+A  ++    +E+  RW Q+E I GF +   + +P+L
Sbjct:   52 PCMSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFE--LRSSWSVPD---------ALQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKALSELTTCLRERLFRWQQIEKICGFQIAHNSGLPSL 454          
BLAST of Stromal interaction molecule 1 vs. Ensembl Human
Match: STIM2 (stromal interaction molecule 2 [Source:HGNC Symbol;Acc:HGNC:19205])

HSP 1 Score: 162.54 bits (410), Expect = 2.358e-41
Identity = 124/414 (29.95%), Postives = 204/414 (49.28%), Query Frame = 2
Query:  266 ACVNNHSKC--NKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ---LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSRSQH---EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
             C++    C   +D     A+  +H Q+DDDK+G I++ ES +F+ E +       K    H+ D HI  +DLW  WK+SE +NWT  D + WL   VELPQYE  F    + G++L R+   E  F+++ +KI +  HR+K+ +KA+D VLFG + R     +    +  ++   V    +   QN  SK  V  M   L+ +   E+SL +L+E+LE  +        E Q +E +   EI  A      +   RE   C+ SR Q+   E+ ++R AL +A+ +    +R S S             L   LQLT  +E+Q    K    + Q +   +  +K+ KK++   G+  + HSS +D+++      K+A  ++    +E+  RW Q+E I GF +   + +P+L
Sbjct:   52 PCMSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFE--LRSSWSVPD---------ALQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKALSELTTCLRERLFRWQQIEKICGFQIAHNSGLPSL 454          
BLAST of Stromal interaction molecule 1 vs. Ensembl Celegans
Match: stim-1 (Stromal interaction molecule 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EF60])

HSP 1 Score: 98.2117 bits (243), Expect = 3.017e-21
Identity = 107/388 (27.58%), Postives = 185/388 (47.68%), Query Frame = 2
Query:  296 KDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAK---KFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGM--EFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFE-IQQM--EERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLV--HSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNL 1429
            +D+L Y AI ++H  +DDD +G ID  ES  F++E + + +G+E+ +   KFH  D  I   DLW  W  S    WT   L+ WL  +V LP       + K++G  L R      +FL   + I +S++R+K+ + ++D VLFG       TK  ++A L   ++ + +L         +V+  Q   + +++    LTEL+           + +FE +Q+M  +ER           S+ S+ D   +  E+  LR  L EA+       R+  + +  S+ P     L  LL+ T   E+  L ++     ++  E +E+  ++ KK+ + L S KL    +S  D ++    + K   EK+    +E + RW Q+E++ GF L
Sbjct:   39 RDKLGYEAIRDIHRDMDDDHSGSIDRNESTGFMKEDM-QMRGSERTRRENKFHGDDDAITVDDLWEAWFESIERTWTNERLVEWLINDVNLPSIVEAVKAKKIDGKILPRFASPNSDFLNKELGIKSSVYRQKLRLNSLDVVLFGYKDNNNRTKDILLAFLALLLTSLIFL---------YVRQKQKAQQKVNELSNKLTELKCM---------ETEFEDVQKMLNDER-----------SKRSISDGVVNHTEMENLRVQLEEAE-------RRLEANSNGSQAP---LALQPLLRRTCENEMAFLEKQRQDCFKEMKEAIEMVDRLQKKQGSVLSSLKLATGAASTSDQVDSKIFALKSRMEKIHTLTRETQERWLQIESLCGFPL 386          
BLAST of Stromal interaction molecule 1 vs. Ensembl Celegans
Match: stim-1 (Stromal interaction molecule 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EF60])

HSP 1 Score: 97.8265 bits (242), Expect = 3.455e-21
Identity = 121/453 (26.71%), Postives = 206/453 (45.47%), Query Frame = 2
Query:  296 KDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAK---KFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGM--EFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFE-IQQM--EERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLV--HSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQ----KRESPMFMTSSDT-----VDSLNSVSIHDSQGSPKSEN 1597
            +D+L Y AI ++H  +DDD +G ID  ES  F++E + + +G+E+ +   KFH  D  I   DLW  W  S    WT   L+ WL  +V LP       + K++G  L R      +FL   + I +S++R+K+ + ++D VLFG       TK  ++A L   ++ + +L         +V+  Q   + +++    LTEL+           + +FE +Q+M  +ER           S+ S+ D   +  E+  LR  L EA+       R+  + +  S+ P     L  LL+ T   E+  L ++     ++  E +E+  ++ KK+ + L S KL    +S  D ++    + K   EK+    +E + RW Q+E++ GF L  +    +   + + H           K+ SP    S  T     V +  S SIH    SP  E+
Sbjct:   39 RDKLGYEAIRDIHRDMDDDHSGSIDRNESTGFMKEDM-QMRGSERTRRENKFHGDDDAITVDDLWEAWFESIERTWTNERLVEWLINDVNLPSIVEAVKAKKIDGKILPRFASPNSDFLNKELGIKSSVYRQKLRLNSLDVVLFGYKDNNNRTKDILLAFLALLLTSLIFL---------YVRQKQKAQQKVNELSNKLTELKCM---------ETEFEDVQKMLNDER-----------SKRSISDGVVNHTEMENLRVQLEEAE-------RRLEANSNGSQAP---LALQPLLRRTCENEMAFLEKQRQDCFKEMKEAIEMVDRLQKKQGSVLSSLKLATGAASTSDQVDSKIFALKSRMEKIHTLTRETQERWLQIESLCGFPLLYLNGSSSSGSISNAHSNPNAVNSNFVKKVSPPIPPSQQTANLRFVPTEQSDSIHSEDTSPIVED 451          
BLAST of Stromal interaction molecule 1 vs. Ensembl Celegans
Match: stim-1 (Stromal interaction molecule 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EF60])

HSP 1 Score: 96.6709 bits (239), Expect = 3.855e-21
Identity = 107/388 (27.58%), Postives = 185/388 (47.68%), Query Frame = 2
Query:  296 KDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAK---KFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGM--EFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFE-IQQM--EERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLV--HSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNL 1429
            +D+L Y AI ++H  +DDD +G ID  ES  F++E + + +G+E+ +   KFH  D  I   DLW  W  S    WT   L+ WL  +V LP       + K++G  L R      +FL   + I +S++R+K+ + ++D VLFG       TK  ++A L   ++ + +L         +V+  Q   + +++    LTEL+           + +FE +Q+M  +ER           S+ S+ D   +  E+  LR  L EA+       R+  + +  S+ P     L  LL+ T   E+  L ++     ++  E +E+  ++ KK+ + L S KL    +S  D ++    + K   EK+    +E + RW Q+E++ GF L
Sbjct:   39 RDKLGYEAIRDIHRDMDDDHSGSIDRNESTGFMKEDM-QMRGSERTRRENKFHGDDDAITVDDLWEAWFESIERTWTNERLVEWLINDVNLPSIVEAVKAKKIDGKILPRFASPNSDFLNKELGIKSSVYRQKLRLNSLDVVLFGYKDNNNRTKDILLAFLALLLTSLIFL---------YVRQKQKAQQKVNELSNKLTELK---------CMETEFEDVQKMLNDER-----------SKRSISDGVVNHTEMENLRVQLEEAE-------RRLEANSNGSQAP---LALQPLLRRTCENEMAFLEKQRQDCFKEMKEAIEMVDRLQKKQGSVLSSLKLATGAASTSDQVDSKIFALKSRMEKIHTLTRETQERWLQIESLCGFPL 386          
BLAST of Stromal interaction molecule 1 vs. Ensembl Fly
Match: Stim (gene:FBgn0045073 transcript:FBtr0303567)

HSP 1 Score: 167.162 bits (422), Expect = 4.334e-44
Identity = 135/442 (30.54%), Postives = 218/442 (49.32%), Query Frame = 2
Query:  236 NDFDAFEISVACVNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKK-FH-KTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQLTKTSIVATLFFFVSIIA--YLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIV----ENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSS 1531
            +DFD +  SV          +D     AI+ LH Q+DDD NG+ID++ES DF+ E L    G EK +K FH   D HI  ++LW  W  SE +NWT      WL   V+LPQY  +F   K+ G++L RL    ++++ NV+ I + IH++KI +KA+D VLFG  +         +       +II   Y   QN  +KR ++ M   ++ + + E+SL E++++LE      EN+  +K      +E R K   T  ++SS   L        E+ +L+    E ++  N L R       N   P    QL   LQ T  +E +N  +K  + ++Q     E  +K+ KK+++ +G+F   H   +DD+++     + A   V  E +E+  RW Q+E   G N+     +P L  +++     G +   +S M M+S+
Sbjct:  129 DDFDCYSGSV----------QDRFGMEAIASLHRQLDDDDNGNIDLSESDDFLREELKYDSGYEKRQKAFHFNDDMHISVKELWEAWLRSEVHNWTIEQTTDWLAQSVQLPQYVDLFKLHKVTGAALPRLAVNNLQYVGNVLGIKDPIHKQKISLKAMDVVLFGPPRETGTRWKDYILVTLLLSAIIGCWYAYQQNKNAKRHLRRMAQDMEGLQRAEQSLQEMQKELERARMEQENVATEK----LDLERRLKEAPT--LSSSNSDL--------EVQQLK---KEIEMLRNELSRAEFELVDNCWSP--PPQLQSWLQYTYELESKNHQKKRTSAEKQLQSAREACEKLRKKRSSLVGAFVSTHGKSIDDVDRSIVEARNALGDVTNELQERLHRWKQIETCLGLNIVNNNGLPYLENVLY-----GRNGGLQSSMGMSST 536          
BLAST of Stromal interaction molecule 1 vs. Ensembl Fly
Match: Stim (gene:FBgn0045073 transcript:FBtr0074159)

HSP 1 Score: 167.162 bits (422), Expect = 4.604e-44
Identity = 135/442 (30.54%), Postives = 218/442 (49.32%), Query Frame = 2
Query:  236 NDFDAFEISVACVNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKK-FH-KTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQLTKTSIVATLFFFVSIIA--YLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIV----ENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSS 1531
            +DFD +  SV          +D     AI+ LH Q+DDD NG+ID++ES DF+ E L    G EK +K FH   D HI  ++LW  W  SE +NWT      WL   V+LPQY  +F   K+ G++L RL    ++++ NV+ I + IH++KI +KA+D VLFG  +         +       +II   Y   QN  +KR ++ M   ++ + + E+SL E++++LE      EN+  +K      +E R K   T  ++SS   L        E+ +L+    E ++  N L R       N   P    QL   LQ T  +E +N  +K  + ++Q     E  +K+ KK+++ +G+F   H   +DD+++     + A   V  E +E+  RW Q+E   G N+     +P L  +++     G +   +S M M+S+
Sbjct:  129 DDFDCYSGSV----------QDRFGMEAIASLHRQLDDDDNGNIDLSESDDFLREELKYDSGYEKRQKAFHFNDDMHISVKELWEAWLRSEVHNWTIEQTTDWLAQSVQLPQYVDLFKLHKVTGAALPRLAVNNLQYVGNVLGIKDPIHKQKISLKAMDVVLFGPPRETGTRWKDYILVTLLLSAIIGCWYAYQQNKNAKRHLRRMAQDMEGLQRAEQSLQEMQKELERARMEQENVATEK----LDLERRLKEAPT--LSSSNSDL--------EVQQLK---KEIEMLRNELSRAEFELVDNCWSP--PPQLQSWLQYTYELESKNHQKKRTSAEKQLQSAREACEKLRKKRSSLVGAFVSTHGKSIDDVDRSIVEARNALGDVTNELQERLHRWKQIETCLGLNIVNNNGLPYLENVLY-----GRNGGLQSSMGMSST 536          
BLAST of Stromal interaction molecule 1 vs. Ensembl Zebrafish
Match: stim2a (tromal interaction molecule 2a [Source:ZFIN;Acc:ZDB-GENE-130530-765])

HSP 1 Score: 177.563 bits (449), Expect = 3.996e-46
Identity = 125/414 (30.19%), Postives = 214/414 (51.69%), Query Frame = 2
Query:  266 ACVNNHSKC--NKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ---LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRE-------SLCDDSR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
             C+     C    D     A+  +H ++DDD++G I++ ES +F+ E + + Q A K  K H  D HI  ++LW  WKSSE +NWT  D++ WLR  VELPQYE  F  L+++G++L R+   E  F+ + +KI +  H++K+ +KA+D VLFG   R     L    ++ ++   +    +  +Q+  SK  +  M   L+ + + E+SL +L+E+LE  +  K     E + +EE+ + EI  A   +         ++ + SR   ++ E+ ++R AL  A+  +  L     S             L L LQLT  +E+Q    K  + ++Q     +  +K+ KK+++ LG+  + HSS +D +++     K A  +V    +E+  RW Q+E++ GF L K A +P L
Sbjct:   42 TCLQMSPPCITEADRFSLEALQHIHREMDDDQDGGIEVEESVEFIIEDMQQQQQANKHSKLHHEDQHITLEELWRSWKSSEVHNWTQEDVLQWLREFVELPQYEKSFKELRVSGNTLPRIASNEPSFMSSYLKIQDQQHKQKLKLKALDVVLFGPPIRPPHNWLKDVLLIVSIVMGIGGCWFAHVQSKSSKVHISKMMKDLESLQRAEQSLRDLQEQLEKAQEEKRTVTVEKKNLEEKMRDEIQGAQEEANRLHRLRDGAVTELSRLWYAEEELEQVRGALKRAEKDMQTLWSVPES-------------LQLWLQLTHEVEVQYYNVKKQSAEQQLITAKDEAEKIKKKRSSVLGTLHVAHSSSLDQVDQRILEAKNALAEVTACLRERLHRWQQIESLCGFPLMKNAGLPNL 442          
BLAST of Stromal interaction molecule 1 vs. Ensembl Zebrafish
Match: stim2b (stromal interaction molecule 2b [Source:ZFIN;Acc:ZDB-GENE-120404-3])

HSP 1 Score: 168.703 bits (426), Expect = 1.139e-43
Identity = 129/423 (30.50%), Postives = 213/423 (50.35%), Query Frame = 2
Query:  239 DFDAFEISVACVNNHSKCN--KDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ---LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
            D  A   +  C      C    D     A+  +H Q+DDD +G I++ ES +F+ E + + Q   K    H+ D HI  ++LW  WK SE +NWT  D++ WL+  VELPQYE  F   K++G++L R+   E  F+   +KI +  H++K+ +KA+DAVLFG   R+    L    ++ ++   V    +  IQN  SK  +  M   L+ +   EESLTEL+ +LE  +        E Q +E++ + EIT A      +   RE   C+ SR   ++ E+ ++R AL  A+ Q+            +  LP     L + LQLT  +E+Q    K    + Q +   +  +K+ KK+++  G+  + HSS +D+++      K+A  +V    +E+  RW Q+E + GF +   + +P+L
Sbjct:   38 DPAAVAPTDPCSAVMPPCTNEADRFSLEALRHIHKQLDDDNDGAIEVNESVEFIIEDMKQHQ-TNKHSNLHREDQHITVEELWRGWKISEVHNWTLEDVVEWLKESVELPQYERNFREFKVDGNTLPRIAANEPAFMSMQLKILDQRHKQKLNLKALDAVLFGPPLRHHYHWLKDFILMISIIIGVGGCWFAYIQNKSSKIHISQMMKDLESLQHAEESLTELQSRLEKAQEENRTVAVEKQNLEQKMRDEITGAKKEASRLRELREGAECELSRLKYAEEELVQVRMALKRAEKQMQ----------SDWSLP---EALQMWLQLTHEVEVQYYNIKKQNAELQLTVAKDEAEKIKKKRSSVFGTLHVAHSSSLDEVDHKILEAKKALSEVTACLRERLHRWQQIERLCGFPVVNNSGLPSL 446          
BLAST of Stromal interaction molecule 1 vs. Ensembl Zebrafish
Match: stim1a (stromal interaction molecule 1a [Source:ZFIN;Acc:ZDB-GENE-060503-914])

HSP 1 Score: 159.844 bits (403), Expect = 9.227e-42
Identity = 131/418 (31.34%), Postives = 213/418 (50.96%), Query Frame = 2
Query:  257 ISVACVNNHSKCNKDE---LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLL--NVVKIHNSIHRKKIMIKAVDAVLFGS--IKRY-QLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRES----LCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
            +S  C  +   C +DE   L + AI  +H Q+DDD NG++D+ E+  F+ E L+      K   FH  D  I  +DLW+ WKSSE YNWT  +++ WL   VEL QY      L  +G+++ RL      L   V+KI +  H +K+ +KA+D VLFG+  + R+  L    +V ++   +    +  IQN +SK  +K M   L  + + E+SL +L++KL+I +      + E   +E++ + EI  A      +   RE     L     ++ E+ ++R AL +A+ ++    R S S       P ++  L   LQLT  +E+Q    K    +RQ     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E +TGF L     +P+L
Sbjct:   39 VSELCRIDEPLC-QDENAILSFEAIRSIHKQMDDDDNGNVDVLETDGFLREDLNYHDPKGKHNTFHGDDQFISVEDLWNAWKSSEVYNWTVDEVVKWLIDYVELTQYVEAIKKLNFSGTAMPRLAVKNNTLTQTVLKILDRSHVQKLQLKALDTVLFGAPMMNRHNHLKDFMLVVSIVIGMGGCWFAYIQNRHSKDHMKKMMKDLDSLQRAEQSLHDLQQKLQIAQEEHRSVEVEKVNLEQKLRDEINTAKQEAQRLKELREGTENELSRQKYAEEELEQVRMALKKAEKELES--RSSWS-------PPEA--LQKWLQLTHEVEVQYYNIKKQNAERQLQVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILAAKQALGEVTAALRERLHRWQQIELLTGFTLVHNPGLPSL 444          
BLAST of Stromal interaction molecule 1 vs. Ensembl Zebrafish
Match: stim1a (stromal interaction molecule 1a [Source:ZFIN;Acc:ZDB-GENE-060503-914])

HSP 1 Score: 160.614 bits (405), Expect = 3.978e-41
Identity = 130/418 (31.10%), Postives = 211/418 (50.48%), Query Frame = 2
Query:  257 ISVACVNNHSKCNKDE---LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLL--NVVKIHNSIHRKKIMIKAVDAVLFGSI---KRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRES----LCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
            +S  C  +   C +DE   L + AI  +H Q+DDD NG++D+ E+  F+ E L+      K   FH  D  I  +DLW+ WKSSE YNWT  +++ WL   VEL QY      L  +G+++ RL      L   V+KI +  H +K+ +KA+D VLFG+    +   L    +V ++   +    +  IQN +SK  +K M   L  + + E+SL +L++KL+I +      + E   +E++ + EI  A      +   RE     L     ++ E+ ++R AL +A+ ++    R S S       P ++  L   LQLT  +E+Q    K    +RQ     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E +TGF L     +P+L
Sbjct:   39 VSELCRIDEPLC-QDENAILSFEAIRSIHKQMDDDDNGNVDVLETDGFLREDLNYHDPKGKHNTFHGDDQFISVEDLWNAWKSSEVYNWTVDEVVKWLIDYVELTQYVEAIKKLNFSGTAMPRLAVKNNTLTQTVLKILDRSHVQKLQLKALDTVLFGAPMMNRHNHLKDFMLVVSIVIGMGGCWFAYIQNRHSKDHMKKMMKDLDSLQRAEQSLHDLQQKLQIAQEEHRSVEVEKVNLEQKLRDEINTAKQEAQRLKELREGTENELSRQKYAEEELEQVRMALKKAEKELES--RSSWS-------PPEA--LQKWLQLTHEVEVQYYNIKKQNAERQLQVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILAAKQALGEVTAALRERLHRWQQIELLTGFTLVHNPGLPSL 444          
BLAST of Stromal interaction molecule 1 vs. Ensembl Zebrafish
Match: stim1a (stromal interaction molecule 1a [Source:ZFIN;Acc:ZDB-GENE-060503-914])

HSP 1 Score: 159.844 bits (403), Expect = 8.405e-41
Identity = 130/418 (31.10%), Postives = 211/418 (50.48%), Query Frame = 2
Query:  257 ISVACVNNHSKCNKDE---LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLL--NVVKIHNSIHRKKIMIKAVDAVLFGSI---KRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRES----LCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
            +S  C  +   C +DE   L + AI  +H Q+DDD NG++D+ E+  F+ E L+      K   FH  D  I  +DLW+ WKSSE YNWT  +++ WL   VEL QY      L  +G+++ RL      L   V+KI +  H +K+ +KA+D VLFG+    +   L    +V ++   +    +  IQN +SK  +K M   L  + + E+SL +L++KL+I +      + E   +E++ + EI  A      +   RE     L     ++ E+ ++R AL +A+ ++    R S S       P ++  L   LQLT  +E+Q    K    +RQ     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E +TGF L     +P+L
Sbjct:   39 VSELCRIDEPLC-QDENAILSFEAIRSIHKQMDDDDNGNVDVLETDGFLREDLNYHDPKGKHNTFHGDDQFISVEDLWNAWKSSEVYNWTVDEVVKWLIDYVELTQYVEAIKKLNFSGTAMPRLAVKNNTLTQTVLKILDRSHVQKLQLKALDTVLFGAPMMNRHNHLKDFMLVVSIVIGMGGCWFAYIQNRHSKDHMKKMMKDLDSLQRAEQSLHDLQQKLQIAQEEHRSVEVEKVNLEQKLRDEINTAKQEAQRLKELREGTENELSRQKYAEEELEQVRMALKKAEKELES--RSSWS-------PPEA--LQKWLQLTHEVEVQYYNIKKQNAERQLQVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILAAKQALGEVTAALRERLHRWQQIELLTGFTLVHNPGLPSL 444          
BLAST of Stromal interaction molecule 1 vs. Ensembl Xenopus
Match: stim1 (stromal interaction molecule 1 [Source:NCBI gene;Acc:403095])

HSP 1 Score: 158.303 bits (399), Expect = 3.513e-40
Identity = 125/419 (29.83%), Postives = 204/419 (48.69%), Query Frame = 2
Query:  293 NKDEL-EYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVE---------------------NIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLI 1468
            N DEL  + A+  +H Q+DDD NG++D+ ES +F+ E L+      K   FH  D  I  +DLW+ WK+SE YNWT  ++  WL   VELPQYE  F  L+L+G  + RL          ++K+ +   R+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L+  +                     ++  Q+   ++++ E  + E++R   + +E LC           +R AL  A+ ++      SA  A           L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF   +I + P L  L+
Sbjct:   37 NADELLSFEAVMSIHKQMDDDANGNVDVEESDEFLREDLNYHDPTAKHSTFHGEDKLISVEDLWNSWKTSEVYNWTVDEVAQWLITYVELPQYEETFRKLQLSGRDMPRLAIANATMTGTLLKMTDRSQRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKDHMKKMMKDLEGLHRAEQSLHDLQERLQKAQEEHRTVEVEKVHLEKKLQNEISLAKQEAHRLRELREGTENELSRQKYAEQEELC---------TWVRMALKNAEKELESHSNWSAPEA-----------LQKWLQLTHEVEVQYYNIKKQNAEKQLLLAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIETLCGF---QIVNNPGLHALM 432          
BLAST of Stromal interaction molecule 1 vs. Ensembl Xenopus
Match: stim1 (stromal interaction molecule 1 [Source:NCBI gene;Acc:403095])

HSP 1 Score: 157.918 bits (398), Expect = 8.984e-40
Identity = 125/419 (29.83%), Postives = 204/419 (48.69%), Query Frame = 2
Query:  293 NKDEL-EYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVE---------------------NIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLI 1468
            N DEL  + A+  +H Q+DDD NG++D+ ES +F+ E L+      K   FH  D  I  +DLW+ WK+SE YNWT  ++  WL   VELPQYE  F  L+L+G  + RL          ++K+ +   R+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L+  +                     ++  Q+   ++++ E  + E++R   + +E LC           +R AL  A+ ++      SA  A           L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF   +I + P L  L+
Sbjct:   62 NADELLSFEAVMSIHKQMDDDANGNVDVEESDEFLREDLNYHDPTAKHSTFHGEDKLISVEDLWNSWKTSEVYNWTVDEVAQWLITYVELPQYEETFRKLQLSGRDMPRLAIANATMTGTLLKMTDRSQRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKDHMKKMMKDLEGLHRAEQSLHDLQERLQKAQEEHRTVEVEKVHLEKKLQNEISLAKQEAHRLRELREGTENELSRQKYAEQEELC---------TWVRMALKNAEKELESHSNWSAPEA-----------LQKWLQLTHEVEVQYYNIKKQNAEKQLLLAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIETLCGF---QIVNNPGLHALM 457          
BLAST of Stromal interaction molecule 1 vs. Ensembl Xenopus
Match: stim1 (stromal interaction molecule 1 [Source:NCBI gene;Acc:403095])

HSP 1 Score: 152.525 bits (384), Expect = 1.774e-38
Identity = 110/386 (28.50%), Postives = 181/386 (46.89%), Query Frame = 2
Query:  389 FVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVE---------------------NIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLI 1468
            F+ E L+      K   FH  D  I  +DLW+ WK+SE YNWT  ++  WL   VELPQYE  F  L+L+G  + RL          ++K+ +   R+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L+  +                     ++  Q+   ++++ E  + E++R   + +E LC           +R AL  A+ ++      SA  A           L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF   +I + P L  L+
Sbjct:    5 FLREDLNYHDPTAKHSTFHGEDKLISVEDLWNSWKTSEVYNWTVDEVAQWLITYVELPQYEETFRKLQLSGRDMPRLAIANATMTGTLLKMTDRSQRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKDHMKKMMKDLEGLHRAEQSLHDLQERLQKAQEEHRTVEVEKVHLEKKLQNEISLAKQEAHRLRELREGTENELSRQKYAEQEELC---------TWVRMALKNAEKELESHSNWSAPEA-----------LQKWLQLTHEVEVQYYNIKKQNAEKQLLLAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIETLCGF---QIVNNPGLHALM 367          
BLAST of Stromal interaction molecule 1 vs. Ensembl Xenopus
Match: pgm1 (phosphoglucomutase 1 [Source:Xenbase;Acc:XB-GENE-948527])

HSP 1 Score: 113.62 bits (283), Expect = 2.130e-26
Identity = 98/342 (28.65%), Postives = 160/342 (46.78%), Query Frame = 2
Query:  506 YNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLLNV--VKIHNSIHRKKIMIKAVDAVLFGSIKR--YQLTKTSIVA-TLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNL------AEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLI 1468
            +NWT  + + WL   VELPQYE  F    + G++L R+   E +L +  +KI +  HR+K  +KA+D VLFG   R  +   K  I+  ++   V    +   QN  SK  +  M   L+ + K E SL EL+++LE  +        E Q +E +   EI+ A      +   RE   C+ SR   ++ E+ ++R AL +A+        K      N  +P     L   LQLT  +E+Q        AE   AI +  +E      K+ KK++   G+  + HSS +D+++      K+A  ++    +E+  RW Q+E + GF +  +    T   +I
Sbjct:   14 HNWTEEETLQWLLEFVELPQYEKNFRENSVKGTALPRIAVNEPVLMISQLKITDRSHRQKFQLKALDVVLFGPPTRPPHNWVKDFILTISIVIGVGGCWFAYSQNRTSKEHISQMMKDLEGLQKAEISLLELQDRLEKAQEENRTVAVEKQNLERKMMDEISDAKREAHRLRELREGTECELSRLKYAEEELVQVRMALKKAE--------KEFELRSNWSVP---ETLQKWLQLTHEVEVQYYNIKKQNAEMHLAIAKDEAE------KIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKALSELTTCLRERLYRWQQIEKMCGFPIVHVVFFSTYTHII 338          
BLAST of Stromal interaction molecule 1 vs. Ensembl Xenopus
Match: ENSXETT00000030975.1 (stromal interaction molecule 2-like [Source:NCBI gene;Acc:101731659])

HSP 1 Score: 113.62 bits (283), Expect = 2.130e-26
Identity = 98/342 (28.65%), Postives = 160/342 (46.78%), Query Frame = 2
Query:  506 YNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLLNV--VKIHNSIHRKKIMIKAVDAVLFGSIKR--YQLTKTSIVA-TLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNL------AEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLI 1468
            +NWT  + + WL   VELPQYE  F    + G++L R+   E +L +  +KI +  HR+K  +KA+D VLFG   R  +   K  I+  ++   V    +   QN  SK  +  M   L+ + K E SL EL+++LE  +        E Q +E +   EI+ A      +   RE   C+ SR   ++ E+ ++R AL +A+        K      N  +P     L   LQLT  +E+Q        AE   AI +  +E      K+ KK++   G+  + HSS +D+++      K+A  ++    +E+  RW Q+E + GF +  +    T   +I
Sbjct:   14 HNWTEEETLQWLLEFVELPQYEKNFRENSVKGTALPRIAVNEPVLMISQLKITDRSHRQKFQLKALDVVLFGPPTRPPHNWVKDFILTISIVIGVGGCWFAYSQNRTSKEHISQMMKDLEGLQKAEISLLELQDRLEKAQEENRTVAVEKQNLERKMMDEISDAKREAHRLRELREGTECELSRLKYAEEELVQVRMALKKAE--------KEFELRSNWSVP---ETLQKWLQLTHEVEVQYYNIKKQNAEMHLAIAKDEAE------KIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKALSELTTCLRERLYRWQQIEKMCGFPIVHVVFFSTYTHII 338          
BLAST of Stromal interaction molecule 1 vs. Ensembl Mouse
Match: Stim1 (stromal interaction molecule 1 [Source:MGI Symbol;Acc:MGI:107476])

HSP 1 Score: 173.326 bits (438), Expect = 2.753e-46
Identity = 144/481 (29.94%), Postives = 235/481 (48.86%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQNSN 1654
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  ++I WL   VELPQYE  F  L+L G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    +RQ     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ  +
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLITYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAERQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQLGLGSQRGS 516          
BLAST of Stromal interaction molecule 1 vs. Ensembl Mouse
Match: Stim1 (stromal interaction molecule 1 [Source:MGI Symbol;Acc:MGI:107476])

HSP 1 Score: 171.785 bits (434), Expect = 6.449e-45
Identity = 144/478 (30.13%), Postives = 234/478 (48.95%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQ 1645
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  ++I WL   VELPQYE  F  L+L G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    +RQ     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLITYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAERQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQLGLGSQ 513          
BLAST of Stromal interaction molecule 1 vs. Ensembl Mouse
Match: Stim1 (stromal interaction molecule 1 [Source:MGI Symbol;Acc:MGI:107476])

HSP 1 Score: 172.555 bits (436), Expect = 1.003e-44
Identity = 144/478 (30.13%), Postives = 234/478 (48.95%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQ 1645
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  ++I WL   VELPQYE  F  L+L G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    +RQ     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLITYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAERQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQLGLGSQ 513          
BLAST of Stromal interaction molecule 1 vs. Ensembl Mouse
Match: Stim2 (stromal interaction molecule 2 [Source:MGI Symbol;Acc:MGI:2151156])

HSP 1 Score: 162.155 bits (409), Expect = 2.393e-41
Identity = 126/414 (30.43%), Postives = 206/414 (49.76%), Query Frame = 2
Query:  266 ACVNNHSKC--NKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKR--YQLTKTSIVA-TLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSRSQH---EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
             C++    C   +D     A+  +H Q+DDDK+G I++ ES +F+ E +       K    H+ D HI  +DLW  WK+SE +NWT  D + WL   VELPQYE  F    + G++L R+   E  F+++ +KI +  HR+K+ +KA+D VLFG + R  +   K  I+  ++   V    +   QN  SK  V  M   L+ +   E+SL +L+E+LE  +        E Q +E +   EI  A      +   RE   C+ SR Q+   E+ ++R AL +A+ +    +R S S             L   LQLT  +E+Q    K    + Q +   +  +K+ KK++   G+  + HSS +D+++      K+A  ++    +E+  RW Q+E I GF +   + +P+L
Sbjct:   52 PCMSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVDESDEFIREDMKYKDATNKHSHLHREDKHITVEDLWKQWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHETSFMISQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTISIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRTVAVEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFE--LRSSWSVPD---------ALQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKALSELTTCLRERLFRWQQIEKICGFQIAHNSGLPSL 454          
BLAST of Stromal interaction molecule 1 vs. Ensembl Mouse
Match: Stim2 (stromal interaction molecule 2 [Source:MGI Symbol;Acc:MGI:2151156])

HSP 1 Score: 161.77 bits (408), Expect = 2.833e-41
Identity = 128/422 (30.33%), Postives = 210/422 (49.76%), Query Frame = 2
Query:  266 ACVNNHSKC--NKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKR--YQLTKTSIVA-TLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSRSQH---EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIEL-------QNLAEKIA-AIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
             C++    C   +D     A+  +H Q+DDDK+G I++ ES +F+ E +       K    H+ D HI  +DLW  WK+SE +NWT  D + WL   VELPQYE  F    + G++L R+   E  F+++ +KI +  HR+K+ +KA+D VLFG + R  +   K  I+  ++   V    +   QN  SK  V  M   L+ +   E+SL +L+E+LE  +        E Q +E +   EI  A      +   RE   C+ SR Q+   E+ ++R AL +A+ +    +R S S             L   LQLT  +E+       QN   ++A A D   + ++   +K+ KK++   G+  + HSS +D+++      K+A  ++    +E+  RW Q+E I GF +   + +P+L
Sbjct:   52 PCMSLSPPCFTEEDRFSLEALQTIHKQMDDDKDGGIEVDESDEFIREDMKYKDATNKHSHLHREDKHITVEDLWKQWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHETSFMISQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTISIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRTVAVEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFE--LRSSWSVPD---------ALQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDEVAASYLLQAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKALSELTTCLRERLFRWQQIEKICGFQIAHNSGLPSL 462          
BLAST of Stromal interaction molecule 1 vs. UniProt/SwissProt
Match: sp|P70302|STIM1_MOUSE (Stromal interaction molecule 1 OS=Mus musculus OX=10090 GN=Stim1 PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 4.511e-44
Identity = 144/478 (30.13%), Postives = 234/478 (48.95%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQ 1645
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  ++I WL   VELPQYE  F  L+L G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    +RQ     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLITYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAERQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQLGLGSQ 513          
BLAST of Stromal interaction molecule 1 vs. UniProt/SwissProt
Match: sp|P84903|STIM1_RAT (Stromal interaction molecule 1 OS=Rattus norvegicus OX=10116 GN=Stim1 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.884e-43
Identity = 143/478 (29.92%), Postives = 234/478 (48.95%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQ 1645
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WK+SE YNWT  ++I WL   VELPQYE  F  L+L G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    +RQ     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKASEVYNWTVDEVIQWLITYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAERQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQ 513          
BLAST of Stromal interaction molecule 1 vs. UniProt/SwissProt
Match: sp|Q58CP9|STIM1_BOVIN (Stromal interaction molecule 1 OS=Bos taurus OX=9913 GN=STIM1 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 3.957e-43
Identity = 142/478 (29.71%), Postives = 235/478 (49.16%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQ 1645
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  +++ WL   VELPQYE  F  L+L+G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ
Sbjct:   47 CRIDKPLCHSEDEKLSFDAVRSIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQ 511          
BLAST of Stromal interaction molecule 1 vs. UniProt/SwissProt
Match: sp|Q13586|STIM1_HUMAN (Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3)

HSP 1 Score: 169.088 bits (427), Expect = 4.149e-43
Identity = 142/478 (29.71%), Postives = 235/478 (49.16%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGS---IKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDDSRSQH-----EIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHD-SQGSPKSENSLKFLENSVQFSVDSQ 1645
            C  +   C+ ++  L + A+  +H  +DDD NGD+D+ ES +F+ E L+      K   FH  D  I  +DLW  WKSSE YNWT  +++ WL   VELPQYE  F  L+L+G ++ RL  T       V+K+ +  HR+K+ +KA+D VLFG     +   L    +V ++   V    +  IQN YSK  +K M   L+ + + E+SL +L+E+L   +      + E   +E++ + EI  A      +   RE   ++ RS+      E+ ++R AL +A+ +   L   S+ +A  +        L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E + GF +     I +L   ++    S     R +P     +D VD ++   +   S  SP  ++S++      Q  + SQ
Sbjct:   49 CRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREG-TENERSRQKYAEEELEQVREALRKAEKE---LESHSSWYAPEA--------LQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNID-PSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQ 513          
BLAST of Stromal interaction molecule 1 vs. UniProt/SwissProt
Match: sp|P83094|STIM_DROME (Stromal interaction molecule homolog OS=Drosophila melanogaster OX=7227 GN=Stim PE=1 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 4.615e-43
Identity = 135/442 (30.54%), Postives = 218/442 (49.32%), Query Frame = 2
Query:  236 NDFDAFEISVACVNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKK-FH-KTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQLTKTSIVATLFFFVSIIA--YLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIV----ENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSS 1531
            +DFD +  SV          +D     AI+ LH Q+DDD NG+ID++ES DF+ E L    G EK +K FH   D HI  ++LW  W  SE +NWT      WL   V+LPQY  +F   K+ G++L RL    ++++ NV+ I + IH++KI +KA+D VLFG  +         +       +II   Y   QN  +KR ++ M   ++ + + E+SL E++++LE      EN+  +K      +E R K   T  ++SS   L        E+ +L+    E ++  N L R       N   P    QL   LQ T  +E +N  +K  + ++Q     E  +K+ KK+++ +G+F   H   +DD+++     + A   V  E +E+  RW Q+E   G N+     +P L  +++     G +   +S M M+S+
Sbjct:  129 DDFDCYSGSV----------QDRFGMEAIASLHRQLDDDDNGNIDLSESDDFLREELKYDSGYEKRQKAFHFNDDMHISVKELWEAWLRSEVHNWTIEQTTDWLAQSVQLPQYVDLFKLHKVTGAALPRLAVNNLQYVGNVLGIKDPIHKQKISLKAMDVVLFGPPRETGTRWKDYILVTLLLSAIIGCWYAYQQNKNAKRHLRRMAQDMEGLQRAEQSLQEMQKELERARMEQENVATEK----LDLERRLKEAPT--LSSSNSDL--------EVQQLK---KEIEMLRNELSRAEFELVDNCWSP--PPQLQSWLQYTYELESKNHQKKRTSAEKQLQSAREACEKLRKKRSSLVGAFVSTHGKSIDDVDRSIVEARNALGDVTNELQERLHRWKQIETCLGLNIVNNNGLPYLENVLY-----GRNGGLQSSMGMSST 536          
BLAST of Stromal interaction molecule 1 vs. TrEMBL
Match: R7TJX0 (SAM domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_147177 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 6.633e-58
Identity = 140/393 (35.62%), Postives = 212/393 (53.94%), Query Frame = 2
Query:  299 DELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTG-MEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ--LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLI 1468
            D L Y AI+ LH QIDDDKNG++D  ES +FV E L      E+  +FH +D HI   DLWH+W  S+ YNWT  D++ WL  +VELPQY   F    + G  L RL    ++L +++ I   +HR+KI +K+ D VLFG  K     +   ++VA+L   +       +Q+ YS+  +K +   L  + + E++LTEL+ KLE+ EN +     E + +E R  +E+  A + +         ++ EI RL+ A  E  +Q+  +    A +       G   +L   LQLT  IE++N   K  A D+Q     E+ +K+ +K+ AFLGS ++ H+S +DD +    STK A E+V  +  E+  RW Q+E I GFN+T    I  L  L+
Sbjct:    1 DPLGYEAITRLHSQIDDDKNGNLDWEESDEFVREELEYEDNFERQARFHGSDDHITVDDLWHLWVKSDVYNWTVDDVLDWLVTQVELPQYADSFRINDVGGRILPRLAANGQYLTSILGIKTPVHRQKIALKSTDTVLFGPPKPGHNYVKDVALVASLLIAIGGCWLAYVQHKYSQSHLKKVMKDLDTLQRAEDALTELQSKLELAENEQRSVVEEKKSLENRLNHEVNSAKSEAERLRQTREATEEEIGRLKLA-EEELVQVR-MALAEAEYELERGHGGSLVELQPWLQLTHEIEMKNYEAKKEAADKQLILAKEMCEKIRRKRAAFLGSIRVAHTSSIDDTDSKIMSTKAALEEVKMDLAERSHRWQQIEKICGFNITTNPGIQYLESLL 391          
BLAST of Stromal interaction molecule 1 vs. TrEMBL
Match: A0A1S3HKR8 (stromal interaction molecule homolog OS=Lingula unguis OX=7574 GN=LOC106156136 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 7.525e-55
Identity = 143/441 (32.43%), Postives = 241/441 (54.65%), Query Frame = 2
Query:  266 ACVNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ--LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDS 1546
            +C +   +CNKD+L + AIS LH ++DDDKNG++D++ES +F+ + L    G E+   FH  D  I   +LW  WK SE YNWT  D++ W+   V+LPQY   F    ++G+ L R+      FL  ++ I N +H++K+ +KA+D VLFG  K+    +   ++VA+L   +    +  IQ+ YS+  +K M + L ++ + E++LTEL+EKL   +  + +   E Q +E + K EI  A      +  +RE    D +R   ++ E+A++RSAL +A+ ++ ++         N   P D   L   LQLT  IEL +   K  + +RQ +   +  +++ KK++AF+GS +L HSS +DD+++     + + E+V  + +E+  RW Q+E +TGF    I   P + QL      S   Q  ++  ++  +D  D 
Sbjct:   40 SCPSEDKECNKDKLGFDAISLLHGKLDDDKNGNVDLSESDEFLRDELQYTDGFERHNIFHGNDKQITVDELWVQWKQSEVYNWTVDDVLDWVTVSVDLPQYAENFRVNAVDGTVLPRIAANSNHFLSGILGIKNPVHKQKLSLKAMDVVLFGPPKKGHSYIKDIALVASLVIAIGGCWFAYIQHKYSQSHMKKMITDLDNLQRAEDALTELQEKLHRAQKSQQEVVQEKQHLEAKMKDEIQDAKLEAERLKLAREGTEADMTRLKLAEEELAQVRSALRQAERELENM---------NWRPPAD---LQDWLQLTYEIELTHYNTKKLSAERQLAAAKDACERIRKKRSAFMGSLRLAHSSSIDDVDRRIIDARSSLEEVGRDLQERLQRWRQIEELTGF---AILTNPGMAQLSSKLYGSSHPQGHDTAAYLRPTDIDDG 465          
BLAST of Stromal interaction molecule 1 vs. TrEMBL
Match: A0A0L8FP39 (SAM domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22013405mg PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 8.227e-51
Identity = 142/465 (30.54%), Postives = 244/465 (52.47%), Query Frame = 2
Query:  272 VNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ--LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKN------------QKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIH-THMESGEHQKRES-------PMFMTSSDTVDSLNSVSIHDSQGSPKSENS 1600
             +++  C KD+  + AI  LHD IDDD+NG++D TES +F+   L    G E+   FH  D  I  +DLW  WK SE YNWT  D++ WL + VELPQY + F + K++GS+L R+      L+ + + N++H++K+ +KA+D VLFG  K+    +   +++A+L   +    +  +Q+ YS+  VK M    + +   EESL EL+E+L+  +  +N            Q D +++ + ++   EI+R             + + E+ ++++ L +A+ ++      SA        P D   L   LQLT  IELQ+   K  A + Q  E  +  +K+ KK+ AF+G  ++ H + +D+++K   + + + E V  + +E+  RW  +E +  F++TK + + +L Q +H   +  G   K  S       P  ++SS    S++++S H S GSP S  S
Sbjct:    1 ADHNPSCLKDKENFNAIKTLHDLIDDDRNGNVDQTESDEFLRVELQYTDGFERHFTFHGNDGFISVEDLWKSWKQSEVYNWTVDDVVDWLVHHVELPQYVTNFQTHKIDGSTLPRMAASHQYLSTIGVKNNVHKQKLSLKAMDVVLFGPPKKGHSYIKDLTLIASLIIAIGGCWFAYLQHKYSQAHVKKMMRDWESLQIAEESLKELQERLDKAQQEQNLNDRLKDVEGIEQPDSDVKLLRKQSLDEISRG------------KIEEELKQVKANLRKAEKELESRQWSSA--------PAD---LQKWLQLTYEIELQHHNNKKLAAENQLREARDCCEKLKKKRNAFMGPLRIAHGNSIDEVDKRILNARASLEVVHQDLQERLGRWRAIERLCAFSVTKNSGLASLMQTMHQDKLTPGFPAKTPSSKDLQTYPKNLSSSLNRRSIDTISNH-SGGSPISPES 441          
BLAST of Stromal interaction molecule 1 vs. TrEMBL
Match: C3YZK5 (SAM domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_119144 PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.830e-50
Identity = 143/454 (31.50%), Postives = 238/454 (52.42%), Query Frame = 2
Query:  257 ISVACVNNHS-------KCN------KDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKT--DAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ--LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKS-ASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTV--DSLN 1552
            ++V+CV++         +C       KD L   A+  LH  +DDD NG++D++ES +F+ + L    G+E+   FH++  D  I   DLW  WK SE YNWT    ++WL   VELPQY + F +  ++GS+L RL      FL  ++ I N +HR+KI +KA+D VLFG  K+    +  T++V +L   +    +  +Q+ +S+  +K M  +++ + K EE+L E++ +L+  E  +     E   +E + + E+T A   +         ++ EI RLR A  E   Q+   +RK+       S  P  S  L   LQLT  +EL+N + K  A + Q++E  E  +K+ KK+   +G+ K+ H+S +D+++K  A  + A ++V  + KE+ +RW ++E + GFN+     +  L Q++      G      SP F  S   V  DSL+
Sbjct:   14 LAVSCVHSRDVSLDEEEQCTDECRQEKDRLGLEALHTLHRMLDDDHNGNVDLSESDEFLRDELHYQDGSERQSTFHRSGEDKFISVDDLWTAWKHSEVYNWTVEHTVAWLVNAVELPQYAATFETNAVDGSALPRLAVNNPHFLTTILGITNPVHRQKIALKAMDVVLFGPAKQGHSYIKDTALVLSLVIAIGGCWFAFVQHRFSQGHIKKMMREMESLQKAEETLGEMQARLQQAEEEQQTVVEEKMNLEAKMREEMTNAKQEAERLKMVRENTETEINRLRIA-EEELYQVRQALRKAEKELERRSWHPPTS--LQQWLQLTYELELKNYSNKRLAAETQFAEAKESCEKIRKKRITVMGALKIAHTSSLDEVDKRIAKARSALQEVTSDLKERLVRWRKIEKLCGFNIITNPGLTALSQVLTEGSVPG------SPGFAGSVQGVEDDSLD 458          
BLAST of Stromal interaction molecule 1 vs. TrEMBL
Match: A0A0L8FN83 (SAM domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22013405mg PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 6.859e-50
Identity = 127/414 (30.68%), Postives = 222/414 (53.62%), Query Frame = 2
Query:  272 VNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ--LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKN------------QKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIH 1471
             +++  C KD+  + AI  LHD IDDD+NG++D TES +F+   L    G E+   FH  D  I  +DLW  WK SE YNWT  D++ WL + VELPQY + F + K++GS+L R+      L+ + + N++H++K+ +KA+D VLFG  K+    +   +++A+L   +    +  +Q+ YS+  VK M    + +   EESL EL+E+L+  +  +N            Q D +++ + ++   EI+R             + + E+ ++++ L +A+ ++      SA        P D   L   LQLT  IELQ+   K  A + Q  E  +  +K+ KK+ AF+G  ++ H + +D+++K   + + + E V  + +E+  RW  +E +  F++TK + + +L Q +H
Sbjct:    1 ADHNPSCLKDKENFNAIKTLHDLIDDDRNGNVDQTESDEFLRVELQYTDGFERHFTFHGNDGFISVEDLWKSWKQSEVYNWTVDDVVDWLVHHVELPQYVTNFQTHKIDGSTLPRMAASHQYLSTIGVKNNVHKQKLSLKAMDVVLFGPPKKGHSYIKDLTLIASLIIAIGGCWFAYLQHKYSQAHVKKMMRDWESLQIAEESLKELQERLDKAQQEQNLNDRLKDVEGIEQPDSDVKLLRKQSLDEISRG------------KIEEELKQVKANLRKAEKELESRQWSSA--------PAD---LQKWLQLTYEIELQHHNNKKLAAENQLREARDCCEKLKKKRNAFMGPLRIAHGNSIDEVDKRILNARASLEVVHQDLQERLGRWRAIERLCAFSVTKNSGLASLMQTMH 391          
BLAST of Stromal interaction molecule 1 vs. Ensembl Cavefish
Match: stim1a (stromal interaction molecule 1a [Source:ZFIN;Acc:ZDB-GENE-060503-914])

HSP 1 Score: 159.844 bits (403), Expect = 4.897e-42
Identity = 122/399 (30.58%), Postives = 204/399 (51.13%), Query Frame = 2
Query:  305 LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSI---KRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRES----LCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
            L + AI  +H Q+DDD NG++D++E+  F+ E L+      K   FH  D  I  +DLW+ WKSS+ YNWT  +++ WL   VEL QY   F  +  +G+++ RL        + V+KI +  H +K+ +KA+D VLFG+        L    +V ++   +    +  IQN +SK  +K M   L+ + + E+SL +L++KL I +      + E   +E++ + EI  A      +   RE     L     ++ E+ ++R AL +A+ ++    R S S       P +S  L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E +TGF +     +P+L
Sbjct:   30 LSFEAIRNIHKQMDDDANGNVDVSETDGFLREDLNYHDPKAKHNSFHGDDQFISVEDLWNSWKSSKVYNWTVDEVVEWLESYVELSQYAEAFRKMNFSGTTMPRLAVKNSTLTVTVLKILDRSHTQKLQLKALDTVLFGAPMMNSHNHLKDFMLVVSIVIGMGGCWFAFIQNRHSKDHMKKMMKDLEGLQRAEQSLHDLQQKLRIAQEEHRTVEVEKVNLEQKLRDEINSAKQEAHRLRELREGTENELSRQKYAEEELEQVRMALKKAEKELES--RCSWS-------PPES--LQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILAAKQALGEVTAALRERLNRWQQIEILTGFTIVNNPGLPSL 417          
BLAST of Stromal interaction molecule 1 vs. Ensembl Cavefish
Match: stim2a (stromal interaction molecule 2-like [Source:NCBI gene;Acc:103031161])

HSP 1 Score: 164.081 bits (414), Expect = 9.013e-42
Identity = 124/410 (30.24%), Postives = 206/410 (50.24%), Query Frame = 2
Query:  266 ACVNNHSKC--NKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ---LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHT 1474
            AC+     C    D     A+  +H ++DDD++G I++ ES +F+ E + + Q   K  K H+ D HI  ++LW  WKSSE +NWT  D++ WLR  VELPQYE  F  +++NG++L R+   E  F+   +KI +  H+ K+ +KA+D VLFG   R     +    ++ ++   V    +   QN  SK  +  M   L+ + + E+ L +L+E+L   +  K     E Q +EE+ + EI  A   +         +  E++RLR A  E +     L +          +P     L L LQLT  +E+Q    K  + ++Q     E  +K+ KK+++ LG+  +VHSS +D ++      K A  +V    +E+  RW Q+E + GF + K   +P+L   ++ 
Sbjct:   43 ACLQVAPPCVTEADHFSLEALRLIHREMDDDQDGGIEVEESVEFIIEDMQQQQQTNKHSKLHREDQHITVEELWRGWKSSEVHNWTQDDVLRWLREFVELPQYEKSFKEIRVNGNTLPRIASNEPSFMSGYLKIQDQQHKHKLKLKALDVVLFGPPTRPPHNWMKDLVLIVSVVMGVGGCLFAQAQNKTSKEHISKMMKDLESLQRAEQRLRDLQEQLVQAQEEKRTVAVEKQFLEEKMRDEIQGAQEEANRLQELRQGAVSELSRLRYAEEELEQVRGALKKAELDMQACWSVP---ESLQLWLQLTHEVEVQYYNVKKQSAEQQLCTAKEEAEKIKKKRSSVLGTLHVVHSSSLDQVDHKILEAKNALVEVTACLQERLHRWQQIEWLCGFLVMKNPGLPSLTATLYP 449          
BLAST of Stromal interaction molecule 1 vs. Ensembl Cavefish
Match: stim2b (stromal interaction molecule 2 [Source:NCBI gene;Acc:103030125])

HSP 1 Score: 162.54 bits (410), Expect = 9.701e-42
Identity = 127/412 (30.83%), Postives = 213/412 (51.70%), Query Frame = 2
Query:  266 ACVNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ---LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
             CVN       D     A+  +H Q+DDD +G I++ ES +F+ E + K Q   K    H+ D HI  ++LW  WKSSE +NWT  D I WLR  VELPQYE+ F   +++G++L R+   E  F+   +KI +  H++K+ +KA+DAVLFG   R Q   L    ++ ++   V    +  +QN  SK  +  M   L+ +   E+SL +L+ +LE  +      + E Q +E++ + EI+ A      +   RE   C+ SR   ++ E+ ++R AL  A+ ++               +P     L + LQLT  +E+Q    K  + + Q +   E  +K+ KK+ + LG+  + HSS +D+++      K+A  +V    +E+  RW Q+E + GF + + + +P+L
Sbjct:   46 PCVNE-----ADRFSLEALRHIHKQLDDDNDGGIEVNESVEFIIEDM-KQQQTNKHSNLHREDQHITMEELWKGWKSSEVHNWTLDDAIQWLRESVELPQYETNFREFRVDGNTLPRIAANEPSFMTMQLKILDQRHKQKLNLKALDAVLFGPPLRPQHNWLKDFVLMVSIIIGVGGCWFAYVQNKSSKIHISRMMKDLESLQSAEQSLMDLQSRLEKAQEENRTVEVEKQNLEQKMRDEISGAKKEAHRLRELREGAECELSRLKYAEEELVQVRMALKRAEKELQ----------SEWSVP---EALQMWLQLTHEVEVQYYNIKKQSAELQLNVAKEEAEKIKKKRGSVLGTLHVAHSSSLDEVDHKILEAKKALSEVTACLRERLHRWQQIEKLCGFPVVQNSGLPSL 438          
BLAST of Stromal interaction molecule 1 vs. Ensembl Cavefish
Match: stim1a (stromal interaction molecule 1a [Source:ZFIN;Acc:ZDB-GENE-060503-914])

HSP 1 Score: 160.229 bits (404), Expect = 3.929e-41
Identity = 122/399 (30.58%), Postives = 204/399 (51.13%), Query Frame = 2
Query:  305 LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSI---KRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRES----LCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
            L + AI  +H Q+DDD NG++D++E+  F+ E L+      K   FH  D  I  +DLW+ WKSS+ YNWT  +++ WL   VEL QY   F  +  +G+++ RL        + V+KI +  H +K+ +KA+D VLFG+        L    +V ++   +    +  IQN +SK  +K M   L+ + + E+SL +L++KL I +      + E   +E++ + EI  A      +   RE     L     ++ E+ ++R AL +A+ ++    R S S       P +S  L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E +TGF +     +P+L
Sbjct:   54 LSFEAIRNIHKQMDDDANGNVDVSETDGFLREDLNYHDPKAKHNSFHGDDQFISVEDLWNSWKSSKVYNWTVDEVVEWLESYVELSQYAEAFRKMNFSGTTMPRLAVKNSTLTVTVLKILDRSHTQKLQLKALDTVLFGAPMMNSHNHLKDFMLVVSIVIGMGGCWFAFIQNRHSKDHMKKMMKDLEGLQRAEQSLHDLQQKLRIAQEEHRTVEVEKVNLEQKLRDEINSAKQEAHRLRELREGTENELSRQKYAEEELEQVRMALKKAEKELES--RCSWS-------PPES--LQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILAAKQALGEVTAALRERLNRWQQIEILTGFTIVNNPGLPSL 441          
BLAST of Stromal interaction molecule 1 vs. Ensembl Cavefish
Match: stim1a (stromal interaction molecule 1a [Source:ZFIN;Acc:ZDB-GENE-060503-914])

HSP 1 Score: 159.844 bits (403), Expect = 4.279e-41
Identity = 122/399 (30.58%), Postives = 204/399 (51.13%), Query Frame = 2
Query:  305 LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSI---KRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRES----LCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
            L + AI  +H Q+DDD NG++D++E+  F+ E L+      K   FH  D  I  +DLW+ WKSS+ YNWT  +++ WL   VEL QY   F  +  +G+++ RL        + V+KI +  H +K+ +KA+D VLFG+        L    +V ++   +    +  IQN +SK  +K M   L+ + + E+SL +L++KL I +      + E   +E++ + EI  A      +   RE     L     ++ E+ ++R AL +A+ ++    R S S       P +S  L   LQLT  +E+Q    K    ++Q     E  +K+ KK+    G+F + HSS +DD++    + K+A  +V    +E+  RW Q+E +TGF +     +P+L
Sbjct:   46 LSFEAIRNIHKQMDDDANGNVDVSETDGFLREDLNYHDPKAKHNSFHGDDQFISVEDLWNSWKSSKVYNWTVDEVVEWLESYVELSQYAEAFRKMNFSGTTMPRLAVKNSTLTVTVLKILDRSHTQKLQLKALDTVLFGAPMMNSHNHLKDFMLVVSIVIGMGGCWFAFIQNRHSKDHMKKMMKDLEGLQRAEQSLHDLQQKLRIAQEEHRTVEVEKVNLEQKLRDEINSAKQEAHRLRELREGTENELSRQKYAEEELEQVRMALKKAEKELES--RCSWS-------PPES--LQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILAAKQALGEVTAALRERLNRWQQIEILTGFTIVNNPGLPSL 433          
BLAST of Stromal interaction molecule 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002273.1 (pep scaffold:Pmarinus_7.0:GL480247:1536:7869:-1 gene:ENSPMAG00000002068.1 transcript:ENSPMAT00000002273.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 1.925e-23
Identity = 68/204 (33.33%), Postives = 113/204 (55.39%), Query Frame = 2
Query:  302 ELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRL--TGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFG---SIKRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKL 898
            +L + A+S +H ++DDD++G ID  ES  F+ E +  +  A + ++FH  D  I  +++W  W +S+ YNWT  D+  WL   VELPQY   F    ++G SL RL  T   F+  ++KI    HR K+ +KA+D VLFG   S +R ++   ++   +   V+     L+Q   +   V  + S+L  + K E+SL +++ +L
Sbjct:    1 QLSFDAVSSIHARMDDDEDGTIDTRESDGFLREDMEYSDPATQHRRFHGGDQTITLKEMWAAWLASDVYNWTVQDVALWLETMVELPQYLENFLENNIDGPSLPRLAITNHTFMTTILKIPERSHRHKLQLKALDVVLFGAPLSAQRSRVKDVALAVAVVAAVTGCWLALVQRRRALEHVARVTSELDSLQKAEQSLLDMQARL 204          
BLAST of Stromal interaction molecule 1 vs. Ensembl Nematostella
Match: EDO49682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY6])

HSP 1 Score: 139.043 bits (349), Expect = 6.664e-36
Identity = 111/398 (27.89%), Postives = 202/398 (50.75%), Query Frame = 2
Query:  299 DELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFG-SIKRYQLTKTSIVATLFFFVSIIAYLLI-QNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVEN-----IKNQKDFEIQQMEE--RHKYEITR---AINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLL-------LQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNL 1429
            ++L +  IS++H  +DDD++G +D++ES +F+ + L  +    +   FH  D+ I  +DLW  W SSE +NWT+ +++SWL   V LPQY   F S  +NGS L RL      FL   + + +  HRKKI ++A+D +LFG     +   K  +VA      ++  +  + Q   +K+ ++     LK + + E++  +L+ +L   E      +K + D E +  EE    K+E  R   A + ++E L     ++ E+ ++R AL +A+ ++ +      S+    EL   +  LH+         Q+ R   L+ + E   A DR           + KK+ +F+GSF++ H   +D++++   + + A   V  E +E++ RW Q+E ++G  +
Sbjct:    3 EKLNFAGISQIHYHLDDDRDGKVDVSESDEFMRDELHLSD-QNRHNHFHGNDSLITVEDLWKSWVSSEVHNWTSKEVVSWLVDCVHLPQYSEAFKSYGVNGSMLPRLATKHNGFLHADLGVKDPKHRKKISLRAMDVILFGPPASGHNFLKDIVVAFSVLIATVGCWFAVHQKRRAKQQIEQTMRDLKVLQQAEKNFADLQARLAAAEEDHQRAMKQKGDLETRLQEEIDASKFEAERLQDAKDGTKEQLQRLYIAEQELMQVRKALRKAERELEY-----RSWKAPEEL---AQWLHITYTKESRHFQMKRTQALKQMTEAKDACDR-----------IRKKRNSFIGSFRMAHDLTIDEVDQQILAARAALADVTNEMEERQRRWYQIEALSGLPI 380          
BLAST of Stromal interaction molecule 1 vs. Ensembl Medaka
Match: stim1a (stromal interaction molecule 1 [Source:NCBI gene;Acc:101156837])

HSP 1 Score: 177.563 bits (449), Expect = 4.818e-47
Identity = 148/469 (31.56%), Postives = 238/469 (50.75%), Query Frame = 2
Query:  296 KDE---LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSI---KRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDD-SR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHT-HMESGEHQKRESPMFMTSSDTVDSLNSVSIHDSQGSPKSENSLKFLENSVQFSVDSQ 1645
            KDE   L + AI  +H Q+DDD NG++DI E+  F+ E L+      K   FH  D  I  +DLW+ WK SE YNWT  +++ WL   VELPQY   F  +  NGS++ RL        L+++KI +  H +K+ +KA+D VLFG+    +   L    +V ++   +    +  IQN YSK  +K M   L+ + + E+SL +L++KL+I +      + E   +E++ + EI  A      +   RE   ++ SR   ++ E+ ++R AL +A+ ++    R S S       P +S  L   LQLT  +E+Q    K  + +RQ     E  +K+ KK+    G+F + HSS +DD++    + K++  +V    +E+  RW+Q+E +TGF    I + P L  LI   +++      R +P     SD +D L+   +     SP S  SL+      Q +  SQ
Sbjct:   47 KDENARLSFEAIRSIHKQMDDDANGNVDIVETDGFLREDLNYHDPKAKHNTFHGDDQFISVEDLWNAWKGSEVYNWTVDEMVKWLITCVELPQYVDAFRKMNFNGSTMPRLAVKNTTLTLSILKILDRSHVQKLQLKALDTVLFGAPLMNRHNHLKDFMLVVSIVIGMGGCWFAYIQNRYSKDHMKKMMKDLEGLQRAEQSLHDLQQKLQIAQEEHRTVEVEKVNLEQKLRDEINAAKQEASRLRELREGTVNELSRQKYAEEELEQVRMALKKAEKELES--RCSWS-------PPES--LQKWLQLTHEVEVQYYNIKKQSAERQLLMAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILAAKQSLGEVTAALRERLQRWHQIEFLTGF---AIVNNPGLSSLIAALNLDPTFMGGRATPQHFPMSDDMDELDDCVMPGILQSP-SMVSLRKPHIDPQLAAGSQ 500          
BLAST of Stromal interaction molecule 1 vs. Ensembl Medaka
Match: stim1a (stromal interaction molecule 1 [Source:NCBI gene;Acc:101156837])

HSP 1 Score: 176.022 bits (445), Expect = 1.959e-46
Identity = 140/440 (31.82%), Postives = 227/440 (51.59%), Query Frame = 2
Query:  296 KDE---LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLT--GMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSI---KRYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESLCDD-SR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHT-HMESGEHQKRESPMFMTSSDTVDSLNSV 1558
            KDE   L + AI  +H Q+DDD NG++DI E+  F+ E L+      K   FH  D  I  +DLW+ WK SE YNWT  +++ WL   VELPQY   F  +  NGS++ RL        L+++KI +  H +K+ +KA+D VLFG+    +   L    +V ++   +    +  IQN YSK  +K M   L+ + + E+SL +L++KL+I +      + E   +E++ + EI  A      +   RE   ++ SR   ++ E+ ++R AL +A+ ++    R S S       P +S  L   LQLT  +E+Q    K  + +RQ     E  +K+ KK+    G+F + HSS +DD++    + K++  +V    +E+  RW+Q+E +TGF    I + P L  LI   +++      R +P     SD +D L+  
Sbjct:   47 KDENARLSFEAIRSIHKQMDDDANGNVDIVETDGFLREDLNYHDPKAKHNTFHGDDQFISVEDLWNAWKGSEVYNWTVDEMVKWLITCVELPQYVDAFRKMNFNGSTMPRLAVKNTTLTLSILKILDRSHVQKLQLKALDTVLFGAPLMNRHNHLKDFMLVVSIVIGMGGCWFAYIQNRYSKDHMKKMMKDLEGLQRAEQSLHDLQQKLQIAQEEHRTVEVEKVNLEQKLRDEINAAKQEASRLRELREGTVNELSRQKYAEEELEQVRMALKKAEKELES--RCSWS-------PPES--LQKWLQLTHEVEVQYYNIKKQSAERQLLMAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILAAKQSLGEVTAALRERLQRWHQIEFLTGF---AIVNNPGLSSLIAALNLDPTFMGGRATPQHFPMSDDMDELDDC 472          
BLAST of Stromal interaction molecule 1 vs. Ensembl Medaka
Match: stim1b (stromal interaction molecule 1 [Source:NCBI gene;Acc:101164993])

HSP 1 Score: 167.162 bits (422), Expect = 2.178e-44
Identity = 122/399 (30.58%), Postives = 206/399 (51.63%), Query Frame = 2
Query:  269 CVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLL--NVVKIHNSIHRKKIMIKAVDAVLFGSIK--RYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSH-----QLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLT 1432
            CV +   C+ ++  L + AI  +H  +DDD +G +D TE+ +F+ E L       K   FH+ D HI  +D+W+ WKSS  YNWT   +  WL   VELPQY   F  L+L+G SL RL      L  +++KI +  H +K+ +KA+D VLFG     R +     +  ++   +    +   Q   S+  +  +   L+ + + E+SL +L+EKL+  +  +     E  ++EE  + EI  A + ++        +++E++R + A  E + Q+   ++K+       EL   +H      L   LQLT  IE+Q    K  + +RQ  +  E  +K+ KK+++  G+F + HSS +DD++    S K+A  +V    +E+  RW Q+E++TGF L 
Sbjct:   28 CVIDQQLCHNEDSLLSFEAICSIHKLMDDDADGSVDTTETDEFLREDLQYKDSKAKQNSFHRADLHISVEDMWNAWKSSIVYNWTVPQVEEWLAVSVELPQYSESFQKLQLDGRSLPRLAVKNTTLTGSLLKIVDRGHAQKLQLKALDTVLFGPPPGLRNRWKDWVLALSILMALGGCWFAYAQTRKSRDDMGKLMKDLEGLQRAEQSLLDLQEKLQQAQEEQRWVQVEKVRVEEELRSEIDSAKHEAQRLRELREGTENELSRQKYAEQELE-QVRMALKKA-----ERELESRAHWTPPEALQTWLQLTHEIEVQYYNCKKQSAERQLLQAKEGAEKIKKKRSSLFGTFHVAHSSSLDDVDHKILSAKQALAEVTAALREKLHRWQQIESLTGFALV 420          
BLAST of Stromal interaction molecule 1 vs. Ensembl Medaka
Match: stim1b (stromal interaction molecule 1 [Source:NCBI gene;Acc:101164993])

HSP 1 Score: 167.933 bits (424), Expect = 1.254e-43
Identity = 124/409 (30.32%), Postives = 208/409 (50.86%), Query Frame = 2
Query:  239 DFDAFEISVACVNNHSKCNKDE--LEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGMEFLL--NVVKIHNSIHRKKIMIKAVDAVLFGSIK--RYQLTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSH-----QLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLT 1432
            D      S  CV +   C+ ++  L + AI  +H  +DDD +G +D TE+ +F+ E L       K   FH+ D HI  +D+W+ WKSS  YNWT   +  WL   VELPQY   F  L+L+G SL RL      L  +++KI +  H +K+ +KA+D VLFG     R +     +  ++   +    +   Q   S+  +  +   L+ + + E+SL +L+EKL+  +  +     E  ++EE  + EI  A + ++        +++E++R + A  E + Q+   ++K+       EL   +H      L   LQLT  IE+Q    K  + +RQ  +  E  +K+ KK+++  G+F + HSS +DD++    S K+A  +V    +E+  RW Q+E++TGF L 
Sbjct:   36 DLPGNRASDLCVIDQQLCHNEDSLLSFEAICSIHKLMDDDADGSVDTTETDEFLREDLQYKDSKAKQNSFHRADLHISVEDMWNAWKSSIVYNWTVPQVEEWLAVSVELPQYSESFQKLQLDGRSLPRLAVKNTTLTGSLLKIVDRGHAQKLQLKALDTVLFGPPPGLRNRWKDWVLALSILMALGGCWFAYAQTRKSRDDMGKLMKDLEGLQRAEQSLLDLQEKLQQAQEEQRWVQVEKVRVEEELRSEIDSAKHEAQRLRELREGTENELSRQKYAEQELE-QVRMALKKA-----ERELESRAHWTPPEALQTWLQLTHEIEVQYYNCKKQSAERQLLQAKEGAEKIKKKRSSLFGTFHVAHSSSLDDVDHKILSAKQALAEVTAALREKLHRWQQIESLTGFALV 438          
BLAST of Stromal interaction molecule 1 vs. Ensembl Medaka
Match: stim2b (stromal interaction molecule 2 [Source:NCBI gene;Acc:101166502])

HSP 1 Score: 164.466 bits (415), Expect = 2.973e-42
Identity = 125/426 (29.34%), Postives = 213/426 (50.00%), Query Frame = 2
Query:  230 SNNDFDAFEISVACVNNHSKC--NKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSRLTGME--FLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQ---LTKTSIVATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRA------INSSRESL-CDDSR---SQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTL 1456
             ++D     IS  C+     C    D     A+  +H Q+DDD +G I++ ES +F+ E + K Q   K    H+ D HI  ++LW  WK+SE +NWTT D I WLR  VELPQYE  F   ++ G++L R+   E  F+   +KI +  H++K+ +KA+DAVLFG   R Q   +    ++ ++   V    +  +QN  S+  +  M   L+ +   E+SL EL+ +LE  +        E + +E++ + EI  A      +   RE   C+ SR   ++ E+ ++R AL +A+ ++     +S   A           L   LQLT  +E+Q    K  + + Q     +  +K+ KK+ +  G+  + HSS +D+++      K++  +V    +E+  RW Q+E + GF +   + +P+L
Sbjct:   31 PSSDASNVAISDPCLTVMPPCINEDDRFSLEALRHIHKQLDDDNDGGIEVNESVEFIIEDM-KQQQTNKHSNLHREDQHITVEELWKGWKTSEVHNWTTDDAIQWLRESVELPQYEKNFRDFRVTGNTLPRMAANEPSFMSMQLKILDQRHKQKLNLKALDAVLFGPPLRPQHNWMKDFVLMVSIVIGVGGCWFAYMQNKSSRVHISRMMKDLESLQNAEQSLMELQGRLEKAQEENRTVAVEKENLEQKMRDEIDEAKKEAHRLRDLREGAECELSRLKYAEEELVQVRKALKQAEKEMQS--ERSVPEA-----------LQKWLQLTHEVEVQYYNIKKQSAEFQLCVAKDEAEKIKKKRGSVFGTLHVAHSSSLDEVDHKILEAKKSLSEVTACLRERLHRWQQIEKLCGFPIVNNSGLPSL 442          
BLAST of Stromal interaction molecule 1 vs. Planmine SMEST
Match: SMESG000081265.1 (SMESG000081265.1)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 330/331 (99.70%), Postives = 330/331 (99.70%), Query Frame = 2
Query:  833 MQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHDSQGSPKSENSLKFLENSVQFSVDSQNSNDSVENSSFQYRSAEKLNDEMNVNQRSRKEKYDRKKHFLKTVKSRIPSLTRSSTENLK 1825
            MQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHDSQGSPKSENSLKFLENSVQFSVDSQNSNDSVENSSFQYRSAEKLNDEMNVNQRSRKEK DRKKHFLKTVKSRIPSLTRSSTENLK
Sbjct:    1 MQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSVSIHDSQGSPKSENSLKFLENSVQFSVDSQNSNDSVENSSFQYRSAEKLNDEMNVNQRSRKEKCDRKKHFLKTVKSRIPSLTRSSTENLK 331          
BLAST of Stromal interaction molecule 1 vs. Planmine SMEST
Match: SMESG000081265.1 (SMESG000081265.1)

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 329/334 (98.50%), Postives = 330/334 (98.80%), Query Frame = 2
Query:  833 MQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRE---SPMFMTSSDTVDSLNSVSIHDSQGSPKSENSLKFLENSVQFSVDSQNSNDSVENSSFQYRSAEKLNDEMNVNQRSRKEKYDRKKHFLKTVKSRIPSLTRSSTENLK 1825
            MQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRE   +PMFMTSSDTVDSLNSVSIHDSQGSPKSENSLKFLENSVQFSVDSQNSNDSVENSSFQYRSAEKLNDEMNVNQRSRKEK DRKKHFLKTVKSRIPSLTRSSTENLK
Sbjct:    1 MQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRECNSTPMFMTSSDTVDSLNSVSIHDSQGSPKSENSLKFLENSVQFSVDSQNSNDSVENSSFQYRSAEKLNDEMNVNQRSRKEKCDRKKHFLKTVKSRIPSLTRSSTENLK 334          
BLAST of Stromal interaction molecule 1 vs. Planmine SMEST
Match: SMESG000045881.1 (SMESG000045881.1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.122e-19
Identity = 54/155 (34.84%), Postives = 92/155 (59.35%), Query Frame = 2
Query:  266 ACVNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSR--LTGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIK 724
            + +N + +  KD++    I+++H ++D +K+G+I+  E+++F    L      + ++      AH+ K  LW  WK+S+ YNWT  D+++WL  +V+L +Y  VF    +NGS + R  L+ M FL+N++ I N  HR+KI  KA D +LFG  K
Sbjct:   28 SFINENGQNIKDKIALQVINDIHSEMDINKDGEINSDEAEEFTNGELRIQSNIDISENIK---AHLTKDLLWKSWKNSKVYNWTIDDVVTWLNIDVDLSEYTKVFLKNNINGSMIPRLALSDMSFLINILGIRNGTHRRKIARKAKDLILFGPSK 179          

HSP 2 Score: 78.5666 bits (192), Expect = 9.695e-16
Identity = 44/102 (43.14%), Postives = 65/102 (63.73%), Query Frame = 2
Query:  311 YLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSR 616
            Y  I  LH Q+DDDK+G +D  E+ +F  + L      ++AK+F+K D HI K++LW  WKSS  YNWT  D++ WL+  VEL +Y  +F   K++GS++ R
Sbjct:  191 YDVIKNLHSQLDDDKDGGVDPIEADEFARDELKYTGDFDRAKRFNKNDNHISKEELWRNWKSSLVYNWTMEDVLDWLKVHVELGEYIDLFKKYKIDGSTIPR 292          
BLAST of Stromal interaction molecule 1 vs. Planmine SMEST
Match: SMESG000052167.1 (SMESG000052167.1)

HSP 1 Score: 90.1225 bits (222), Expect = 6.677e-19
Identity = 54/153 (35.29%), Postives = 91/153 (59.48%), Query Frame = 2
Query:  272 VNNHSKCNKDELEYLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGSSLSR--LTGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIK 724
            +N + +  KD++    I+++H ++D +K+G+I+  E+++F    L      + ++      AH+ K  LW  WK+S+ YNWT  D+++WL  +V+L +Y  VF    +NGS + R  L+ M FL+N++ I N  HR+KI  KA D +LFG  K
Sbjct:   30 INENGQNIKDKIALQVINDIHSEMDINKDGEINSDEAEEFTNGELRIQSNIDISENIK---AHLTKDLLWKSWKNSKVYNWTIDDVVTWLNIDVDLSEYTKVFLKNNINGSMIPRLALSDMSFLINILGIRNGTHRRKIARKAKDLILFGPSK 179          

HSP 2 Score: 60.4622 bits (145), Expect = 2.194e-9
Identity = 35/78 (44.87%), Postives = 50/78 (64.10%), Query Frame = 2
Query:  311 YLAISELHXXXXXXXXXXXXXTESKDFVEESLSKAQGAEKAKKFHKTDAHIDKQDLWHIWKSSEAYNWTTTDLISWLR 544
            Y  I  LH Q+DDDK+G +D  E+ +F  + L      ++AK+F+K D HI K++LW  WKSS  YNWT  D++ WL+
Sbjct:  191 YDVIKNLHSQLDDDKDGGVDPIEADEFARDELKYTGDFDRAKRFNKNDNHISKEELWRNWKSSLVYNWTMEDVLDWLK 268          
BLAST of Stromal interaction molecule 1 vs. Planmine SMEST
Match: SMESG000045892.1 (SMESG000045892.1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.339e-14
Identity = 74/302 (24.50%), Postives = 134/302 (44.37%), Query Frame = 2
Query:  719 IKRYQLTKTSIVATLFFFVSIIAYL-LIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEIVENIKNQKDFEIQQMEERHKYEITRAINS-SRESLCDDSRSQHEIARLRSALNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKIAAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKR--------------AYEKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKRESPMFMTSSDTVDSLNSV-SIHDS 1573
            ++ Y   K SI+ TL        +L   Q+ +SKR ++TMQ K+  +   E++LT+L+ +L+  E    +   E Q++EE+ K E  +     SR+S+ D  + +H                        +F     +P    QL +LLQ+   IE      K  A   Q     ++ +K+ KKK++ +GS ++ HS ++DD++K     K               A ++V  +  E+  RW+ +E +  F +     +P LR      +  G  +      +   +DT DSL+ + S+H++
Sbjct:    2 LETYSFMKDSILITLVIVTIGGCWLAYYQHRFSKRQIETMQMKMNQLGIAEDALTKLQARLDEAEEQNTRVSSEKQKIEEKLKSEFEKLKEEMSRDSIDDIFKYKH--------------------TDDETFNMEVIVP---EQLKILLQMNYEIEENFFTFKKLAAHHQMQNVKDMCEKLRKKKSSLIGSLRIAHSGNLDDMDKELQEAKFIDCSNNFSEKYFRIAVDEVRSDLVERSQRWDYIEKLIKFKIFPTPGLPALRSAFTATINGGNPKSHIHKSWYPITDTEDSLSEIESLHET 280          
The following BLAST results are available for this feature:
BLAST of Stromal interaction molecule 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STIM14.297e-4529.52stromal interaction molecule 1 [Source:HGNC Symbol... [more]
STIM18.639e-4429.71stromal interaction molecule 1 [Source:HGNC Symbol... [more]
STIM11.171e-4329.71stromal interaction molecule 1 [Source:HGNC Symbol... [more]
STIM28.235e-4229.95stromal interaction molecule 2 [Source:HGNC Symbol... [more]
STIM22.358e-4129.95stromal interaction molecule 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
stim-13.017e-2127.58Stromal interaction molecule 1 [Source:UniProtKB/... [more]
stim-13.455e-2126.71Stromal interaction molecule 1 [Source:UniProtKB/... [more]
stim-13.855e-2127.58Stromal interaction molecule 1 [Source:UniProtKB/... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Stim4.334e-4430.54gene:FBgn0045073 transcript:FBtr0303567[more]
Stim4.604e-4430.54gene:FBgn0045073 transcript:FBtr0074159[more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stim2a3.996e-4630.19tromal interaction molecule 2a [Source:ZFIN;Acc:ZD... [more]
stim2b1.139e-4330.50stromal interaction molecule 2b [Source:ZFIN;Acc:Z... [more]
stim1a9.227e-4231.34stromal interaction molecule 1a [Source:ZFIN;Acc:Z... [more]
stim1a3.978e-4131.10stromal interaction molecule 1a [Source:ZFIN;Acc:Z... [more]
stim1a8.405e-4131.10stromal interaction molecule 1a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stim13.513e-4029.83stromal interaction molecule 1 [Source:NCBI gene;A... [more]
stim18.984e-4029.83stromal interaction molecule 1 [Source:NCBI gene;A... [more]
stim11.774e-3828.50stromal interaction molecule 1 [Source:NCBI gene;A... [more]
pgm12.130e-2628.65phosphoglucomutase 1 [Source:Xenbase;Acc:XB-GENE-9... [more]
ENSXETT00000030975.12.130e-2628.65stromal interaction molecule 2-like [Source:NCBI g... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stim12.753e-4629.94stromal interaction molecule 1 [Source:MGI Symbol;... [more]
Stim16.449e-4530.13stromal interaction molecule 1 [Source:MGI Symbol;... [more]
Stim11.003e-4430.13stromal interaction molecule 1 [Source:MGI Symbol;... [more]
Stim22.393e-4130.43stromal interaction molecule 2 [Source:MGI Symbol;... [more]
Stim22.833e-4130.33stromal interaction molecule 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70302|STIM1_MOUSE4.511e-4430.13Stromal interaction molecule 1 OS=Mus musculus OX=... [more]
sp|P84903|STIM1_RAT1.884e-4329.92Stromal interaction molecule 1 OS=Rattus norvegicu... [more]
sp|Q58CP9|STIM1_BOVIN3.957e-4329.71Stromal interaction molecule 1 OS=Bos taurus OX=99... [more]
sp|Q13586|STIM1_HUMAN4.149e-4329.71Stromal interaction molecule 1 OS=Homo sapiens OX=... [more]
sp|P83094|STIM_DROME4.615e-4330.54Stromal interaction molecule homolog OS=Drosophila... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TJX06.633e-5835.62SAM domain-containing protein (Fragment) OS=Capite... [more]
A0A1S3HKR87.525e-5532.43stromal interaction molecule homolog OS=Lingula un... [more]
A0A0L8FP398.227e-5130.54SAM domain-containing protein (Fragment) OS=Octopu... [more]
C3YZK51.830e-5031.50SAM domain-containing protein OS=Branchiostoma flo... [more]
A0A0L8FN836.859e-5030.68SAM domain-containing protein (Fragment) OS=Octopu... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stim1a4.897e-4230.58stromal interaction molecule 1a [Source:ZFIN;Acc:Z... [more]
stim2a9.013e-4230.24stromal interaction molecule 2-like [Source:NCBI g... [more]
stim2b9.701e-4230.83stromal interaction molecule 2 [Source:NCBI gene;A... [more]
stim1a3.929e-4130.58stromal interaction molecule 1a [Source:ZFIN;Acc:Z... [more]
stim1a4.279e-4130.58stromal interaction molecule 1a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002273.11.925e-2333.33pep scaffold:Pmarinus_7.0:GL480247:1536:7869:-1 ge... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO496826.664e-3627.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stim1a4.818e-4731.56stromal interaction molecule 1 [Source:NCBI gene;A... [more]
stim1a1.959e-4631.82stromal interaction molecule 1 [Source:NCBI gene;A... [more]
stim1b2.178e-4430.58stromal interaction molecule 1 [Source:NCBI gene;A... [more]
stim1b1.254e-4330.32stromal interaction molecule 1 [Source:NCBI gene;A... [more]
stim2b2.973e-4229.34stromal interaction molecule 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Stromal interaction molecule 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081265.10.000e+099.70SMESG000081265.1[more]
SMESG000081265.10.000e+098.50SMESG000081265.1[more]
SMESG000045881.11.122e-1934.84SMESG000045881.1[more]
SMESG000052167.16.677e-1935.29SMESG000052167.1[more]
SMESG000045892.14.339e-1424.50SMESG000045892.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022653 ID=SMED30022653|Name=Stromal interaction molecule 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2011bp
AATCTAGAATGTTTAGAGATTATTAAATTTTAAGGTTATTAAAATTTTTT
CAATTCAAAAGTTTTAATTTTACTTGTTATTCTTATTAAACCCTAAACAT
TCTAGATTACTATCCATATCAGATTTGATTATTTTCATTGAAAATATTTT
CTTAATGATTCAGCTTTTCAATAAAATTAGATTTATTAGTATTTTCCTCA
TAATATTAAATTTTTCCGTGGCTATTCAAAGCAACAATGATTTTGATGCA
TTTGAAATTTCAGTCGCTTGCGTCAATAATCACTCAAAATGTAATAAAGA
TGAATTAGAATATTTAGCGATTTCTGAGCTTCATGATCAGATTGATGATG
ATAAAAACGGAGACATTGATATCACTGAATCGAAAGATTTTGTCGAAGAA
TCACTGTCAAAGGCACAAGGAGCAGAAAAGGCAAAAAAATTTCATAAAAC
TGATGCGCATATTGATAAACAAGACTTGTGGCATATTTGGAAATCAAGCG
AAGCATATAATTGGACGACAACCGATTTGATTAGTTGGTTAAGATATGAA
GTTGAACTTCCTCAATATGAAAGTGTCTTTAATAGTTTAAAATTGAATGG
ATCTTCATTATCAAGGCTGACCGGAATGGAATTCCTGCTTAATGTAGTAA
AAATTCATAATTCAATACACAGAAAAAAAATCATGATCAAAGCCGTAGAT
GCTGTCTTATTTGGATCAATAAAAAGGTATCAACTTACCAAAACTTCAAT
AGTTGCTACGCTTTTCTTCTTCGTCAGTATAATAGCATATTTGTTGATCC
AAAATGTGTACTCAAAACGATTTGTTAAGACTATGCAGTCGAAATTGAAA
GATATTTCTAAAACCGAAGAAAGTTTAACTGAATTAAGAGAAAAATTGGA
AATTGTTGAAAACATAAAAAACCAGAAAGATTTCGAGATACAACAAATGG
AGGAAAGACACAAATATGAAATTACTCGCGCAATCAATTCTTCTCGAGAA
TCTCTTTGTGACGATTCAAGATCCCAGCATGAAATTGCAAGACTTCGCAG
TGCACTGAATGAAGCGCAAATCCAAATCAATCATCTAATGAGAAAATCTG
CATCGTTTGCCGGAAATAGTGAGTTACCCGGGGATAGCCACCAGCTACAT
TTGTTGCTCCAACTTACACGTGCAATTGAATTGCAAAATTTAGCGGAGAA
AATTGCGGCCATTGACCGTCAATATTCAGAGTTCATGGAATTGAATCAAA
AAGTTAATAAAAAGAAAACTGCTTTTCTTGGATCCTTCAAATTAGTTCAT
TCAAGTGATATGGATGATATAGAAAAAGGATTTGCTTCCACAAAAAGAGC
GTATGAAAAAGTTATTTACGAGAAAAAAGAACAAGAATTAAGATGGAATC
AACTTGAAAATATAACAGGGTTTAATTTGACAAAAATTGCAGATATTCCG
ACGTTGCGACAATTGATTCATACTCATATGGAATCAGGAGAACATCAAAA
ACGAGAATCACCAATGTTCATGACAAGCAGTGACACCGTTGACAGTCTAA
ATAGTGTATCTATTCATGATTCACAAGGAAGTCCAAAATCAGAGAACTCA
TTAAAATTTTTAGAAAACTCAGTTCAGTTTTCTGTCGATAGCCAGAATTC
TAATGATTCAGTGGAAAATTCATCGTTCCAGTATCGCTCGGCCGAAAAAT
TAAATGATGAAATGAACGTTAATCAAAGATCCAGAAAAGAAAAATATGAT
AGAAAGAAACATTTTCTGAAAACCGTTAAATCACGAATTCCATCTCTAAC
GAGATCGTCCACAGAAAATTTAAAATGAGACAAAGATTTACAAAGTCATT
TAATAGGAATTTTAGACAGTGCTTTGTTGATATATAGAAAATACTTTTAT
ATTTCAAAGTGATAAATAAAATTTTATTAGTTCAGTATGAAAACAATGAA
AAACAGATACTGTTAATAAAATTATCGGTGAATATTCGCTCAAAATAATG
TTAATTTTTCC
back to top

protein sequence of SMED30022653-orf-1

>SMED30022653-orf-1 ID=SMED30022653-orf-1|Name=SMED30022653-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=558bp
MIQLFNKIRFISIFLIILNFSVAIQSNNDFDAFEISVACVNNHSKCNKDE
LEYLAISELHDQIDDDKNGDIDITESKDFVEESLSKAQGAEKAKKFHKTD
AHIDKQDLWHIWKSSEAYNWTTTDLISWLRYEVELPQYESVFNSLKLNGS
SLSRLTGMEFLLNVVKIHNSIHRKKIMIKAVDAVLFGSIKRYQLTKTSIV
ATLFFFVSIIAYLLIQNVYSKRFVKTMQSKLKDISKTEESLTELREKLEI
VENIKNQKDFEIQQMEERHKYEITRAINSSRESLCDDSRSQHEIARLRSA
LNEAQIQINHLMRKSASFAGNSELPGDSHQLHLLLQLTRAIELQNLAEKI
AAIDRQYSEFMELNQKVNKKKTAFLGSFKLVHSSDMDDIEKGFASTKRAY
EKVIYEKKEQELRWNQLENITGFNLTKIADIPTLRQLIHTHMESGEHQKR
ESPMFMTSSDTVDSLNSVSIHDSQGSPKSENSLKFLENSVQFSVDSQNSN
DSVENSSFQYRSAEKLNDEMNVNQRSRKEKYDRKKHFLKTVKSRIPSLTR
SSTENLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037608STIM
IPR001660SAM
IPR013761SAM/pointed_sf
IPR032393SOAR
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005246calcium channel regulator activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030176integral component of endoplasmic reticulum membrane
Vocabulary: biological process
TermDefinition
GO:0032237activation of store-operated calcium channel activity
GO:0051924regulation of calcium ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 343..363
NoneNo IPR availableCOILSCoilCoilcoord: 294..314
NoneNo IPR availableCOILSCoilCoilcoord: 227..268
NoneNo IPR availableGENE3DG3DSA:1.10.238.180coord: 47..121
e-value: 3.5E-23
score: 83.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..517
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..557
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.768
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
IPR001660Sterile alpha motif domainPFAMPF07647SAM_2coord: 119..177
e-value: 6.4E-7
score: 29.4
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 120..177
score: 9.891
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 123..187
e-value: 7.2E-19
score: 70.2
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 112..187
IPR032393Stromal interaction molecule, Orai1-activating regionPFAMPF16533SOARcoord: 328..424
e-value: 4.6E-19
score: 68.3
IPR037608Stromal interaction moleculePANTHERPTHR15136FAMILY NOT NAMEDcoord: 36..496