IFI30 lysosomal thiol reductase

Overview
NameIFI30 lysosomal thiol reductase
Smed IDSMED30022650
Length (bp)1251
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IFI30 lysosomal thiol reductase (SMED30022650) t-SNE clustered cells

Violin plots show distribution of expression levels for IFI30 lysosomal thiol reductase (SMED30022650) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IFI30 lysosomal thiol reductase (SMED30022650) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IFI30 lysosomal thiol reductase (SMED30022650) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022650

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30022650SMESG000052978.1 dd_Smed_v4_2024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022650SMESG000052978.1 dd_Smed_v4_2024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022650SMESG000052978.1 dd_Smed_v4_2024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022650SMESG000052978.1 dd_Smed_v4_2024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022650SMESG000052978.1 dd_Smed_v4_2024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022650SMESG000052978.1 Contig20845newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022650SMESG000052978.1 Contig20845uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022650SMESG000052978.1 Contig37685newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022650SMESG000052978.1 Contig37685uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022650SMESG000052978.1 Contig34257newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022650SMESG000052978.1 Contig34257uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30022650SMESG000052978.1 dd_Smed_v6_2024_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30022650SMESG000052978.1 dd_Smed_v6_2024_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Human
Match: IFI30 (IFI30 lysosomal thiol reductase [Source:HGNC Symbol;Acc:HGNC:5398])

HSP 1 Score: 97.0561 bits (240), Expect = 1.883e-22
Identity = 55/174 (31.61%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  661 VYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            +Y E  C   + F+  +L P   L+   + V L PYG A E+ V+G+WEF CQHG +EC+ N + AC +   +         C+ +  +   +   C + Y   L  D I EC  GD+G  L H  A  T +L P   Y+PW+ +N    +  +D+  T L  L+C  ++ + P
Sbjct:   66 LYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVN---GKPLEDQ--TQLLTLVCQLYQGKKP 234          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Celegans
Match: C02D5.2 (GILT-like protein C02D5.2 [Source:UniProtKB/Swiss-Prot;Acc:P34276])

HSP 1 Score: 97.8265 bits (242), Expect = 5.816e-23
Identity = 61/185 (32.97%), Postives = 84/185 (45.41%), Query Frame = 1
Query:  640 DNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGF--ITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITN-QSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 1185
            +N + LDVYME +CPDT  F   QL     +LG    I +N+ P+GKA        +E  CQHG  ECQ N ++ C I        Y+P   C+    +     K   E Y  +Y+ + EC  G +G  L       T+SL P + +IPWI+IN     S    A   L   +C   +  P  C 
Sbjct:   76 ENIVKLDVYMEAQCPDTSRFFRQQLKKAWDILGRLNRIELNVIPFGKARCTEKGNDFECQCQHGPTECQINQLMNCVIDRFGFPHRYLPGVLCMQGKYSLDEAMKCVTENYPSEYERMRECASGTRGRRLLALSGQKTASLTPAIDFIPWIVING----SRNSDALYDLTQNVCEAMQPMPSACK 256          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Celegans
Match: C02D5.2 (GILT-like protein C02D5.2 [Source:UniProtKB/Swiss-Prot;Acc:P34276])

HSP 1 Score: 97.4413 bits (241), Expect = 1.671e-22
Identity = 61/184 (33.15%), Postives = 84/184 (45.65%), Query Frame = 1
Query:  640 DNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGF--ITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAI-SITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQC 1182
            +N + LDVYME +CPDT  F   QL     +LG    I +N+ P+GKA        +E  CQHG  ECQ N ++ C I        Y+P   C+    +     K   E Y  +Y+ + EC  G +G  L       T+SL P + +IPWI+IN     S    A   L   +C   +  P  C
Sbjct:  136 ENIVKLDVYMEAQCPDTSRFFRQQLKKAWDILGRLNRIELNVIPFGKARCTEKGNDFECQCQHGPTECQINQLMNCVIDRFGFPHRYLPGVLCMQGKYSLDEAMKCVTENYPSEYERMRECASGTRGRRLLALSGQKTASLTPAIDFIPWIVING----SRNSDALYDLTQNVCEAMQPMPSAC 315          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Celegans
Match: F37H8.5 (GILT-like protein F37H8.5 [Source:UniProtKB/Swiss-Prot;Acc:O17861])

HSP 1 Score: 78.5666 bits (192), Expect = 3.885e-16
Identity = 58/196 (29.59%), Postives = 91/196 (46.43%), Query Frame = 1
Query:  613 FSTFQD----ADGDNKLVLDVYMETRCPDTQVFIDDQLVPVT-QLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANF----KTCCEEYNLDYD---LINECFEGDKGNSLQHKYALATSSLVP-KLAYIPWIIINKVFSQSNQDKATTYLKGLICSYF 1161
            F++F D    A  + K+ + V +E  CPD Q F+  QL P+  +    ++ + L P+G A    V       CQHG +EC  N    C I      + +P  SC+ ++L     F    + C E+  +  D   L   C     G  LQ+K A AT+++ P +  ++PW+IIN V   S Q      L  L+C ++
Sbjct:   60 FASFCDKHRAATHNQKINITVLIEALCPDCQNFLTKQLYPIVFKNFANYVNIELVPFGNAK---VLEDGTIKCQHGEEECSINKFEGCFIDSMQDQSPLPTLSCIEESLQKKVEFADAVQQCFEKLQIGGDIQRLTQSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIINGVSLTSFQG-FQNQLPTLLCEWY 251          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Celegans
Match: ZK669.2 (pep chromosome:WBcel235:II:7936592:7938583:-1 gene:WBGene00014052.1 transcript:ZK669.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK669.2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.450e-15
Identity = 49/179 (27.37%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNL--YPYGKAD-EKFVNGKWEFNCQHGSQECQGNTILACAIS-ITNQSTYVPFSSCLM-KNL------NPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSY 1158
            ++ + E+ CPDT  +  + ++PV   L    T+N+  +P+G A   +        NCQHG  ECQ N + AC IS +     Y+P  +C+  KN       + + NF+      +LD + +  C +   G  L  ++      +  +L ++PWI+IN   SQ+ +++    LK ++C +
Sbjct:   76 IEFFGESLCPDTTRYFRNHIMPVWTSLQASSTINITYHPFGLASCRRSAETGIRCNCQHGPAECQLNMLQACVISTLQVPQLYLPIVNCMQGKNKFSSAVDDCIVNFRP---RPDLDENFMARCAQSQLGAKLMMQHGYRQKEVASELDWVPWILINGRRSQAAENQ----LKTIVCQF 247          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Celegans
Match: pqn-48 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:O76576])

HSP 1 Score: 70.4774 bits (171), Expect = 3.385e-13
Identity = 43/145 (29.66%), Postives = 67/145 (46.21%), Query Frame = 1
Query:  670 ETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLA---NFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVP-KLAYIPWIIIN 1092
            E  CP  Q FI +QL  V     G + + L P+G +    +     F+C HG +EC  N + +C I I      +PF  C  +N+         +TC       Y  I +C++G +G  LQ + A  T S  P  +  +P+++IN
Sbjct:  148 EALCPYCQKFIANQLGSVFNQFQGQLILELVPWGNSR---IMRDGSFSCNHGQKECDANRLQSCVIDILKVKGALPFIVCFERNIQHYGVEHAMQTCSAFIRSQYRQIRQCYDGPRGVQLQREAAQKTMSTRPNPILEVPYLLIN 289          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Fly
Match: CG41378 (gene:FBgn0085638 transcript:FBtr0301791)

HSP 1 Score: 107.842 bits (268), Expect = 3.590e-27
Identity = 62/171 (36.26%), Postives = 87/171 (50.88%), Query Frame = 1
Query:  646 KLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQS-TYVPFSSCL-MKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLIC 1152
            K+V+ VY E  CPD++ F+  QL+P  ++    + V L PYGKA  K  NGK  F+CQHG  ECQ N   ACA  I       +  ++C+ M N +P      C  + N D  +I  CFE  +G  L      +T+SL P + +IP I I+   SQ  Q+     L   +C
Sbjct:   13 KVVVTVYYEALCPDSKYFLTKQLLPTFKIAKSIMEVKLAPYGKAKTKEHNGKITFDCQHGPIECQANIYHACAAEIIEDPLLRLEVATCMIMDNHSPQEAMNKCTSQINFDDSVIQNCFESYRGVDLLKVIGESTNSLRPPITFIPTITIDG--SQGRQESILKDLLSEVC 181          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Fly
Match: CG41378 (gene:FBgn0085638 transcript:FBtr0301792)

HSP 1 Score: 107.842 bits (268), Expect = 4.689e-27
Identity = 62/171 (36.26%), Postives = 87/171 (50.88%), Query Frame = 1
Query:  646 KLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQS-TYVPFSSCL-MKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLIC 1152
            K+V+ VY E  CPD++ F+  QL+P  ++    + V L PYGKA  K  NGK  F+CQHG  ECQ N   ACA  I       +  ++C+ M N +P      C  + N D  +I  CFE  +G  L      +T+SL P + +IP I I+   SQ  Q+     L   +C
Sbjct:   22 KVVVTVYYEALCPDSKYFLTKQLLPTFKIAKSIMEVKLAPYGKAKTKEHNGKITFDCQHGPIECQANIYHACAAEIIEDPLLRLEVATCMIMDNHSPQEAMNKCTSQINFDDSVIQNCFESYRGVDLLKVIGESTNSLRPPITFIPTITIDG--SQGRQESILKDLLSEVC 190          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Fly
Match: CG41378 (gene:FBgn0085638 transcript:FBtr0301790)

HSP 1 Score: 107.457 bits (267), Expect = 1.165e-26
Identity = 62/171 (36.26%), Postives = 87/171 (50.88%), Query Frame = 1
Query:  646 KLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQS-TYVPFSSCL-MKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLIC 1152
            K+V+ VY E  CPD++ F+  QL+P  ++    + V L PYGKA  K  NGK  F+CQHG  ECQ N   ACA  I       +  ++C+ M N +P      C  + N D  +I  CFE  +G  L      +T+SL P + +IP I I+   SQ  Q+     L   +C
Sbjct:   45 KVVVTVYYEALCPDSKYFLTKQLLPTFKIAKSIMEVKLAPYGKAKTKEHNGKITFDCQHGPIECQANIYHACAAEIIEDPLLRLEVATCMIMDNHSPQEAMNKCTSQINFDDSVIQNCFESYRGVDLLKVIGESTNSLRPPITFIPTITIDG--SQGRQESILKDLLSEVC 213          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Fly
Match: CG9427 (gene:FBgn0037721 transcript:FBtr0082104)

HSP 1 Score: 94.7449 bits (234), Expect = 2.947e-22
Identity = 62/182 (34.07%), Postives = 94/182 (51.65%), Query Frame = 1
Query:  625 QDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAI-SITNQSTYVPFSSCLMKNLNP-LANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFK 1164
            ++    NKL + +  E+ CPD++ F+  QL PV +  G +I + L P+GK+  +  NG   F+CQHG  EC+GN + +C I S  NQ+  V F  C M  L P  +    C  E  L  D+++ C   + G  LQ +  L T    P  ++IP I+ N VF Q  QD +    +G +C   +
Sbjct:   27 REKRQSNKLHITLLYESLCPDSRNFMH-QLGPVYEEFGDYIDILLVPFGKSQSE-RNGAI-FHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQM--LAPDYSRIDQCANEAGLLTDVVH-CLSSETGTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVCYMLR 200          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Fly
Match: CG9427 (gene:FBgn0037721 transcript:FBtr0334619)

HSP 1 Score: 90.8929 bits (224), Expect = 6.640e-21
Identity = 60/176 (34.09%), Postives = 91/176 (51.70%), Query Frame = 1
Query:  643 NKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAI-SITNQSTYVPFSSCLMKNLNP-LANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFK 1164
             +L + +  E+ CPD++ F+  QL PV +  G +I + L P+GK+  +  NG   F+CQHG  EC+GN + +C I S  NQ+  V F  C M  L P  +    C  E  L  D+++ C   + G  LQ +  L T    P  ++IP I+ N VF Q  QD +    +G +C   +
Sbjct:   32 KQLHITLLYESLCPDSRNFMH-QLGPVYEEFGDYIDILLVPFGKSQSE-RNGAI-FHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQM--LAPDYSRIDQCANEAGLLTDVVH-CLSSETGTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVCYMLR 199          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Zebrafish
Match: ifi30 (IFI30 lysosomal thiol reductase [Source:NCBI gene;Acc:336503])

HSP 1 Score: 119.783 bits (299), Expect = 7.600e-31
Identity = 65/188 (34.57%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  622 FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAIS-ITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLD--YDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            +      +K+ + +Y E+ CP  ++F+  QLVP   +L   + ++L PYG A E    GK+ F CQHG  EC GN I  C ++ +   +  V F  C+    + L + + C   Y  D  +D I +C +GD+GN L H+ A+ T +L P   Y+PWI +N   +   QDKA   L  L+CS +K + P
Sbjct:   53 YNSTKAADKVKVSLYYESLCPGCRMFLTSQLVPTLIMLQDIMEIDLVPYGNAQETQAQGKYIFTCQHGEDECLGNMIETCMLNKLGLDAVMVIF--CMESGNDVLKSAQPCLGVYRPDVTWDSIMQCVKGDQGNKLMHENAVKTDALNPPHQYVPWITVNGEHTDDLQDKAMGSLFSLVCSLYKGQKP 238          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Zebrafish
Match: ifi30 (IFI30 lysosomal thiol reductase [Source:NCBI gene;Acc:336503])

HSP 1 Score: 119.783 bits (299), Expect = 7.600e-31
Identity = 65/188 (34.57%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  622 FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAIS-ITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLD--YDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            +      +K+ + +Y E+ CP  ++F+  QLVP   +L   + ++L PYG A E    GK+ F CQHG  EC GN I  C ++ +   +  V F  C+    + L + + C   Y  D  +D I +C +GD+GN L H+ A+ T +L P   Y+PWI +N   +   QDKA   L  L+CS +K + P
Sbjct:   53 YNSTKAADKVKVSLYYESLCPGCRMFLTSQLVPTLIMLQDIMEIDLVPYGNAQETQAQGKYIFTCQHGEDECLGNMIETCMLNKLGLDAVMVIF--CMESGNDVLKSAQPCLGVYRPDVTWDSIMQCVKGDQGNKLMHENAVKTDALNPPHQYVPWITVNGEHTDDLQDKAMGSLFSLVCSLYKGQKP 238          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Zebrafish
Match: si:dkey-197i20.6 (si:dkey-197i20.6 [Source:ZFIN;Acc:ZDB-GENE-131127-557])

HSP 1 Score: 112.079 bits (279), Expect = 4.848e-28
Identity = 60/180 (33.33%), Postives = 97/180 (53.89%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYN--LDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFK-IRPPQCS 1185
            + +Y E+ C   + F+ +QL P   LL   + VNL P+G A E  V  +  F+CQHG  EC  N + AC +     + + P   C+  + +   + K C + Y   + ++ I  C  G+ G+SL H+ A+ T +L P   ++PWI IN  ++   +DKA + L  L+CS +K I+PP C+
Sbjct:   69 ISLYYESLCSGCRAFLTEQLFPTWTLLKDIMKVNLVPFGNAKE--VPEENSFSCQHGEPECYANMVEACVLYEATHAAF-PVIHCMESSADVTQSAKPCLQLYAPFIKWETIESCTRGELGHSLMHQNAVKTQALKPAHTHVPWITINGKYTSELEDKAMSTLFNLVCSLYKGIKPPVCT 245          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Xenopus
Match: nxpe3 (neurexophilin and PC-esterase domain family member 3 [Source:Xenbase;Acc:XB-GENE-949458])

HSP 1 Score: 116.701 bits (291), Expect = 1.043e-29
Identity = 65/198 (32.83%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  595 QAASGCFSTFQDAD----GDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQ-STYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKI 1167
            Q    C   + + D     +  + +D++ E+ C   + F+  QL P   +L   I V L PYG A E  + GKW F+CQHG +EC GN + AC I I +    Y P   C+  + N   + ++C   Y   L    + EC  GD GN L H+ A  T  L P   Y+PWI+I+ + +   Q +A + L  L+C  +K+
Sbjct:   37 QVEKQCLEFYSNRDLKKSSEPAIQIDLFYESLCGGCRGFLVRQLFPSWLMLAEIINVTLVPYGNAQETNITGKWVFDCQHGPEECLGNMMEACLIHILDDIYKYFPIIFCMESSNNITKSLESCLAVYAPELPLKTVLECVNGDLGNKLMHENAQKTKGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFNLVCDTYKV 234          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Xenopus
Match: nxpe3 (neurexophilin and PC-esterase domain family member 3 [Source:Xenbase;Acc:XB-GENE-949458])

HSP 1 Score: 116.701 bits (291), Expect = 1.642e-29
Identity = 66/202 (32.67%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  595 QAASGCFSTFQDAD----GDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQ-STYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQ 1179
            Q    C   + + D     +  + +D++ E+ C   + F+  QL P   +L   I V L PYG A E  + GKW F+CQHG +EC GN + AC I I +    Y P   C+  + N   + ++C   Y   L    + EC  GD GN L H+ A  T  L P   Y+PWI+I+ + +   Q +A + L  L+C  +K   P+
Sbjct:   37 QVEKQCLEFYSNRDLKKSSEPAIQIDLFYESLCGGCRGFLVRQLFPSWLMLAEIINVTLVPYGNAQETNITGKWVFDCQHGPEECLGNMMEACLIHILDDIYKYFPIIFCMESSNNITKSLESCLAVYAPELPLKTVLECVNGDLGNKLMHENAQKTKGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFNLVCDTYKGPKPE 238          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Mouse
Match: Ifi30 (Gamma-interferon-inducible lysosomal thiol reductase [Source:UniProtKB/Swiss-Prot;Acc:Q9ESY9])

HSP 1 Score: 87.4261 bits (215), Expect = 3.371e-19
Identity = 44/149 (29.53%), Postives = 73/149 (48.99%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINK 1095
            + +Y E+ C   + F+   L P   ++   + + L PYG A E+ V+G WEF CQHG  EC+ N + AC +    +        C+ +  +       C + Y   +  + I EC  G +G  L H+ A  T +L P   Y+PW+++N+
Sbjct:   61 VSLYYESLCGACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNE 209          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Mouse
Match: Ifi30 (Gamma-interferon-inducible lysosomal thiol reductase [Source:UniProtKB/Swiss-Prot;Acc:Q9ESY9])

HSP 1 Score: 87.4261 bits (215), Expect = 3.371e-19
Identity = 44/149 (29.53%), Postives = 73/149 (48.99%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINK 1095
            + +Y E+ C   + F+   L P   ++   + + L PYG A E+ V+G WEF CQHG  EC+ N + AC +    +        C+ +  +       C + Y   +  + I EC  G +G  L H+ A  T +L P   Y+PW+++N+
Sbjct:   61 VSLYYESLCGACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNE 209          
BLAST of IFI30 lysosomal thiol reductase vs. UniProt/SwissProt
Match: sp|E7E2N8|GILT_CARAU (Gamma-interferon-inducible lysosomal thiol reductase OS=Carassius auratus OX=7957 GN=ifi30 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 4.125e-30
Identity = 65/178 (36.52%), Postives = 92/178 (51.69%), Query Frame = 1
Query:  649 LVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLD--YDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            + + +Y E+ CP  + F+  QLVP   +L   + + L PYG A EK   G + F CQHG  EC+GN I  C +        +P   C+    + L   + C   Y  D  +D + +C  GD+GN L H+ AL T++L P   Y+PWI IN   +   QDKAT  L  L+CS +K   P
Sbjct:   58 VTVSLYYESLCPGCREFLVSQLVPTFIMLSDIMNIELVPYGNAQEKDDQGNYTFICQHGEDECRGNMIETCLLKALGPKA-IPVIFCMESGADVLKAAQPCLGVYFPDTTWDSVMKCVTGDEGNKLMHQNALKTNALKPPHEYVPWITINGEHTDDLQDKATNSLFNLVCSLYKGEKP 234          
BLAST of IFI30 lysosomal thiol reductase vs. UniProt/SwissProt
Match: sp|Q5XJN2|GILT_DANRE (Gamma-interferon-inducible lysosomal thiol reductase OS=Danio rerio OX=7955 GN=ifi30 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 5.737e-30
Identity = 65/188 (34.57%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  622 FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAIS-ITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLD--YDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            +      +K+ + +Y E+ CP  ++F+  QLVP   +L   + ++L PYG A E    GK+ F CQHG  EC GN I  C ++ +   +  V F  C+    + L + + C   Y  D  +D I +C +GD+GN L H+ A+ T +L P   Y+PWI +N   +   QDKA   L  L+CS +K + P
Sbjct:   53 YNSTKAADKVKVSLYYESLCPGCRMFLTSQLVPTLIMLQDIMEIDLVPYGNAQETQAQGKYIFTCQHGEDECLGNMIETCMLNKLGLDAVMVIF--CMESGNDVLKSAQPCLGVYRPDVTWDSIMQCVKGDQGNKLMHENAVKTDALNPPHQYVPWITVNGEHTDDLQDKAMGSLFSLVCSLYKGQKP 238          
BLAST of IFI30 lysosomal thiol reductase vs. UniProt/SwissProt
Match: sp|A6QPN6|GILT_BOVIN (Gamma-interferon-inducible lysosomal thiol reductase OS=Bos taurus OX=9913 GN=IFI30 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 3.372e-24
Identity = 57/176 (32.39%), Postives = 86/176 (48.86%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            + +Y E  CP  + F+  +L P   ++   + V L PYG A E+ V+GKWEF CQHG +EC  N + AC +    Q        CL +  +   N K C + Y   +  D I EC  G++G  L H  A  T +L P   Y+PW+++N         K   +L  L+C  ++ + P
Sbjct:   58 VSLYYEALCPGCREFLIRELFPTWLMVLEILNVTLVPYGNAQERNVSGKWEFTCQHGERECLLNKVEACLLDQLEQKIAFLTIVCLEEMDDMEQNLKPCLQIYAPKVSADSIMECATGNRGMQLLHINAQLTDALRPPHKYVPWVVVN-----GEHMKDAEHLLHLVCRLYQGQKP 228          
BLAST of IFI30 lysosomal thiol reductase vs. UniProt/SwissProt
Match: sp|B3SP85|GILT_PIG (Gamma-interferon-inducible-lysosomal thiol reductase OS=Sus scrofa OX=9823 GN=IFI30 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.481e-22
Identity = 57/197 (28.93%), Postives = 95/197 (48.22%), Query Frame = 1
Query:  595 QAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIIN-KVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            +A   C            + +++Y E+ C   + F+  +L P   ++   + V L PYG A E+ V+G+WEF CQHG QEC+ N + AC +    ++       C+ +  +   N + C + Y   +  D I EC  GD+G  L H  A  T +L P   Y+PW+++N K  ++ +Q      L  L+C  ++   P
Sbjct:   40 KAGEPCLQRPVGKSDPPPVNVNLYYESLCNGCRYFLVRELFPTWLMVWEILNVTLVPYGNAQERNVSGRWEFTCQHGEQECKMNKVEACLLDKLEKNMAFLTIVCIEELDDMEKNLEPCLQIYAPKVSPDSIMECAMGDRGMQLLHINAQLTDALKPPHEYVPWVVVNGKPMTEKDQ------LLRLVCQLYEGEKP 230          
BLAST of IFI30 lysosomal thiol reductase vs. UniProt/SwissProt
Match: sp|P13284|GILT_HUMAN (Gamma-interferon-inducible lysosomal thiol reductase OS=Homo sapiens OX=9606 GN=IFI30 PE=1 SV=3)

HSP 1 Score: 97.0561 bits (240), Expect = 9.044e-22
Identity = 55/174 (31.61%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  661 VYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            +Y E  C   + F+  +L P   L+   + V L PYG A E+ V+G+WEF CQHG +EC+ N + AC +   +         C+ +  +   +   C + Y   L  D I EC  GD+G  L H  A  T +L P   Y+PW+ +N    +  +D+  T L  L+C  ++ + P
Sbjct:   66 LYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVN---GKPLEDQ--TQLLTLVCQLYQGKKP 234          
BLAST of IFI30 lysosomal thiol reductase vs. TrEMBL
Match: A0A3G3LPG6 (Gamma-interferon-inducible lysosomal thiol reductase OS=Dugesia japonica OX=6161 GN=GILT PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 2.847e-102
Identity = 145/209 (69.38%), Postives = 172/209 (82.30%), Query Frame = 1
Query:  562 MSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKI-RPPQCS 1185
            M   L I LI  A SGC+S    AD   KL+LDVYMETRCPDTQVFIDDQLVPVT+LLG ++ V LYPYGKA+EKFV  KWEF CQHG  ECQGNTILACAIS+TNQS YVPF+SCLM++LNPL+NF++CCE++ LD +L+N+CF+G KGN LQH YALATSSLVPKL YIPWII+NKV++Q+NQD+A T LK LIC + K+  PP+CS
Sbjct:    1 MKIILSIILIYHAVSGCYSKISQAD---KLLLDVYMETRCPDTQVFIDDQLVPVTKLLGNYVEVTLYPYGKAEEKFVGNKWEFICQHGPLECQGNTILACAISMTNQSIYVPFTSCLMRDLNPLSNFRSCCEQFKLDLNLVNKCFQGQKGNELQHHYALATSSLVPKLVYIPWIILNKVYTQANQDQAATNLKALICKHIKVPPPPECS 206          
BLAST of IFI30 lysosomal thiol reductase vs. TrEMBL
Match: A7SMR3 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g246231 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.748e-36
Identity = 74/213 (34.74%), Postives = 118/213 (55.40%), Query Frame = 1
Query:  562 MSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISI-TNQSTYVPFSSCL---MKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLIC-SYFKIRPPQCS 1185
            M++   +F ++  A G F  +  A    K+ + +Y E+ CP  + FI DQL P  Q +G  + + L PYG A +     KW F+CQHG  EC+GN I +CAI+I  N +TY PF  C    + + NP +  + C +   +DY  I++C  G +GN  +H   + T +L P+  ++PW+ +N   ++  Q++ATT L  L+C SY   +P  C+
Sbjct:    1 MAYVNAVFAVALIA-GVFPVYSQAA--PKVSIALYYESLCPGCRAFISDQLYPTYQKIGEIMDITLVPYGNAQQYKYGNKWVFSCQHGQGECEGNIIESCAINILQNLTTYFPFIHCFEQYISSSNPSSTARYCAQLLRIDYTPIDKCASGPQGNQFEHDMGVKTEALEPQHQFVPWVTMNGKHTEEIQNEATTELLKLVCDSYQGAKPAACT 210          
BLAST of IFI30 lysosomal thiol reductase vs. TrEMBL
Match: A0A2P2I298 (Gamma-interferon-inducible lysosomal thiol reductase-like OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 6.824e-36
Identity = 72/180 (40.00%), Postives = 106/180 (58.89%), Query Frame = 1
Query:  646 KLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADE-KFVNGKWEFNCQHGSQECQGNTILACAIS-ITNQSTYVPFSSCLMKN-LNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            ++ L+VYMET CPD + F  +QL P  + L   + V +YPYG A E     G + F CQ+G  ECQGN +LACA   I N  T+V +S C+M++   P+   K C E+ N+D+D I  C    +G+ + H+ A+AT +L PK  Y+PW++IN + ++  Q  A + LK  IC  +   PP
Sbjct:   42 RVKLEVYMETMCPDCRGFFHEQLAPTWKQLRSIMDVEIYPYGNAKETPLSGGGYNFTCQNGPLECQGNMMLACAQKYIHNNPTFVDYSICVMEDSKTPIRTGKKCAEQLNVDFDPILMCSLSREGDEVLHEVAVATDNLQPKHTYVPWMVINNIHTEEIQSAALSDLKKYICGVYTGAPP 221          
BLAST of IFI30 lysosomal thiol reductase vs. TrEMBL
Match: A0A2B4SSD0 (Gamma-interferon-inducible lysosomal thiol reductase OS=Stylophora pistillata OX=50429 GN=IFI30 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.430e-35
Identity = 81/220 (36.82%), Postives = 118/220 (53.64%), Query Frame = 1
Query:  556 NIMSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAIS-ITNQSTYVPFSSCLMKNL----NPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS*KYKF 1200
             +++++LL  + S A+S         D   K+ L +Y E+ CPD Q+FI  QL P    +   + + L PYG A+E+    KW F CQHG +EC+GN I  CAIS + N S  +PF  C  KN+     P A  +TC +   +DYD I  C  G  GN L+HK A  T +L P+  Y+PW+ +N   ++  Q+KA   L  L+C Y+    P+   K +F
Sbjct:    3 GLLAWSLLCLVPSIASSF-------PDDAPKVELALYYESLCPDCQLFIRQQLYPTYLKVSDILDLTLVPYGNAEERKSGDKWVFQCQHGPKECEGNLIETCAISLLKNISASLPFVYCFEKNIEGSEEPKAVAETCAKSLKIDYDSIEACVSGSLGNELEHKMAAMTDALEPQHQYVPWVTVNGKHTEKIQNKAERNLLELVCEYYTGTKPKPCEKQEF 215          

HSP 2 Score: 134.42 bits (337), Expect = 4.952e-31
Identity = 77/223 (34.53%), Postives = 114/223 (51.12%), Query Frame = 1
Query:  550 CFNIMSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISI-TNQSTYVPFSSCLMKNL---NPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFK-IRPPQCS*KYKFI 1203
            C   M   L I  +  AA   F     A    K+ + +Y E+ C   + FI+ Q  P    +G  + V L PYG A E     +W F CQHG  EC GN I  CAISI  N +++ PF  CL   +   NP++  + C  +  +D+  I++C  G +GN+L+H+ AL T++L P   ++PWI +N   +   Q++AT  L GL+C  +K  +P  C  K   I
Sbjct:  259 CRGKMKIKLYILFVLLAALPVFCVGAPAAAP-KVEIALYYESLCGGCRQFIETQFYPTFLKVGQIMDVTLVPYGNAQESRTGDEWRFTCQHGEAECVGNIIETCAISILQNATSFFPFIHCLESTIAEYNPVSAAEQCAGQLGIDFSSIDKCQSGAQGNALEHEMALKTNALNPPHYFVPWITLNGKHTDEIQNRATFDLLGLVCDTYKGTKPDACQKKESAI 480          
BLAST of IFI30 lysosomal thiol reductase vs. TrEMBL
Match: A7SMR2 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g191409 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 3.643e-35
Identity = 68/184 (36.96%), Postives = 103/184 (55.98%), Query Frame = 1
Query:  649 LVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISI-TNQSTYVPFSSC---LMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLIC-SYFKIRPPQCS 1185
            + + +Y E+ C   +  I DQL P  Q +G  + + L PYG A E     KW FNCQHG  EC+GN I  CAI++  N S Y PF  C    + + NP +  + C ++  +DY  I +C  G +GN L+H+  + T +LVP+  Y+PW+ +N   ++  Q++AT  + GL+C +Y   RP  C 
Sbjct:    6 VAISLYYESMCGGCRDMIRDQLYPTFQKVGSIMDITLVPYGNAQEYRYGNKWVFNCQHGQGECEGNIIEVCAINVLKNISAYFPFIHCFEQFISSYNPSSTAQYCAKQLGIDYAPIEKCASGLQGNELEHEMGVETDALVPRHNYVPWVTLNGEHTEEIQNQATFNMLGLVCDNYQGARPAACG 189          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Cavefish
Match: si:dkey-197i20.6 (IFI30 lysosomal thiol reductase [Source:NCBI gene;Acc:103047207])

HSP 1 Score: 112.849 bits (281), Expect = 2.209e-28
Identity = 62/181 (34.25%), Postives = 100/181 (55.25%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYN---LDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFK-IRPPQCS 1185
            + VY E+ CP  + F+ +QL P   +L   +TV+L PYG A+E  + G+  F CQHG   C+ N   AC +++T Q+ + P   C M + + + N    C + N   ++++ I  C  G  G+SL H+  + T SL P   Y+PW+  N V+    +DKA + L  L+C  ++ I+PP C+
Sbjct:   68 VTVYYESLCPGCRSFLTEQLFPTWTMLKDIMTVHLVPYGNAEE--IPGQNSFLCQHGEPGCKANVFEACILNVTGQAAF-PVIYC-MASSSDVINAALPCLQLNAPSVEWEAIQSCVIGGLGHSLMHENGVKTRSLKPAHKYVPWVTFNGVYKDDWEDKAMSSLFNLVCMLYEGIKPPVCT 244          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Cavefish
Match: ENSAMXT00000037267.1 (gamma-interferon-inducible lysosomal thiol reductase-like [Source:NCBI gene;Acc:103023905])

HSP 1 Score: 111.694 bits (278), Expect = 7.598e-28
Identity = 60/188 (31.91%), Postives = 94/188 (50.00%), Query Frame = 1
Query:  610 CFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLD--YDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKI 1167
            CF           + + +Y E+ CP  + F+  QL+P   +L   + V L PYG A E    G + + CQHG +EC GN I  C ++      Y+   +C+  +++ L   K C E +     +D I +C  G +GN L H  A+ T +L P   Y+PW+ +N   S+  Q KA + L  L+CS +K+
Sbjct:   53 CFGANVTKSSAPPVNISLYYESLCPGCRQFLVLQLMPTFFMLNDIMNVELVPYGNAQETGPPGNYVYTCQHGPEECTGNMIETCMLNKMGDDAYLAI-NCMEMSVDVLKAAKPCSELFTEKSYWDDIQKCVSGAEGNKLMHLNAVKTGALKPPHEYVPWVTVNGEHSEDLQQKAMSSLFNLVCSLYKV 239          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Cavefish
Match: ENSAMXT00000042139.1 (gamma-interferon-inducible lysosomal thiol reductase-like [Source:NCBI gene;Acc:103023905])

HSP 1 Score: 110.923 bits (276), Expect = 1.305e-27
Identity = 62/195 (31.79%), Postives = 97/195 (49.74%), Query Frame = 1
Query:  610 CFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLD--YDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKI-RPPQCS 1185
            CF           + + +Y E+ CP  + F+  QL+P   +L   + V L PYG A E    G + + CQHG +EC GN I  C ++      Y+   +C+  +++ L   K C E +     +D I +C  G +GN L H  A+ T +L P   Y+PW+ +N   S+  Q KA + L  L+CS +K  +P  C+
Sbjct:   53 CFGANVTKSSAPPVNISLYYESLCPGCRQFLVLQLMPTFFMLNDIMNVELVPYGNAQETGPPGNYVYTCQHGPEECTGNMIETCMLNKMGDDAYLAI-NCMEMSVDVLKAAKPCSELFTEKSYWDDIQKCVSGAEGNKLMHLNAVKTGALKPPHEYVPWVTVNGEHSEDLQQKAMSSLFNLVCSLYKGDKPAACT 246          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Sea Lamprey
Match: IFI30 (IFI30 lysosomal thiol reductase [Source:HGNC Symbol;Acc:HGNC:5398])

HSP 1 Score: 124.79 bits (312), Expect = 3.962e-34
Identity = 69/194 (35.57%), Postives = 93/194 (47.94%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAIS-ITNQSTYVPFSSCLMKNLNPLANFKTCCE--EYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS*KYKFIL*RKIIFC 1227
            L++Y E+ CP  + F   QL     LLG  + V L PYG A EK    KW F CQHG  EC GN + AC I  + N + +VP   C+    NP++    C       L++  +  C  G  GN L H  A  T +L P   Y+PWI+ N   ++  Q+KA   L  ++CS +K   P    K    L RK   C
Sbjct:    5 LELYAESLCPGCRAFTTGQLYGTWLLLGDIMNVTLVPYGNAQEKHDGDKWVFTCQHGPNECLGNLLQACLIHYLPNNADHVPIIYCMEAAENPVSAASQCAALLAPTLNWQQVETCANGTLGNQLMHSNAQLTDALNPPHKYVPWIVFNGAHTEEIQNKAMEALLPMVCSAYKGELPAACGKLTHCLKRKCKLC 198          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Nematostella
Match: EDO35014 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMR3])

HSP 1 Score: 141.739 bits (356), Expect = 6.567e-40
Identity = 74/213 (34.74%), Postives = 118/213 (55.40%), Query Frame = 1
Query:  562 MSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISI-TNQSTYVPFSSCL---MKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLIC-SYFKIRPPQCS 1185
            M++   +F ++  A G F  +  A    K+ + +Y E+ CP  + FI DQL P  Q +G  + + L PYG A +     KW F+CQHG  EC+GN I +CAI+I  N +TY PF  C    + + NP +  + C +   +DY  I++C  G +GN  +H   + T +L P+  ++PW+ +N   ++  Q++ATT L  L+C SY   +P  C+
Sbjct:    1 MAYVNAVFAVALIA-GVFPVYSQAA--PKVSIALYYESLCPGCRAFISDQLYPTYQKIGEIMDITLVPYGNAQQYKYGNKWVFSCQHGQGECEGNIIESCAINILQNLTTYFPFIHCFEQYISSSNPSSTARYCAQLLRIDYTPIDKCASGPQGNQFEHDMGVKTEALEPQHQFVPWVTMNGKHTEEIQNEATTELLKLVCDSYQGAKPAACT 210          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Nematostella
Match: EDO35033 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMR2])

HSP 1 Score: 138.272 bits (347), Expect = 5.038e-39
Identity = 68/184 (36.96%), Postives = 103/184 (55.98%), Query Frame = 1
Query:  649 LVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISI-TNQSTYVPFSSC---LMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLIC-SYFKIRPPQCS 1185
            + + +Y E+ C   +  I DQL P  Q +G  + + L PYG A E     KW FNCQHG  EC+GN I  CAI++  N S Y PF  C    + + NP +  + C ++  +DY  I +C  G +GN L+H+  + T +LVP+  Y+PW+ +N   ++  Q++AT  + GL+C +Y   RP  C 
Sbjct:    6 VAISLYYESMCGGCRDMIRDQLYPTFQKVGSIMDITLVPYGNAQEYRYGNKWVFNCQHGQGECEGNIIEVCAINVLKNISAYFPFIHCFEQFISSYNPSSTAQYCAKQLGIDYAPIEKCASGLQGNELEHEMGVETDALVPRHNYVPWVTLNGEHTEEIQNQATFNMLGLVCDNYQGARPAACG 189          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Nematostella
Match: EDO41893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S332])

HSP 1 Score: 85.8853 bits (211), Expect = 7.814e-20
Identity = 48/174 (27.59%), Postives = 84/174 (48.28%), Query Frame = 1
Query:  646 KLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYV-PFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFK 1164
            K+ L VY  ++ P+ + F+  QL P +  +   + +++ P+G   E      +++ C +G++EC  N I ACA++  N    +  F  CL      +      C     DY+ +  C +  +G  + H  A  T  L PK+++ PWI +N   S+  Q +A   L  L+CS +K
Sbjct:    3 KVKLAVYYNSKNPEFRRFMVAQLYPTSNKIPNILDISMVPFGDGKEIKAKSGFQYYCTNGAEECLENLIQACAVATENNPEILTSFVGCLSYYDGSVDKIAKYCSNQIKDYEKVEYCLKNTQGLEVMHYMAKKTRGLQPKMSHSPWITVNGEHSEFIQQQAMENLLQLVCSKYK 176          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Medaka
Match: ifi30 (gamma-interferon-inducible lysosomal thiol reductase [Source:NCBI gene;Acc:101164924])

HSP 1 Score: 127.487 bits (319), Expect = 1.248e-33
Identity = 67/176 (38.07%), Postives = 99/176 (56.25%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYN--LDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPP 1176
            + +Y E+ CP  + F+ + ++P   LL   +TV+L P+G A EK    K+ F CQHG  ECQGN I  C +++TN +   P   C+  + + L + ++C + Y   L  D +N C +GD GN L H+ AL T+ L P   Y+PW+ IN   S   Q KA+T L  L+CS +K   P
Sbjct:   61 VGLYYESLCPGCREFLVEMIMPTWILLNDIMTVHLVPFGNAQEKTEGQKYVFECQHGEDECQGNLIETCLLNMTNMA--FPIIFCMESSTDVLGSVESCLKVYEPQLSMDKLNGCVKGDLGNQLMHQNALQTAGLKPPHQYVPWVTINGEHSDDLQQKASTSLFSLVCSLYKGPKP 234          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Medaka
Match: si:dkey-197i20.6 (IFI30 lysosomal thiol reductase [Source:NCBI gene;Acc:101167441])

HSP 1 Score: 119.013 bits (297), Expect = 1.358e-30
Identity = 60/180 (33.33%), Postives = 98/180 (54.44%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFK-IRPPQCS 1185
            + +Y ET CPD ++FI +QL P   +L   ++V L PYG A E   +    F CQHG  EC+GN I AC + +T  S       C+  + + L+  + C   Y  ++ +  +N C  GD G  L H  A+ T +L P   ++PW+  N  +++ N++KA + L  L+C  ++ ++PP C+
Sbjct:   69 ITLYYETLCPDCRIFISEQLFPTWLMLKDIMSVTLVPYGNAQE-VQSPTSSFICQHGEPECKGNMIQACILHLTTNSLAFQIIYCMESSADVLSAAQPCLHLYAPSVSWSSVNSCVSGDLGFRLMHGNAVMTRALNPPHTHVPWVTFNGEYTEENEEKAMSSLFHLVCELYQGVKPPACT 247          
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Medaka
Match: si:dkey-197i20.6 (IFI30 lysosomal thiol reductase [Source:NCBI gene;Acc:101167441])

HSP 1 Score: 112.464 bits (280), Expect = 3.964e-28
Identity = 57/172 (33.14%), Postives = 92/172 (53.49%), Query Frame = 1
Query:  655 LDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY--NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFK 1164
            + +Y ET CPD ++FI +QL P   +L   ++V L PYG A E   +    F CQHG  EC+GN I AC + +T  S       C+  + + L+  + C   Y  ++ +  +N C  GD G  L H  A+ T +L P   ++PW+  N  +++ N++KA + L  L+C  ++
Sbjct:   69 ITLYYETLCPDCRIFISEQLFPTWLMLKDIMSVTLVPYGNAQE-VQSPTSSFICQHGEPECKGNMIQACILHLTTNSLAFQIIYCMESSADVLSAAQPCLHLYAPSVSWSSVNSCVSGDLGFRLMHGNAVMTRALNPPHTHVPWVTFNGEYTEENEEKAMSSLFHLVCELYQ 239          
BLAST of IFI30 lysosomal thiol reductase vs. Planmine SMEST
Match: SMESG000052978.1 (SMESG000052978.1)

HSP 1 Score: 459.529 bits (1181), Expect = 9.576e-164
Identity = 223/224 (99.55%), Postives = 223/224 (99.55%), Query Frame = 1
Query:  514 MSLDSTTCCYKFCFNIMSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 1185
            MSL STTCCYKFCFNIMSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS
Sbjct:    1 MSLYSTTCCYKFCFNIMSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 224          
BLAST of IFI30 lysosomal thiol reductase vs. Planmine SMEST
Match: SMESG000052978.1 (SMESG000052978.1)

HSP 1 Score: 431.409 bits (1108), Expect = 5.545e-153
Identity = 208/208 (100.00%), Postives = 208/208 (100.00%), Query Frame = 1
Query:  562 MSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 1185
            MSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS
Sbjct:    1 MSFTLLIFLISQAASGCFSTFQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 208          
BLAST of IFI30 lysosomal thiol reductase vs. Planmine SMEST
Match: SMESG000052978.1 (SMESG000052978.1)

HSP 1 Score: 393.66 bits (1010), Expect = 6.668e-138
Identity = 188/188 (100.00%), Postives = 188/188 (100.00%), Query Frame = 1
Query:  622 FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 1185
            FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS
Sbjct:   35 FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 222          
BLAST of IFI30 lysosomal thiol reductase vs. Planmine SMEST
Match: SMESG000052978.1 (SMESG000052978.1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.179e-137
Identity = 188/188 (100.00%), Postives = 188/188 (100.00%), Query Frame = 1
Query:  622 FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 1185
            FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS
Sbjct:   32 FQDADGDNKLVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSNQDKATTYLKGLICSYFKIRPPQCS 219          
BLAST of IFI30 lysosomal thiol reductase vs. Planmine SMEST
Match: SMESG000046200.1 (SMESG000046200.1)

HSP 1 Score: 123.25 bits (308), Expect = 7.018e-33
Identity = 59/173 (34.10%), Postives = 99/173 (57.23%), Query Frame = 1
Query:  649 LVLDVYMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFNCQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEYNLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIIN----KVFSQSNQDKATTYLKGLICS 1155
            + LDV++E++CPD++ F+ +QL+P       F ++ ++P+GKA+  F N +W F CQ+G  EC GN I  CA ++T    Y+PF  C M NL+P+A++  C +++ +D   +N C E  +G  L +  A+ T    P + ++P ++ N      +S+      T  LKG I S
Sbjct:   32 MKLDVFIESKCPDSKKFLIEQLIPFYNKHKNFSSIRIFPFGKANVSFKNNRWNFVCQNGPMECAGNIIFGCAANMTTIDHYLPFIGCSMTNLSPVADYPYCAKKFKIDLAQLNNCAESYRGILLHYNNAMETRLYEP-IRFVPHLVFNGKSDPFYSRIIVSNITAVLKGSIPS 203          
The following BLAST results are available for this feature:
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IFI301.883e-2231.61IFI30 lysosomal thiol reductase [Source:HGNC Symbo... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C02D5.25.816e-2332.97GILT-like protein C02D5.2 [Source:UniProtKB/Swiss... [more]
C02D5.21.671e-2233.15GILT-like protein C02D5.2 [Source:UniProtKB/Swiss... [more]
F37H8.53.885e-1629.59GILT-like protein F37H8.5 [Source:UniProtKB/Swiss... [more]
ZK669.22.450e-1527.37pep chromosome:WBcel235:II:7936592:7938583:-1 gene... [more]
pqn-483.385e-1329.66Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG413783.590e-2736.26gene:FBgn0085638 transcript:FBtr0301791[more]
CG413784.689e-2736.26gene:FBgn0085638 transcript:FBtr0301792[more]
CG413781.165e-2636.26gene:FBgn0085638 transcript:FBtr0301790[more]
CG94272.947e-2234.07gene:FBgn0037721 transcript:FBtr0082104[more]
CG94276.640e-2134.09gene:FBgn0037721 transcript:FBtr0334619[more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ifi307.600e-3134.57IFI30 lysosomal thiol reductase [Source:NCBI gene;... [more]
ifi307.600e-3134.57IFI30 lysosomal thiol reductase [Source:NCBI gene;... [more]
si:dkey-197i20.64.848e-2833.33si:dkey-197i20.6 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nxpe31.043e-2932.83neurexophilin and PC-esterase domain family member... [more]
nxpe31.642e-2932.67neurexophilin and PC-esterase domain family member... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ifi303.371e-1929.53Gamma-interferon-inducible lysosomal thiol reducta... [more]
Ifi303.371e-1929.53Gamma-interferon-inducible lysosomal thiol reducta... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E7E2N8|GILT_CARAU4.125e-3036.52Gamma-interferon-inducible lysosomal thiol reducta... [more]
sp|Q5XJN2|GILT_DANRE5.737e-3034.57Gamma-interferon-inducible lysosomal thiol reducta... [more]
sp|A6QPN6|GILT_BOVIN3.372e-2432.39Gamma-interferon-inducible lysosomal thiol reducta... [more]
sp|B3SP85|GILT_PIG3.481e-2228.93Gamma-interferon-inducible-lysosomal thiol reducta... [more]
sp|P13284|GILT_HUMAN9.044e-2231.61Gamma-interferon-inducible lysosomal thiol reducta... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3G3LPG62.847e-10269.38Gamma-interferon-inducible lysosomal thiol reducta... [more]
A7SMR34.748e-3634.74Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A2P2I2986.824e-3640.00Gamma-interferon-inducible lysosomal thiol reducta... [more]
A0A2B4SSD01.430e-3536.82Gamma-interferon-inducible lysosomal thiol reducta... [more]
A7SMR23.643e-3536.96Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-197i20.62.209e-2834.25IFI30 lysosomal thiol reductase [Source:NCBI gene;... [more]
ENSAMXT00000037267.17.598e-2831.91gamma-interferon-inducible lysosomal thiol reducta... [more]
ENSAMXT00000042139.11.305e-2731.79gamma-interferon-inducible lysosomal thiol reducta... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IFI303.962e-3435.57IFI30 lysosomal thiol reductase [Source:HGNC Symbo... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO350146.567e-4034.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350335.038e-3936.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418937.814e-2027.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ifi301.248e-3338.07gamma-interferon-inducible lysosomal thiol reducta... [more]
si:dkey-197i20.61.358e-3033.33IFI30 lysosomal thiol reductase [Source:NCBI gene;... [more]
si:dkey-197i20.63.964e-2833.14IFI30 lysosomal thiol reductase [Source:NCBI gene;... [more]
back to top
BLAST of IFI30 lysosomal thiol reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052978.19.576e-16499.55SMESG000052978.1[more]
SMESG000052978.15.545e-153100.00SMESG000052978.1[more]
SMESG000052978.16.668e-138100.00SMESG000052978.1[more]
SMESG000052978.11.179e-137100.00SMESG000052978.1[more]
SMESG000046200.17.018e-3334.10SMESG000046200.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022650 ID=SMED30022650|Name=IFI30 lysosomal thiol reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=1251bp
TGTCAAACAAACGGTTCTTTTTAATTTTAATATTTTCTCAAAAATGTTCA
CACTGTAATCTTAATGCAGGAATATTCAGTAATGACATGCGCCAGAACAG
CTATTAAACTGATATTAAATACATTGGGATCTATCCACATCCATCACATT
TATAAATAAGCAACAGTTTTGTGTGTCCTCGCATGAGATCTGCAAACTGC
CTGTTTATATTAGATTCAATTTGGAAATTTTTTAAATCAATTTTATGACA
ATGTAAAGTCCAAATCGCTCATAAAATTGATAGCATTTCACTGGCAGTTC
CACATTATTAATGATTTTGTTTATTCCATAGTTTTATCACTGTGCCGAGA
TTCAGAAAATCGTTGACCAAAGTTGCAATTGTGCAATCCATTGATAATTC
TGCAATTTTTATTGATTATTCTTACTGAGAACTAATTAATTGAGAGCTAA
CATTCATATATTTTGAAACTCAGTTGGAACATACCGGCACCAATTTGAAA
ATATTTGTGTGAAATGTCGCTAGATAGCACCACGTGTTGCTATAAATTTT
GTTTTAATATCATGAGTTTCACTTTGCTGATTTTCCTCATTTCTCAAGCA
GCTTCTGGATGCTTTTCCACGTTTCAGGATGCTGATGGAGACAACAAATT
GGTGCTTGATGTCTACATGGAGACTCGATGTCCTGATACGCAAGTTTTCA
TTGATGATCAATTAGTTCCAGTAACGCAACTGTTGGGAGGCTTTATCACC
GTCAATCTTTATCCTTATGGCAAAGCTGATGAGAAATTCGTTAATGGCAA
ATGGGAATTCAATTGCCAACATGGGTCACAGGAGTGTCAGGGAAACACAA
TTTTGGCCTGCGCCATATCTATAACTAACCAATCAACCTATGTGCCTTTT
TCATCTTGTTTAATGAAAAACTTGAACCCATTGGCCAATTTTAAAACATG
TTGCGAAGAATACAATTTAGATTACGATTTGATTAACGAATGCTTCGAAG
GGGATAAAGGCAATTCATTACAGCACAAATATGCTCTAGCTACCTCCAGT
TTGGTACCAAAACTAGCCTACATTCCATGGATTATTATTAATAAAGTATT
TTCTCAATCAAATCAAGATAAAGCTACGACGTATTTGAAAGGTCTCATTT
GCAGTTATTTCAAGATACGGCCTCCTCAGTGTTCCTGAAAATACAAATTC
ATTTTATAAAGAAAAATAATTTTTTGTAAAATTTGAACTAATAAATATAG
C
back to top

protein sequence of SMED30022650-orf-1

>SMED30022650-orf-1 ID=SMED30022650-orf-1|Name=SMED30022650-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=225bp
MSLDSTTCCYKFCFNIMSFTLLIFLISQAASGCFSTFQDADGDNKLVLDV
YMETRCPDTQVFIDDQLVPVTQLLGGFITVNLYPYGKADEKFVNGKWEFN
CQHGSQECQGNTILACAISITNQSTYVPFSSCLMKNLNPLANFKTCCEEY
NLDYDLINECFEGDKGNSLQHKYALATSSLVPKLAYIPWIIINKVFSQSN
QDKATTYLKGLICSYFKIRPPQCS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0047134protein-disulfide reductase activity
GO:0016491oxidoreductase activity
GO:0016667oxidoreductase activity, acting on a sulfur group of donors
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000067goblet cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004911Interferon-induced_GILT
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0042590antigen processing and presentation of exogenous peptide antigen via MHC class I
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005764lysosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPFAMPF03227GILTcoord: 48..149
e-value: 3.6E-27
score: 94.7
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPANTHERPTHR13234GAMMA-INTERFERON INDUCIBLE LYSOSOMAL THIOL REDUCTASE GILTcoord: 24..217
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..31
score: 0.717
NoneNo IPR availableTMHMMTMhelixcoord: 12..31