Androgen-induced protein

Overview
NameAndrogen-induced protein
Smed IDSMED30022644
Length (bp)785
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Androgen-induced protein (SMED30022644) t-SNE clustered cells

Violin plots show distribution of expression levels for Androgen-induced protein (SMED30022644) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Androgen-induced protein (SMED30022644) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Androgen-induced protein (SMED30022644) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022644

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022644SMESG000014624.1 Contig1145newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022644SMESG000014624.1 Contig1145uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Androgen-induced protein vs. Ensembl Human
Match: AIG1 (androgen induced 1 [Source:HGNC Symbol;Acc:HGNC:21607])

HSP 1 Score: 81.6481 bits (200), Expect = 7.847e-18
Identity = 57/181 (31.49%), Postives = 91/181 (50.28%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMI------------GNYIKTRSIKRSIILNT--LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F + +            GN  + R +K+ I L    L  + FP+ +FV  +FW +Y  +R+ +  K    ++P W+    HT VL  I+ ++  +   YP R  GL+ I   SV YI+W+  +H+ T  W YPFLE +    R  F+    ILM   Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGE 215          
BLAST of Androgen-induced protein vs. Ensembl Human
Match: AIG1 (androgen induced 1 [Source:HGNC Symbol;Acc:HGNC:21607])

HSP 1 Score: 81.2629 bits (199), Expect = 8.018e-18
Identity = 57/181 (31.49%), Postives = 91/181 (50.28%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMI------------GNYIKTRSIKRSIILNT--LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F + +            GN  + R +K+ I L    L  + FP+ +FV  +FW +Y  +R+ +  K    ++P W+    HT VL  I+ ++  +   YP R  GL+ I   SV YI+W+  +H+ T  W YPFLE +    R  F+    ILM   Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGE 215          
BLAST of Androgen-induced protein vs. Ensembl Human
Match: AIG1 (androgen induced 1 [Source:HGNC Symbol;Acc:HGNC:21607])

HSP 1 Score: 81.2629 bits (199), Expect = 1.017e-17
Identity = 57/181 (31.49%), Postives = 91/181 (50.28%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMI------------GNYIKTRSIKRSIILNT--LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F + +            GN  + R +K+ I L    L  + FP+ +FV  +FW +Y  +R+ +  K    ++P W+    HT VL  I+ ++  +   YP R  GL+ I   SV YI+W+  +H+ T  W YPFLE +    R  F+    ILM   Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGE 215          
BLAST of Androgen-induced protein vs. Ensembl Human
Match: AIG1 (androgen induced 1 [Source:HGNC Symbol;Acc:HGNC:21607])

HSP 1 Score: 76.2554 bits (186), Expect = 2.823e-16
Identity = 51/162 (31.48%), Postives = 83/162 (51.23%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMI------------GNYIKTRSIKRSIILNT--LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMR 574
            +G  +K LT I+L +Q ++F + +            GN  + R +K+ I L    L  + FP+ +FV  +FW +Y  +R+ +  K    ++P W+    HT VL  I+ ++  +   YP R  GL+ I   SV YI+W+  +H+ T  W YPFLE +    R
Sbjct:   31 YGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGAR 192          
BLAST of Androgen-induced protein vs. Ensembl Human
Match: ADTRP (androgen dependent TFPI regulating protein [Source:HGNC Symbol;Acc:HGNC:21214])

HSP 1 Score: 73.9442 bits (180), Expect = 3.547e-15
Identity = 52/184 (28.26%), Postives = 100/184 (54.35%), Query Frame = 2
Query:  116 KNEIKF-----GSKFKHLTSINLCLQTLYFLLM-IGNYIKTRSIKRSIILNTLF------SVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            K+E+K      G+++K++T +NL LQT+++ +  + + +K     + I   T F      ++ FP++ FV + FW L+  NRD +  K     +P W+  + HTF+  I + ++++ P  YP +K GL+++ A S+ YI  I  ++++T  W YP    LS      F+ + ++ + + Y + E
Sbjct:   29 KDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGE 212          
BLAST of Androgen-induced protein vs. Ensembl Fly
Match: CG3625 (gene:FBgn0031245 transcript:FBtr0078135)

HSP 1 Score: 82.4185 bits (202), Expect = 1.972e-18
Identity = 54/182 (29.67%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  113 VKNEIKFGSKFKHLTSINLCLQTLYFLL-MIGNYIKTRSI--KRSIILNT-----LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEF 634
            + N + FG KFK LT I   +Q LY+++ ++ +++ T  +  K+   +       + ++ FP+ + V + FW+LY I+R+ V  K      P W+    HT +++ II +L I+   YPKR  GL+ +      Y++WIH++ + +  W YP LE+L    R  F+       ++ Y + EF
Sbjct:   46 MPNTVPFGGKFKFLTFICAIIQALYYIVSLVNDFVGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQLPQRILFFAAVVGFTLSLYLLGEF 227          
BLAST of Androgen-induced protein vs. Ensembl Fly
Match: CG3625 (gene:FBgn0031245 transcript:FBtr0078136)

HSP 1 Score: 79.7221 bits (195), Expect = 1.889e-17
Identity = 51/175 (29.14%), Postives = 94/175 (53.71%), Query Frame = 2
Query:  134 GSKFKHLTSINLCLQTLYFLL-MIGNYIKTRSI--KRSIILNT-----LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEF 634
            G KFK+LT ++  +Q LY+++ ++ +++ T  +  K+   +       + ++ FP+ + V + FW+LY I+R+ V  K      P W+    HT +++ II +L I+   YPKR  GL+ +      Y++WIH++ + +  W YP LE+L    R  F+       ++ Y + EF
Sbjct:   56 GGKFKYLTFLDAIIQALYYIVSLVNDFVGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQLPQRILFFAAVVGFTLSLYLLGEF 230          
BLAST of Androgen-induced protein vs. Ensembl Fly
Match: CG11601 (gene:FBgn0031244 transcript:FBtr0078137)

HSP 1 Score: 73.1738 bits (178), Expect = 5.956e-15
Identity = 57/198 (28.79%), Postives = 98/198 (49.49%), Query Frame = 2
Query:  116 KNEIK--FGSKFKHLTSINLCLQTLYFLLMIGNYI--------KTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEFFVYLRTKPNRRLTNK 679
            ++E+K  +G KFK+LT +++ LQ +Y  L + N +         ++S+ RS+      +  FP+   V + FW +Y  +R+ +   +     P W+    HT V L+ I DL      YP R  G++   +  + YIIW+H++ Y +  W YP LE+L   +RY F  +     +  Y + EF   +   P  +L N+
Sbjct:   72 EDELKARWGGKFKYLTFLDVILQAIYHSLALLNDLFGDNNVSGDSKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEWVYPILEVLPAYLRYVFLALLVGFNLVCYLLGEFANNVVWGPEFKLLNQ 269          
BLAST of Androgen-induced protein vs. Ensembl Fly
Match: CG11601 (gene:FBgn0031244 transcript:FBtr0343780)

HSP 1 Score: 73.1738 bits (178), Expect = 5.956e-15
Identity = 57/198 (28.79%), Postives = 98/198 (49.49%), Query Frame = 2
Query:  116 KNEIK--FGSKFKHLTSINLCLQTLYFLLMIGNYI--------KTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEFFVYLRTKPNRRLTNK 679
            ++E+K  +G KFK+LT +++ LQ +Y  L + N +         ++S+ RS+      +  FP+   V + FW +Y  +R+ +   +     P W+    HT V L+ I DL      YP R  G++   +  + YIIW+H++ Y +  W YP LE+L   +RY F  +     +  Y + EF   +   P  +L N+
Sbjct:   72 EDELKARWGGKFKYLTFLDVILQAIYHSLALLNDLFGDNNVSGDSKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEWVYPILEVLPAYLRYVFLALLVGFNLVCYLLGEFANNVVWGPEFKLLNQ 269          
BLAST of Androgen-induced protein vs. Ensembl Fly
Match: CG11601 (gene:FBgn0031244 transcript:FBtr0343779)

HSP 1 Score: 73.1738 bits (178), Expect = 5.956e-15
Identity = 57/198 (28.79%), Postives = 98/198 (49.49%), Query Frame = 2
Query:  116 KNEIK--FGSKFKHLTSINLCLQTLYFLLMIGNYI--------KTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEFFVYLRTKPNRRLTNK 679
            ++E+K  +G KFK+LT +++ LQ +Y  L + N +         ++S+ RS+      +  FP+   V + FW +Y  +R+ +   +     P W+    HT V L+ I DL      YP R  G++   +  + YIIW+H++ Y +  W YP LE+L   +RY F  +     +  Y + EF   +   P  +L N+
Sbjct:   72 EDELKARWGGKFKYLTFLDVILQAIYHSLALLNDLFGDNNVSGDSKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDRELIFPSALDAIFPSWLNHVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSFILLYIIWLHIVRYFSGEWVYPILEVLPAYLRYVFLALLVGFNLVCYLLGEFANNVVWGPEFKLLNQ 269          
BLAST of Androgen-induced protein vs. Ensembl Zebrafish
Match: aig1 (androgen-induced 1 (H. sapiens) [Source:ZFIN;Acc:ZDB-GENE-041014-358])

HSP 1 Score: 75.0998 bits (183), Expect = 9.970e-16
Identity = 54/181 (29.83%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYF----------LLMIGNYI--KTRSIKRSIILNTLFSVI--FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F          LL  G+    + R +++ I L      +  FP+ +FV  MFW+LY  +RD +  +    ++P W+    HT VL  II ++      YP R  GL  + A +V Y++W+  +H  T  W YP LE +    R  F+     L+  +Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGVCVLTDLSSLLTKGSASMEQERQLRKLIGLRDWMMAVLAFPVGVFVVTMFWTLYLYDRDLIYPRLLDNFIPQWLNHGMHTTVLPFIIIEMRTTHHRYPSRPCGLLAVCAFAVGYVVWMCWVHSMTGVWVYPLLEHIGPTARILFFFCLMALINVYYVLGE 215          
BLAST of Androgen-induced protein vs. Ensembl Zebrafish
Match: aig1 (androgen-induced 1 (H. sapiens) [Source:ZFIN;Acc:ZDB-GENE-041014-358])

HSP 1 Score: 64.3142 bits (155), Expect = 6.691e-12
Identity = 53/181 (29.28%), Postives = 85/181 (46.96%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYF----------LLMIGNYI--KTRSIKRSIILNT--LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F          LL  G+    + R +++ I L    +  + FP+ +FV  MFW+LY  +RD +  +    ++P W+    HT VL  II ++      YP R  GL  + A SV     +  +H  T  W YP LE +    R  F+     L+  +Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGVCVLTDLSSLLTKGSASMEQERQLRKLIGLRDWMMAVLAFPVGVFVVTMFWTLYLYDRDLIYPRLLDNFIPQWLNHGMHTTVLPFIIIEMRTTHHRYPSRPCGLLAVCAFSVSGSHRMCWVHSMTGVWVYPLLEHIGPTARILFFFCLMALINVYYVLGE 215          
BLAST of Androgen-induced protein vs. Ensembl Zebrafish
Match: adtrp1 (androgen dependent TFPI regulating protein 1 [Source:ZFIN;Acc:ZDB-GENE-050417-220])

HSP 1 Score: 56.6102 bits (135), Expect = 4.238e-9
Identity = 44/180 (24.44%), Postives = 83/180 (46.11%), Query Frame = 2
Query:  128 KFGSKFKHLTSINLCLQTLYFLL-----MIGNYIKTRSIKRSIILNT------LFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             +G ++K+LT INL +  ++F L      + + +     +    LN        F+V+ FP+  FV + FW+LY  +R+ V  K   + +P W+  + HT ++ +++  + +    YP R  G+  +      Y+ W+  +H+ +  W YP +  LS      F     + M   Y + E
Sbjct:   45 SYGGRWKYLTFINLVMHAVFFGLCVLVDAVHSAVSVNQSRSGTPLNLSRARDFYFTVLAFPVGTFVFVSFWTLYTYDRELVYPKLLDEIIPIWLNHAMHTVIMPLLLLQMFLQNHRYPSRTAGIFSLAVFVALYLSWVLWVHHASGIWVYPIMAHLSPVGLCVFLGGASLSMAPLYLLGE 224          
BLAST of Androgen-induced protein vs. Ensembl Zebrafish
Match: CR792417.1 (androgen-dependent TFPI-regulating protein-like [Source:NCBI gene;Acc:100537455])

HSP 1 Score: 53.1434 bits (126), Expect = 2.487e-8
Identity = 36/125 (28.80%), Postives = 70/125 (56.00%), Query Frame = 2
Query:  248 NTLFSV-IFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILS-DNMRYFFYIVCFILMITF 616
            + LFSV +FP+ +FV ++FW ++  +R  V   S   + P W+  + HT VL I+  ++++ P ++PK K GL+ +  + + Y+ W+  ++     W YP L + S   +  FF++   ++ + F
Sbjct:   29 DLLFSVFVFPVGMFVVLLFWLIFAYDRQLVYPASIDNFFPPWLNHAMHTVVLPILFGEILLEPHVFPKTKNGLAALGVVGLAYLGWVIWVYCTVGIWVYPLLGLFSHSGLAIFFFLNMLVVSLLF 153          
BLAST of Androgen-induced protein vs. Ensembl Xenopus
Match: ENSXETT00000040250.1 (androgen-induced gene 1 protein-like [Source:NCBI gene;Acc:100495442])

HSP 1 Score: 81.6481 bits (200), Expect = 5.616e-18
Identity = 59/196 (30.10%), Postives = 94/196 (47.96%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFL---------LMIGNYIKTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEFFVYLR----TKPNRRLTNK 679
            +G ++K+LT IN  LQT++F          L++    K  S    +   T   + FP+ +FV   FW +Y  +R+ V  K     +P W+    HT VL +++ +L      YP RK G+SI+ A S+ Y+ W+  IH+ +  W YP L  L       F+    ++ + FYC+ E   + R     KP R+   K
Sbjct:   37 YGGRWKYLTFINQVLQTVFFAICVLSDLAPLVLPKKKKLSSFLLQLRDGTFAVLAFPIGVFVVASFWGIYAYDRELVYPKVLDSIIPQWLNHCMHTVVLPLLLVELYACSHRYPSRKWGISIMAAFSLLYMAWVLWIHHVSGIWVYPLLAKLDAVGLAVFFAGAMLVTVPFYCLGELLTWFRWGTPRKPPRKRKAK 232          
BLAST of Androgen-induced protein vs. Ensembl Xenopus
Match: tctex1d1 (Tctex1 domain containing 1 [Source:Xenbase;Acc:XB-GENE-5960232])

HSP 1 Score: 81.6481 bits (200), Expect = 6.168e-18
Identity = 57/181 (31.49%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYF----------LLMIG--NYIKTRSIKRSIILNT--LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F          LL  G  N  + R +K+ I L    +  + FP+ +FV  MFW LY  +R+ V  K    ++P W+    HT VL  I+ ++      YP R  G+  +   S+CYI+W+  +H+ T  W YP LE +S   +  F+I+  +++  FY + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGICVLSDLSSLLTKGSDNQEQERQLKKLISLRDWVMAVLAFPVGVFVVTMFWILYIYDRELVYPKLLDNFIPPWLNHGMHTTVLPFILIEMRTTHHQYPSRTCGIVTVCLFSICYILWVCWVHHMTGMWVYPLLEYISPGAKIVFFIIVTVVINMFYILGE 215          
BLAST of Androgen-induced protein vs. Ensembl Xenopus
Match: ENSXETT00000040240.1 (androgen-induced gene 1 protein-like [Source:NCBI gene;Acc:100495442])

HSP 1 Score: 77.7962 bits (190), Expect = 1.306e-16
Identity = 55/183 (30.05%), Postives = 89/183 (48.63%), Query Frame = 2
Query:  128 KFGSKFKHLTSINLCLQTLYFL---------LMIGNYIKTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEFFVYLR 649
             +G ++K+LT IN  LQT++F          L++    K  S    +   T   + FP+ +FV   FW +Y  +R+ V  K     +P W+    HT VL +++ +L      YP RK G+SI+ A S+ Y+ W+  IH+ +  W YP L  L       F+    ++ + FYC+ E   + R
Sbjct:   36 SYGGRWKYLTFINQVLQTVFFAICVLSDLAPLVLPKKKKLSSFLLQLRDGTFAVLAFPIGVFVVASFWGIYAYDRELVYPKVLDSIIPQWLNHCMHTVVLPLLLVELYACSHRYPSRKWGISIMAAFSLLYMAWVLWIHHVSGIWVYPLLAKLDAVGLAVFFAGAMLVTVPFYCLGELLTWFR 218          
BLAST of Androgen-induced protein vs. Ensembl Xenopus
Match: blnk (B cell linker [Source:Xenbase;Acc:XB-GENE-946366])

HSP 1 Score: 60.4622 bits (145), Expect = 2.501e-10
Identity = 51/152 (33.55%), Postives = 84/152 (55.26%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYF-------LLMIGNYIKTRSIKRSIILNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILS 562
            +G  +K+LT +N+ LQT ++       LLM    +K  +   S   + +FSV+ FP + FV + FW+LY  +R  V      K +P W+  + HT V  + + +++ +P  YP +K GL ++   SVCY+ W+  I++    W YPFL +LS
Sbjct:   39 YGGLWKYLTILNVVLQTGFYAICFVADLLMSVPGVKLVNYIVSC-RDLVFSVLAFPASTFVFLAFWALYSYDRQLVYPDGLDKIIPLWLNHAVHTAVFPLAVLEMVTSPHRYPPKKKGLLLLGLCSVCYLSWVLWIYFADGKWVYPFLGLLS 189          
BLAST of Androgen-induced protein vs. Ensembl Mouse
Match: Aig1 (androgen-induced 1 [Source:MGI Symbol;Acc:MGI:1913503])

HSP 1 Score: 83.9593 bits (206), Expect = 7.370e-19
Identity = 57/181 (31.49%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMI------------GNYIKTRSIKRSIILN--TLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F + +            GN  + R +++ I L   TL  + FP+ +FV  +FW++Y  +R+ +  +    ++P W+    HT VL  I+ ++  +   YP R  GL+ I   SV YI+W+  IH+ T  W YPFLE +    R  F+    ILM   Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVTGMWVYPFLEHIGSGARIIFFGSTTILMNFLYLLGE 215          
BLAST of Androgen-induced protein vs. Ensembl Mouse
Match: Aig1 (androgen-induced 1 [Source:MGI Symbol;Acc:MGI:1913503])

HSP 1 Score: 83.5741 bits (205), Expect = 1.581e-18
Identity = 57/181 (31.49%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMI------------GNYIKTRSIKRSIILN--TLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F + +            GN  + R +++ I L   TL  + FP+ +FV  +FW++Y  +R+ +  +    ++P W+    HT VL  I+ ++  +   YP R  GL+ I   SV YI+W+  IH+ T  W YPFLE +    R  F+    ILM   Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVTGMWVYPFLEHIGSGARIIFFGSTTILMNFLYLLGE 215          
BLAST of Androgen-induced protein vs. Ensembl Mouse
Match: Adtrp (androgen dependent TFPI regulating protein [Source:MGI Symbol;Acc:MGI:1924596])

HSP 1 Score: 63.1586 bits (152), Expect = 1.694e-11
Identity = 54/178 (30.34%), Postives = 92/178 (51.69%), Query Frame = 2
Query:  119 NEIKFGSKFKHLTSINLCLQTLYFLLMIGNYIKTRSIKRSII------LNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             E   G + K+LT +NL LQ ++F +   + +  R I R  I       + LF+ + FP++ FV ++FW+L+  +R  V  K    + P W+  + HT +    +++ I+ P  YP +K+GL+++ A +  YII I   + +T NW YP  + LS      F+   +IL+   Y   E
Sbjct:   35 REFHDGGRSKYLTLLNLLLQAIFFGVACLDDVLKRVIGRKDIKFVTSFRDLLFTTMAFPISTFVFLVFWTLFHYDRSLVYPKGLDDFFPAWVNHAMHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNFAYIIRILWRYVQTGNWVYPVFDSLSPLGIIIFFSAAYILVAGIYLFGE 212          
BLAST of Androgen-induced protein vs. Ensembl Mouse
Match: Adtrp (androgen dependent TFPI regulating protein [Source:MGI Symbol;Acc:MGI:1924596])

HSP 1 Score: 63.1586 bits (152), Expect = 1.694e-11
Identity = 54/178 (30.34%), Postives = 92/178 (51.69%), Query Frame = 2
Query:  119 NEIKFGSKFKHLTSINLCLQTLYFLLMIGNYIKTRSIKRSII------LNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             E   G + K+LT +NL LQ ++F +   + +  R I R  I       + LF+ + FP++ FV ++FW+L+  +R  V  K    + P W+  + HT +    +++ I+ P  YP +K+GL+++ A +  YII I   + +T NW YP  + LS      F+   +IL+   Y   E
Sbjct:   35 REFHDGGRSKYLTLLNLLLQAIFFGVACLDDVLKRVIGRKDIKFVTSFRDLLFTTMAFPISTFVFLVFWTLFHYDRSLVYPKGLDDFFPAWVNHAMHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNFAYIIRILWRYVQTGNWVYPVFDSLSPLGIIIFFSAAYILVAGIYLFGE 212          
BLAST of Androgen-induced protein vs. Ensembl Mouse
Match: Adtrp (androgen dependent TFPI regulating protein [Source:MGI Symbol;Acc:MGI:1924596])

HSP 1 Score: 62.7734 bits (151), Expect = 3.220e-11
Identity = 54/178 (30.34%), Postives = 92/178 (51.69%), Query Frame = 2
Query:  119 NEIKFGSKFKHLTSINLCLQTLYFLLMIGNYIKTRSIKRSII------LNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             E   G + K+LT +NL LQ ++F +   + +  R I R  I       + LF+ + FP++ FV ++FW+L+  +R  V  K    + P W+  + HT +    +++ I+ P  YP +K+GL+++ A +  YII I   + +T NW YP  + LS      F+   +IL+   Y   E
Sbjct:   67 REFHDGGRSKYLTLLNLLLQAIFFGVACLDDVLKRVIGRKDIKFVTSFRDLLFTTMAFPISTFVFLVFWTLFHYDRSLVYPKGLDDFFPAWVNHAMHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNFAYIIRILWRYVQTGNWVYPVFDSLSPLGIIIFFSAAYILVAGIYLFGE 244          
BLAST of Androgen-induced protein vs. UniProt/SwissProt
Match: sp|Q9D8B1|AIG1_MOUSE (Androgen-induced gene 1 protein OS=Mus musculus OX=10090 GN=Aig1 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.106e-17
Identity = 57/181 (31.49%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMI------------GNYIKTRSIKRSIILN--TLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F + +            GN  + R +++ I L   TL  + FP+ +FV  +FW++Y  +R+ +  +    ++P W+    HT VL  I+ ++  +   YP R  GL+ I   SV YI+W+  IH+ T  W YPFLE +    R  F+    ILM   Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVTGMWVYPFLEHIGSGARIIFFGSTTILMNFLYLLGE 215          
BLAST of Androgen-induced protein vs. UniProt/SwissProt
Match: sp|Q9NVV5|AIG1_HUMAN (Androgen-induced gene 1 protein OS=Homo sapiens OX=9606 GN=AIG1 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 4.883e-17
Identity = 57/181 (31.49%), Postives = 91/181 (50.28%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMI------------GNYIKTRSIKRSIILNT--LFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F + +            GN  + R +K+ I L    L  + FP+ +FV  +FW +Y  +R+ +  K    ++P W+    HT VL  I+ ++  +   YP R  GL+ I   SV YI+W+  +H+ T  W YPFLE +    R  F+    ILM   Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGE 215          
BLAST of Androgen-induced protein vs. UniProt/SwissProt
Match: sp|Q96IZ2|ADTRP_HUMAN (Androgen-dependent TFPI-regulating protein OS=Homo sapiens OX=9606 GN=ADTRP PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.703e-14
Identity = 52/184 (28.26%), Postives = 100/184 (54.35%), Query Frame = 2
Query:  116 KNEIKF-----GSKFKHLTSINLCLQTLYFLLM-IGNYIKTRSIKRSIILNTLF------SVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            K+E+K      G+++K++T +NL LQT+++ +  + + +K     + I   T F      ++ FP++ FV + FW L+  NRD +  K     +P W+  + HTF+  I + ++++ P  YP +K GL+++ A S+ YI  I  ++++T  W YP    LS      F+ + ++ + + Y + E
Sbjct:   29 KDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGE 212          
BLAST of Androgen-induced protein vs. UniProt/SwissProt
Match: sp|Q60534|ADTRP_MESAU (Androgen-dependent TFPI-regulating protein OS=Mesocricetus auratus OX=10036 GN=ADTRP PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.098e-13
Identity = 55/178 (30.90%), Postives = 100/178 (56.18%), Query Frame = 2
Query:  119 NEIKFGSKFKHLTSINLCLQTLYFLLMIGNYIKTRSIKRSII------LNTLFS-VIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             E   G + K+LT +NL LQ ++F +   + +  R I R  I       + LFS ++FP++ F+ ++FW+L++ +R  +  K    Y P W+  + HT++LL ++ + I+ P  YP +K+GL+++ A ++ YI  +   + +T NW YP    L+      F++VC+IL  + Y + E
Sbjct:   35 KEFHDGGRSKYLTLLNLLLQAIFFGVACLDDVLKRIIGRKDIKFITSTRDLLFSTLVFPISTFIFLVFWTLFYYDRSLIYPKGLDDYFPAWLNHAMHTYILLFVLVETILRPHHYPSKKLGLALLGACNLAYITRVLWRYSQTGNWVYPVFASLNPLGIIIFFLVCYILNASIYLVGE 212          
BLAST of Androgen-induced protein vs. UniProt/SwissProt
Match: sp|Q5M828|ADTRP_RAT (Androgen-dependent TFPI-regulating protein OS=Rattus norvegicus OX=10116 GN=Adtrp PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.432e-11
Identity = 56/178 (31.46%), Postives = 90/178 (50.56%), Query Frame = 2
Query:  119 NEIKFGSKFKHLTSINLCLQTLYFLLMIGNYIKTRSIKRSII------LNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             E   G + K+LT +NL LQ ++F +   + +  R I R  I       + LF+ + FPL+ FV ++FWSL+  +R  V  K    + P W+  + HT +    + + ++ P  YP +K+GLS++ A +  YII I   + +T NW YP    LS      F+   +IL  + Y   E
Sbjct:   35 KEFHDGGRSKYLTLLNLLLQAVFFGVACLDDVLKRVIGRKDIKFITYFRDLLFTTLAFPLSTFVFLVFWSLFHYDRSLVYPKGLDDFFPAWVNHAMHTSIFPFSLAETVLRPHNYPSKKLGLSLLGACNFAYIIRILWRYVQTGNWVYPVFASLSPLGIILFFSASYILSASLYLFGE 212          
BLAST of Androgen-induced protein vs. TrEMBL
Match: H9JH85 (Uncharacterized protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.840e-31
Identity = 71/177 (40.11%), Postives = 110/177 (62.15%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLL-----MIGNYIKTRSIKRSI--ILNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEFF 637
            +  K K+LT +N  +QTLYF L     + GN   T S K  I  I + LFS + FPL++FV I FW +Y I+R+ +L +S   Y P W+    HT ++  I+ DL+ +  +YP++K+GLS++    +CY++WIH+I++KT +W YP L IL+  +R  FY+VC  L+ + Y + E F
Sbjct:  789 YAGKMKYLTHLNAIMQTLYFTLALLNDLFGNNEPTPSEKPLIRRIKDILFSALAFPLSMFVGITFWGIYAIDRELILPRSLDPYFPTWLNHVMHTNIMAFILIDLLTSFRMYPRKKIGLSVLCTYMLCYMVWIHVIYFKTGSWVYPILNILNWPLRVVFYLVCLGLVCSLYSLGEKF 965          
BLAST of Androgen-induced protein vs. TrEMBL
Match: A0A2H1V657 (SFRICE_000311 OS=Spodoptera frugiperda OX=7108 GN=SFRICE_000311 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 5.865e-26
Identity = 64/176 (36.36%), Postives = 107/176 (60.80%), Query Frame = 2
Query:  128 KFGSKFKHLTSINLCLQTLYFLL-----MIGNYIKTRSIKRSI--ILNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             +G KFK+LT ++  +QT YF L     ++GN   + S K  I  + + +FS + FPL +FV + FW++Y I+R+ +L +S   Y P W+    HT +++ I+ +L+ +  +YPKRK GL+I++   +CY+IW+H+I++ T  W YP L +L+  +R  FY+ C       YC+ E
Sbjct:   69 PYGGKFKYLTYLDAMIQTAYFTLAFLNDIVGNNEPSPSEKPLIRRLKDRVFSALAFPLAIFVGVSFWAIYAIDRELILPRSMDAYFPLWLNHVMHTNIVVFILIELLTSFRMYPKRKAGLTILSTFMICYLIWVHVIYFNTGIWVYPILSVLNWPLRVGFYLFCLAFACGAYCLGE 244          
BLAST of Androgen-induced protein vs. TrEMBL
Match: A0A2A4JX63 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_9666 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.412e-25
Identity = 63/182 (34.62%), Postives = 105/182 (57.69%), Query Frame = 2
Query:  110 PVKNEIKFGSKFKHLTSINLCLQTLYFLLMIGNYI--------KTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            P+     +G KFK+LT ++  +QT YF L + N I          + + R I      S+ FPL LFV + FWS+Y ++R+ +L +S  ++ P W+    H+ +++ I+ +L+ +  +YPKRKVGLSI++   +CY++W+H+I+Y T  W YP L +L+  +R  FY+ C       Y + E
Sbjct:   28 PLSTVTPYGGKFKYLTYLDAMIQTTYFTLALLNDIFGTNEPSPSQKPLIRRIKDTVFSSLAFPLALFVGVSFWSIYAVDRELILPRSMDEFFPTWLNHVMHSNIVVFIVIELLTSFRMYPKRKVGLSILSFFMICYLVWVHVIYYNTGFWVYPILHVLNWPLRVGFYLFCLSFACGGYILGE 209          
BLAST of Androgen-induced protein vs. TrEMBL
Match: A0A212EQ70 (Uncharacterized protein OS=Danaus plexippus plexippus OX=278856 GN=KGM_207387 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 4.203e-25
Identity = 66/176 (37.50%), Postives = 107/176 (60.80%), Query Frame = 2
Query:  128 KFGSKFKHLTSINLCLQTLYFLL-----MIGNYIKTRSIKRSI--ILNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             FG KFK+LT +N  LQT+YF +     +IG    T S K  +  I +TLFS + FPL +FV I FW++Y ++R+ +L K+   + P W+    H+ ++L  I ++  +  +YP R+ GLSI++A  + Y+IW+H+I++KT +W YP L +L+  +R  FY+    L+   Y + E
Sbjct:   36 PFGGKFKYLTYLNAMLQTVYFTVALINDIIGTNESTPSNKPLVRRIKDTLFSALAFPLAMFVGISFWAIYAVDRELILPKAMDAFFPTWLNHVMHSNIVLFTIIEITTSFRMYPGRQFGLSILSAFMLGYVIWVHVIYFKTGSWVYPILNVLNWPLRIIFYLFSLGLVCGLYTLGE 211          
BLAST of Androgen-induced protein vs. TrEMBL
Match: S4PDG5 (Androgen-induced gene 1 protein OS=Pararge aegeria OX=116150 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.243e-24
Identity = 64/175 (36.57%), Postives = 103/175 (58.86%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMIGNYI----KTRSIKRSIILNT---LFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            FG KFK+LT +N  LQT+YF + + N +    ++    + ++  T   LFS + FPL +FV + FW +Y ++R+ +L K    Y P W+    H+ +++  I +L  +  +YPKRK GLSI+T   + Y+IWIH I++KT +W YP L +L+  +R FFY+     +   Y + E
Sbjct:   37 FGGKFKYLTYLNAMLQTVYFTVAVINDLAGTNESSPSNKPLVRRTKDVLFSALAFPLAMFVGVTFWGIYAVDRELILPKMMDAYFPTWLNHVMHSNIVVFTIVELATSFRMYPKRKFGLSILTTFMLFYVIWIHFIYFKTGSWVYPILSVLNWPLRIFFYLFSLGFVCGLYTLGE 211          
BLAST of Androgen-induced protein vs. Ensembl Cavefish
Match: aig1 (androgen induced 1 [Source:NCBI gene;Acc:103021827])

HSP 1 Score: 71.2478 bits (173), Expect = 2.300e-14
Identity = 55/181 (30.39%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYF----------LLMIG--NYIKTRSIKRSIILNTLFSVI--FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q ++F          LL  G  +  + R +++ I L      +  FP+ +FV  MFW+LY  +RD V  +    ++P W+    HT VL  II ++      YP R  GL  + + +V Y++W+  +H  T  W YP LE +    R  F+I    L+  +Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQAVFFGVCVLTDLSSLLTKGTASVEQERQLRKLIGLRDWMMAVLAFPVGVFVVTMFWTLYLYDRDLVYPRLLDNFIPQWLNHGMHTTVLPFIIIEMRTTHHQYPSRLCGLLAVCSFAVGYVLWMCWVHNVTGVWVYPLLEHIGPMARALFFISLTGLISLYYILGE 215          
BLAST of Androgen-induced protein vs. Ensembl Cavefish
Match: ENSAMXT00000042712.1 (androgen-dependent TFPI-regulating protein-like [Source:NCBI gene;Acc:103027058])

HSP 1 Score: 66.6254 bits (161), Expect = 8.920e-13
Identity = 51/181 (28.18%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  107 CPVKNEIKFGSKFKHLTSINLCLQTLYFLLMIGNYIKTRSIKRSIIL-----NTLFSV-IFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
             P      +G  +K+LT INL +Q ++F L     ++T   +  + L     + LFSV  FPL L V ++FW ++  +R  V  +S   + P W   + HT VL I++ ++++ P +YPK + GL+ +      Y  W+  ++     W YP L + S      F+I    ++I  Y + +
Sbjct:   31 APPDGIFPYGGPWKYLTFINLIVQMVFFGLASVRDLRTLGKRSRVTLLSQTKDLLFSVFAFPLGLLVVLLFWVIFSYDRQLVYPESMDNFFPTWANHAMHTLVLPIVLGEVLLEPHVYPKTRNGLAALGVAGFLYSGWVIWVYVSVGIWVYPLLGLFSTTGLVAFFISNIFVVILLYLLGQ 211          
BLAST of Androgen-induced protein vs. Ensembl Cavefish
Match: adtrp1 (androgen dependent TFPI regulating protein 1 [Source:ZFIN;Acc:ZDB-GENE-050417-220])

HSP 1 Score: 48.1358 bits (113), Expect = 3.420e-6
Identity = 29/101 (28.71%), Postives = 57/101 (56.44%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLL-----MIGNYIKTRSIKRSIIL------NTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFV 397
            +G ++K+LT +NL +QT++F       ++   + +++ +  + L      +  F+V+ FP+  FV I FW+LY I+R+ V  K   + +P W+  + HT +
Sbjct:   43 YGGRWKYLTFLNLVMQTVFFGFCLFTDLVLAVLPSKNTRSGVPLFLIKVRDGFFTVLAFPVGTFVFISFWALYTIDRELVYPKYLDELIPIWLNHAMHTVI 143          
BLAST of Androgen-induced protein vs. Ensembl Sea Lamprey
Match: aig1 (androgen-induced 1 (H. sapiens) [Source:ZFIN;Acc:ZDB-GENE-041014-358])

HSP 1 Score: 53.5286 bits (127), Expect = 7.292e-9
Identity = 44/164 (26.83%), Postives = 81/164 (49.39%), Query Frame = 2
Query:  113 VKNEIKFGSKFKHLTSINLCLQTLYFLLMI-------------GNYIKTRSIKRSIILNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILS 562
            +  +  +G  +K LT IN+ +QT +F + +             G  +  +  K + + + +F+V+ FP+  FV I FW++Y  +R+ V  +    ++P W+    H+ VLL ++ ++++ P  YP R +GL      SV YI W+  +        YP L  L+
Sbjct:   29 IPAQQTYGGSWKFLTYINVVIQTCFFAVAVLGDASKFLHQGGSGLAMDQQLTKLTRLRDRIFTVLAFPIGTFVVIAFWAMYSWDREMVHPEVLDSFIPAWLHHGMHSTVLLFLLLEILMTPHRYPSRAMGLLGTVLFSVAYIGWVLWVQQAAGISVYPLLARLA 192          
BLAST of Androgen-induced protein vs. Ensembl Nematostella
Match: EDO46372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQI6])

HSP 1 Score: 78.1814 bits (191), Expect = 1.626e-17
Identity = 49/169 (28.99%), Postives = 92/169 (54.44%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLM-IGNYI----KTRSIKRSIILNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFY 619
            +G ++K+LT +++  +  +FLL  +G+ I      +S   + I + LF+ + FP  +FVS  FW +Y ++R+ +   +    +P WI    HT+  ++I+ +  +    YP  + G+      + CY++WI  I    N W YPFL ++ ++ R  F+ +C I++I FY
Sbjct:   18 YGGRWKYLTFLSIVAEVAFFLLAALGDVISFLIGRQSTTITSIRDHLFTTLAFPFAVFVSATFWGIYAVDRELIFPTALDAIIPPWINHGLHTWNAVLILLEGAVVHHKYPVNRAGIFFTLLPAACYLVWITYIAQTQNFWVYPFLRMMENSGRAAFFGLCAIILIIFY 186          
BLAST of Androgen-induced protein vs. Ensembl Nematostella
Match: EDO44848 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUF7])

HSP 1 Score: 69.3218 bits (168), Expect = 3.988e-14
Identity = 56/174 (32.18%), Postives = 84/174 (48.28%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMIGNYI------KTRSIKRSIILNTLF-SVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            FG +FK LT IN+ LQ  YF+ +    I      K R+ K S     LF S+ FP+ L VS++FW LY I+         S  +P W+    HT   L +  ++I+   IYP++ +G+  +      Y+ W+  I Y  + W YPFLE +       F+     L++  Y I E
Sbjct:   38 FGGRFKFLTFINMILQGTYFIWVAALEIQAMIDGKRRNTKSSHSCEFLFASLAFPIGLTVSVLFWGLYLIDPLSCQSPEASGLIPKWLNHYMHTLPALEVFAEVILFKHIYPRKIIGMVTVLGFGTAYMAWVFYIAYFHHFWVYPFLERMDIMTIGVFFAASGALLVVNYVIGE 211          
BLAST of Androgen-induced protein vs. Ensembl Nematostella
Match: EDO36990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH55])

HSP 1 Score: 55.4546 bits (132), Expect = 2.162e-9
Identity = 45/173 (26.01%), Postives = 83/173 (47.98%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLLMIGNYIKTRSIKR-----SIILNTLFSV-IFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            FG +F+ LT IN+  Q L+F ++     +  + KR     + + + L++   FPL + V+ +FW L  I+   +  K   + +P W+    H+F  L +I +  +    YP R  GL  +  +++ Y  W+ +I      W YPF+  L+      F+   ++L+   Y + E
Sbjct:   11 FGGRFRFLTFINMVWQWLFFTILAVLEFQALTKKRKHELVASLCDFLYAGWTFPLGITVAALFWGLCIIDPHAIQSKEDLEQIPLWLNHYMHSFPGLSVILETFLFKHEYPTRSNGLKAVFGLTLGYTAWMVVIFCMGGIWVYPFMRKLNILQLVLFFTGAYLLVAVVYFLGE 183          
BLAST of Androgen-induced protein vs. Ensembl Medaka
Match: aig1 (androgen induced 1 [Source:NCBI gene;Acc:101169761])

HSP 1 Score: 66.2402 bits (160), Expect = 1.472e-12
Identity = 53/181 (29.28%), Postives = 87/181 (48.07%), Query Frame = 2
Query:  131 FGSKFKHLTSINLCLQTLYFLL--------MIGNYIKTRSIKRS-----IILNTLFSVI-FPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICE 631
            +G  +K LT I+L +Q  +F L        ++ N   +R  +R       + + + +V+ FP+  FV   FW+LY  +R+ V  K    ++P W+    HT VL  +I ++      YP+R  GL  +   S+ YI W   +H+ T  W YP LE +S   R  F+    +L+   Y + E
Sbjct:   35 YGGSWKFLTFIDLVIQATFFGLCVLIDVSSLLTNGGDSREQERQHRKLIGLRDWIMAVLAFPVGAFVVFTFWTLYLYDRELVYPKLLDNFIPQWLNHGMHTTVLPFVIIEMRTTHHKYPRRLWGLVAVCVFSMAYISWTCWVHHVTGVWVYPVLERVSSIARAAFFGTMTLLIFILYVLGE 215          
BLAST of Androgen-induced protein vs. Ensembl Medaka
Match: ENSORLT00000016953.2 (androgen-dependent TFPI-regulating protein-like [Source:NCBI gene;Acc:111948766])

HSP 1 Score: 56.6102 bits (135), Expect = 4.570e-9
Identity = 48/156 (30.77%), Postives = 83/156 (53.21%), Query Frame = 2
Query:  131 FGSKFKHLTSINL-CLQTLYF--LLMIGNYIKTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSD-NMRYFFY 586
            +G  +K+LT +NL  L    F   L  G   ++   K +  L ++F   FP+ +FV ++FW+++  +R+ V   S   + P WI  + HTFVL I + +L++ P  YP++K  L+ +T + + Y+ WI  ++     W YP L   S   +  FF+
Sbjct:   43 YGGPWKYLTFLNLVSLSAALFSSCLFPGKQTESPLKKCNDFLFSVFG--FPVGMFVVLLFWTIFAYDRELVYPASIDSFFPPWINHAMHTFVLPISLGELLVQPHTYPQQKHALAALTLVGLAYLSWILWVYVSVGVWVYPLLGHFSPAGLAAFFF 196          
BLAST of Androgen-induced protein vs. Planmine SMEST
Match: SMESG000010995.1 (SMESG000010995.1)

HSP 1 Score: 52.373 bits (124), Expect = 6.019e-8
Identity = 51/166 (30.72%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  146 KHLTSINLCLQTLYFLLMI-GNYIKTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEFFV 640
            K+LT INL + TLYF L I   ++  + I+   + +++ SV   L  FV++ FW LY+ NR+ V  KS  K +P W   + H F ++ I  + IIN P     K+ L +I  + + Y+  I       N + YP  ++L +  RY F     +  +  + + ++FV
Sbjct:   37 KYLTIINLYILTLYFGLSIFAVFLHNKCIQS--VRSSVLSVTMALGWFVTLTFWGLYFYNRELVYPKSVDKLIPKWWNNAAHLFNVVAITSEAIINKPKTRTTKLSLYLILILIIGYVTLIEYHIRMKNFYVYPIFKMLPELYRYLFNAGLIVAFVGIHYVSDYFV 200          
BLAST of Androgen-induced protein vs. Planmine SMEST
Match: SMESG000010995.1 (SMESG000010995.1)

HSP 1 Score: 52.373 bits (124), Expect = 6.268e-8
Identity = 51/166 (30.72%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  146 KHLTSINLCLQTLYFLLMI-GNYIKTRSIKRSIILNTLFSVIFPLTLFVSIMFWSLYWINRDFVLMKSHSKYVPFWITISNHTFVXXXXXXXXXXXXXXXXKRKVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFILMITFYCICEFFV 640
            K+LT INL + TLYF L I   ++  + I+   + +++ SV   L  FV++ FW LY+ NR+ V  KS  K +P W   + H F ++ I  + IIN P     K+ L +I  + + Y+  I       N + YP  ++L +  RY F     +  +  + + ++FV
Sbjct:   45 KYLTIINLYILTLYFGLSIFAVFLHNKCIQS--VRSSVLSVTMALGWFVTLTFWGLYFYNRELVYPKSVDKLIPKWWNNAAHLFNVVAITSEAIINKPKTRTTKLSLYLILILIIGYVTLIEYHIRMKNFYVYPIFKMLPELYRYLFNAGLIVAFVGIHYVSDYFV 208          
The following BLAST results are available for this feature:
BLAST of Androgen-induced protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AIG17.847e-1831.49androgen induced 1 [Source:HGNC Symbol;Acc:HGNC:21... [more]
AIG18.018e-1831.49androgen induced 1 [Source:HGNC Symbol;Acc:HGNC:21... [more]
AIG11.017e-1731.49androgen induced 1 [Source:HGNC Symbol;Acc:HGNC:21... [more]
AIG12.823e-1631.48androgen induced 1 [Source:HGNC Symbol;Acc:HGNC:21... [more]
ADTRP3.547e-1528.26androgen dependent TFPI regulating protein [Source... [more]
back to top
BLAST of Androgen-induced protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Androgen-induced protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG36251.972e-1829.67gene:FBgn0031245 transcript:FBtr0078135[more]
CG36251.889e-1729.14gene:FBgn0031245 transcript:FBtr0078136[more]
CG116015.956e-1528.79gene:FBgn0031244 transcript:FBtr0078137[more]
CG116015.956e-1528.79gene:FBgn0031244 transcript:FBtr0343780[more]
CG116015.956e-1528.79gene:FBgn0031244 transcript:FBtr0343779[more]
back to top
BLAST of Androgen-induced protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
aig19.970e-1629.83androgen-induced 1 (H. sapiens) [Source:ZFIN;Acc:Z... [more]
aig16.691e-1229.28androgen-induced 1 (H. sapiens) [Source:ZFIN;Acc:Z... [more]
adtrp14.238e-924.44androgen dependent TFPI regulating protein 1 [Sour... [more]
CR792417.12.487e-828.80androgen-dependent TFPI-regulating protein-like [S... [more]
back to top
BLAST of Androgen-induced protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000040250.15.616e-1830.10androgen-induced gene 1 protein-like [Source:NCBI ... [more]
tctex1d16.168e-1831.49Tctex1 domain containing 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000040240.11.306e-1630.05androgen-induced gene 1 protein-like [Source:NCBI ... [more]
blnk2.501e-1033.55B cell linker [Source:Xenbase;Acc:XB-GENE-946366][more]
back to top
BLAST of Androgen-induced protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aig17.370e-1931.49androgen-induced 1 [Source:MGI Symbol;Acc:MGI:1913... [more]
Aig11.581e-1831.49androgen-induced 1 [Source:MGI Symbol;Acc:MGI:1913... [more]
Adtrp1.694e-1130.34androgen dependent TFPI regulating protein [Source... [more]
Adtrp1.694e-1130.34androgen dependent TFPI regulating protein [Source... [more]
Adtrp3.220e-1130.34androgen dependent TFPI regulating protein [Source... [more]
back to top
BLAST of Androgen-induced protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D8B1|AIG1_MOUSE1.106e-1731.49Androgen-induced gene 1 protein OS=Mus musculus OX... [more]
sp|Q9NVV5|AIG1_HUMAN4.883e-1731.49Androgen-induced gene 1 protein OS=Homo sapiens OX... [more]
sp|Q96IZ2|ADTRP_HUMAN1.703e-1428.26Androgen-dependent TFPI-regulating protein OS=Homo... [more]
sp|Q60534|ADTRP_MESAU2.098e-1330.90Androgen-dependent TFPI-regulating protein OS=Meso... [more]
sp|Q5M828|ADTRP_RAT1.432e-1131.46Androgen-dependent TFPI-regulating protein OS=Ratt... [more]
back to top
BLAST of Androgen-induced protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9JH857.840e-3140.11Uncharacterized protein OS=Bombyx mori OX=7091 PE=... [more]
A0A2H1V6575.865e-2636.36SFRICE_000311 OS=Spodoptera frugiperda OX=7108 GN=... [more]
A0A2A4JX631.412e-2534.62Uncharacterized protein OS=Heliothis virescens OX=... [more]
A0A212EQ704.203e-2537.50Uncharacterized protein OS=Danaus plexippus plexip... [more]
S4PDG52.243e-2436.57Androgen-induced gene 1 protein OS=Pararge aegeria... [more]
back to top
BLAST of Androgen-induced protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
aig12.300e-1430.39androgen induced 1 [Source:NCBI gene;Acc:103021827... [more]
ENSAMXT00000042712.18.920e-1328.18androgen-dependent TFPI-regulating protein-like [S... [more]
adtrp13.420e-628.71androgen dependent TFPI regulating protein 1 [Sour... [more]
back to top
BLAST of Androgen-induced protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aig17.292e-926.83androgen-induced 1 (H. sapiens) [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Androgen-induced protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Androgen-induced protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO463721.626e-1728.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448483.988e-1432.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369902.162e-926.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Androgen-induced protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aig11.472e-1229.28androgen induced 1 [Source:NCBI gene;Acc:101169761... [more]
ENSORLT00000016953.24.570e-930.77androgen-dependent TFPI-regulating protein-like [S... [more]
back to top
BLAST of Androgen-induced protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000010995.16.019e-830.72SMESG000010995.1[more]
SMESG000010995.16.268e-830.72SMESG000010995.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022644 ID=SMED30022644|Name=Androgen-induced protein|organism=Schmidtea mediterranea sexual|type=transcript|length=785bp
TCATCTCCTAGTATCTTTATTTGAAATGAATTACAAAACAATTTTTACAT
CATATATTTTAATTCTATTTTGGTATACTTTTACATTTACTTATGGATTT
TATGTTTGTCCAGTGAAAAATGAAATTAAGTTCGGCTCAAAATTTAAACA
TTTGACTTCAATAAATCTCTGCTTGCAAACTTTATATTTTCTTTTGATGA
TTGGAAATTATATAAAAACGAGATCTATCAAAAGGAGTATCATCCTAAAT
ACGTTATTTTCAGTTATATTTCCATTGACATTATTTGTTTCGATCATGTT
CTGGTCGTTATATTGGATAAATCGGGATTTCGTTTTGATGAAATCCCATA
GCAAATACGTTCCGTTCTGGATCACGATATCAAATCACACGTTTGTTTTA
TTGATTATAATCTATGATTTGATAATCAACCCCCCGATCTATCCCAAAAG
AAAAGTAGGGCTGTCAATAATTACAGCGATCTCTGTTTGTTACATAATCT
GGATCCACCTGATTCATTACAAAACCAATAATTGGGCTTATCCATTTCTG
GAAATTCTCTCTGATAATATGAGATATTTCTTTTATATCGTTTGCTTTAT
TCTGATGATTACTTTCTATTGCATTTGTGAATTTTTCGTATATTTAAGGA
CCAAACCAAACCGGAGACTCACAAATAAATATTATCAACTCATGTAGAGC
TTTATCAAAATTATTATTAACTGAGATTTGATTTCCATCGAATCTATCTG
CTTGTAAATTTATTACCAAAATGCCAGATTTGTCG
back to top

protein sequence of SMED30022644-orf-1

>SMED30022644-orf-1 ID=SMED30022644-orf-1|Name=SMED30022644-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=232bp
HLLVSLFEMNYKTIFTSYILILFWYTFTFTYGFYVCPVKNEIKFGSKFKH
LTSINLCLQTLYFLLMIGNYIKTRSIKRSIILNTLFSVIFPLTLFVSIMF
WSLYWINRDFVLMKSHSKYVPFWITISNHTFVLLIIIYDLIINPPIYPKR
KVGLSIITAISVCYIIWIHLIHYKTNNWAYPFLEILSDNMRYFFYIVCFI
LMITFYCICEFFVYLRTKPNRRLTNKYYQLM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR006838Far-17a_AIG1
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006838FAR-17a/AIG1-like proteinPFAMPF04750Far-17a_AIG1coord: 16..211
e-value: 2.5E-38
score: 131.5
IPR006838FAR-17a/AIG1-like proteinPANTHERPTHR10989ANDROGEN-INDUCED PROTEIN 1-RELATEDcoord: 13..215
NoneNo IPR availableTMHMMTMhelixcoord: 83..105
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 120..142
NoneNo IPR availableTMHMMTMhelixcoord: 50..71
NoneNo IPR availableTMHMMTMhelixcoord: 193..215
NoneNo IPR availableTMHMMTMhelixcoord: 154..173