UBX domain containing protein 1

Overview
NameUBX domain containing protein 1
Smed IDSMED30022643
Length (bp)1130
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UBX domain containing protein 1 (SMED30022643) t-SNE clustered cells

Violin plots show distribution of expression levels for UBX domain containing protein 1 (SMED30022643) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UBX domain containing protein 1 (SMED30022643) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UBX domain containing protein 1 (SMED30022643) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of UBX domain containing protein 1 vs. Ensembl Human
Match: UBXN1 (UBX domain protein 1 [Source:HGNC Symbol;Acc:HGNC:18402])

HSP 1 Score: 75.8702 bits (185), Expect = 7.467e-15
Identity = 94/316 (29.75%), Postives = 160/316 (50.63%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVE-EIKP-LTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKML------PAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTG---LCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            + LI+MGF + + EKAL  T N G++AA+DWL+ HE               +   +DE  +  L          G +L RE      +++ G +  S S   E KP L+EEE++ Q +++ E +  K+ ERE ++ +E+L+RER RR+QG+ +  A+ + +EDE+RR A+++RREK E+   R++++ +I  D+  +  +      S    +          P++   + + +D CRIQVR   G  + +TF   + L  V L+     G      +  V+  +  P + +    M R ++ELG  PS VL+   K
Sbjct:    8 ESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHE---------------DDPDVDEPLETPL----------GHILGREPT----SSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKK 294          
BLAST of UBX domain containing protein 1 vs. Ensembl Human
Match: UBXN1 (UBX domain protein 1 [Source:HGNC Symbol;Acc:HGNC:18402])

HSP 1 Score: 75.0998 bits (183), Expect = 1.185e-14
Identity = 93/312 (29.81%), Postives = 159/312 (50.96%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVE-EIKP-LTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKML------PAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTG---LCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            + LI+MGF + + EKAL  T N G++AA+DWL+ HE               +   +DE  +  L          G +L RE      +++ G +  S S   E KP L+EEE++ Q +++ E +  K+ ERE ++ +E+L+RER RR+QG+ +  A+ + +EDE+RR A+++RREK E+   R++++ +I  D+  +  +      S    +          P++   + + +D CRIQVR   G  + +TF   + L  V L+     G      +  V+  +  P + +    M R ++ELG  PS VL+
Sbjct:    8 ESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHE---------------DDPDVDEPLETPL----------GHILGREPT----SSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLI 290          
BLAST of UBX domain containing protein 1 vs. Ensembl Human
Match: UBXN1 (UBX domain protein 1 [Source:HGNC Symbol;Acc:HGNC:18402])

HSP 1 Score: 71.633 bits (174), Expect = 2.176e-13
Identity = 97/312 (31.09%), Postives = 162/312 (51.92%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVE-EIKP-LTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKML--PAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTG---LCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            + LI+MGF + + EKAL  T N G++AA+DWL+ HE               +   +DE  +  L          G +L RE      +++ G +  S S   E KP L+EEE++ Q +++ E +  K+ ERE ++ +E+L+RER RR+QG+ +  A+ + +EDE+RR A+++RREK E++  REK++   A   +     + S+   +A E   +   P++   + + +D CRIQVR   G  + +TF   + L  V L+     G      +  V+  +  P + +    M R ++ELG  PS VL+   K
Sbjct:    8 ESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHE---------------DDPDVDEPLETPL----------GHILGREPT----SSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEEQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKK 290          
BLAST of UBX domain containing protein 1 vs. Ensembl Human
Match: UBXN1 (UBX domain protein 1 [Source:HGNC Symbol;Acc:HGNC:18402])

HSP 1 Score: 66.2402 bits (160), Expect = 1.475e-11
Identity = 88/306 (28.76%), Postives = 153/306 (50.00%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVE-EIKP-LTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKML------PAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTG---LCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFC 1041
            + LI+MGF + + EKAL  T N G++AA+DWL+ HED     + ++ P                          G +L RE      +++ G +  S S   E KP L+EEE++ Q +++ E +  K+ ERE ++ +E+L+RER RR+QG+ +  A+ + +EDE+RR A+++RREK E+   R++++ +I  D+  +  +      S    +          P++   + + +D CRIQVR   G  + +TF   + L  V L+     G      +  V+  +  P + +    M R ++ELG  
Sbjct:    8 ESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETP-------------------------LGHILGREPT----SSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGMA 284          
BLAST of UBX domain containing protein 1 vs. Ensembl Human
Match: UBXN4 (UBX domain protein 4 [Source:HGNC Symbol;Acc:HGNC:14860])

HSP 1 Score: 54.299 bits (129), Expect = 2.306e-7
Identity = 56/208 (26.92%), Postives = 101/208 (48.56%), Query Frame = 1
Query:  481 EEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLP-------------SENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCP--SIVLM 1059
            E+  I++E+L +KL+ +R E+  ++ +  +++E  RR+ GK ++D K K EE+  +R+ +++ REK EDR  RE++K QIALDR  +  +                       E+ +   A   ++V      RIQ R   G+     F P+D+  + A  F+ +T   +       T  P + +  E   + + +L   P  S+VL+
Sbjct:  193 EDLNIRVERLTKKLEERREEKRKEEEQREIKKEIERRKTGKEMLDYKRKQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERAARFAKTKEEVEAAKAAALLAKQAEMEVKRESYARERSTV-----ARIQFRLPDGSSFTNQF-PSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTKEDYKKKLLDLELAPSASVVLL 394          
BLAST of UBX domain containing protein 1 vs. Ensembl Celegans
Match: ubxn-1 (UBX domain-containing protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXH9])

HSP 1 Score: 140.969 bits (354), Expect = 6.967e-39
Identity = 101/300 (33.67%), Postives = 153/300 (51.00%), Query Frame = 1
Query:  160 QLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            QL+DMGF   K E A  + NN  L  A+DW+   +D      + D P        D G      A S KC+DCGKLL  +  + FHA+KT H NFSES E IKPLT EEK  ++ +++EK+K  + ++   +A+E+ ++E+ RR+ GK +I  K    + E+R  A  +RREK ED + R+++  QI LD+EA+K +   + V  AK  P           K++ +  +Q R   G  + + F  N+ L  V  W   +T   +       T  P K +  + M   +K L   PS  ++
Sbjct:    6 QLMDMGFPADKAEAA--AGNNRNLDQALDWI--EKDGAGVPMETDAPAQAAPGAADSG--APPVAASFKCDDCGKLLANDDAIMFHASKTKHENFSESSEAIKPLTAEEKAAKVLEIREKIKVHQAKKAKLEAEENREKEKKRREDGKAMISHKEAARDREIREAAQDRRREKNEDEIARKRVLEQIRLDKEARKAKASGQPVPEAKPAPSA---APVAPPKDYSTTTLQFRLLDGQTVRQQFEANEPLAMVRAWV--ETNHANGVPFTLMTPFPRKVFTEDDMGTPLKVLNLVPSANVI 294          
BLAST of UBX domain containing protein 1 vs. Ensembl Celegans
Match: ubxn-1 (UBX domain-containing protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXH9])

HSP 1 Score: 140.969 bits (354), Expect = 6.967e-39
Identity = 101/300 (33.67%), Postives = 153/300 (51.00%), Query Frame = 1
Query:  160 QLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            QL+DMGF   K E A  + NN  L  A+DW+   +D      + D P        D G      A S KC+DCGKLL  +  + FHA+KT H NFSES E IKPLT EEK  ++ +++EK+K  + ++   +A+E+ ++E+ RR+ GK +I  K    + E+R  A  +RREK ED + R+++  QI LD+EA+K +   + V  AK  P           K++ +  +Q R   G  + + F  N+ L  V  W   +T   +       T  P K +  + M   +K L   PS  ++
Sbjct:    6 QLMDMGFPADKAEAA--AGNNRNLDQALDWI--EKDGAGVPMETDAPAQAAPGAADSG--APPVAASFKCDDCGKLLANDDAIMFHASKTKHENFSESSEAIKPLTAEEKAAKVLEIREKIKVHQAKKAKLEAEENREKEKKRREDGKAMISHKEAARDREIREAAQDRRREKNEDEIARKRVLEQIRLDKEARKAKASGQPVPEAKPAPSA---APVAPPKDYSTTTLQFRLLDGQTVRQQFEANEPLAMVRAWV--ETNHANGVPFTLMTPFPRKVFTEDDMGTPLKVLNLVPSANVI 294          
BLAST of UBX domain containing protein 1 vs. Ensembl Fly
Match: CG8209 (gene:FBgn0035830 transcript:FBtr0076753)

HSP 1 Score: 172.94 bits (437), Expect = 1.386e-50
Identity = 115/325 (35.38%), Postives = 185/325 (56.92%), Query Frame = 1
Query:  148 SDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENAS----------------GIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSE--NVSMAKEMPKMLPAETNTSVK----NFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVL 1056
            S+   L+DMGF + +VE ALE T+N G++ A++WL++H D  +         P + +                    G+  +  AKS+KC++CGK+L   T+V++HA KTGH  FSES EE K LTEEEK+ Q+  ++EKLK KR+ERE ++  E+LQRE+ R + GK + +AK + EE E++++ +Q++REK+E++  R+++K QI  D+ A+K +   E  N   A  +     +     VK    ++   RIQVR   G+ + ETF+  + L  V ++   KTG+ S +     TT P K +  +   + ++ LG  PS V+
Sbjct:    2 SEVQTLMDMGFPRERVEYALEVTSNKGVEPAMEWLLAHVDDPIPSRQGAGESPGSTAQPAAAVDSSAAAASSSTSGAGETSAPVAKSLKCDECGKVLRDHTEVEYHAAKTGHTKFSESEEEKKALTEEEKKAQLALIEEKLKQKRIEREEREKIEALQREKNRIKSGKDMTEAKRRMEELEMKKIVEQRKREKDEEKAARDRVKAQIEADKAARKAREQKELGNAEPAPSVSSTTVSSPPAGVKSPPRDYTETRIQVRLQDGSTLQETFNVKEQLSAVRVFIQMKTGIESPF--SLMTTFPRKLFAEDDYEKPLEVLGLVPSAVI 324          
BLAST of UBX domain containing protein 1 vs. Ensembl Fly
Match: CG8042 (gene:FBgn0027554 transcript:FBtr0076766)

HSP 1 Score: 64.6994 bits (156), Expect = 5.139e-11
Identity = 53/206 (25.73%), Postives = 105/206 (50.97%), Query Frame = 1
Query:  475 TEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDR--EAKKMQLP----SENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEY-EVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            TE E+R  + +++  L+ KR ER  ++ +   + E  RR+ G+     + + +E EL+ + +Q +RE++E+   RE+++ QIA DR  +A++   P    + N   A     ++   T+ SV + D  R+Q+R   G Q  ++F   + L  V ++   +    S+  +    T+ P + +  E   +T+ EL   P+ V++ + K
Sbjct:  278 TESEER--LAEVRNILEQKRKERVEEEKRMEKENELRRRRDGREAQSQQARAKEQELKNMQEQIKRERQEELAARERIRAQIAADRAEQAQRFNTPDISSTTNSVAATAASNVI--TTDASVSSVDETRLQIRLPGGIQRTKSFPAGEVLATVRVYVRNEMLAASDVRDFTLATSYPRREFQTEDEVKTLNELNLVPNAVVLVLTK 479          
BLAST of UBX domain containing protein 1 vs. Ensembl Zebrafish
Match: ubxn1 (UBX domain protein 1 [Source:NCBI gene;Acc:322073])

HSP 1 Score: 132.109 bits (331), Expect = 1.996e-35
Identity = 97/313 (30.99%), Postives = 166/313 (53.04%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSM-----AKEMPKMLPAETNTSV---KNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            D L++MGF +++ EKA+  T N G++ A+DWL+ HE+     +   +PP  N  G  E   QS T      ED               T+ G+          +P+TEEE++ Q+++L++ +K ++ ER  ++ +E ++RE+ RR+QG+ ++  + K ++DE+++LADQ+R+EK EDRL ++++K++IA DRE +  +    + S        E P + P E   +    K++D CRIQVR   G  +   F   + L  V ++  Q  G   + +    T  P + Y    M + ++ELG  PS VL+   K
Sbjct:    8 DSLLEMGFGRNRAEKAVAHTGNQGIERAMDWLMEHENDPDIDEPY-VPPAGNTLGPAEEQSQSPTEIPESIED---------------TEEGNAR--------QPMTEEERKEQVKRLEDLMKARQEERRERERQEGIEREKQRRKQGQELLQVRQKLQDDEMKKLADQRRKEKMEDRLAKQRVKDKIARDREERAQKFGGGSSSTGLSSPPAEAPALSPPENQGAPPAKKDYDDCRIQVRLLDGTTLSTVFKAQEPLAAVRVYV-QMNGANGQ-DFNLITPYPRRVYTDLDMEKPLRELGLVPSAVLVVTKK 294          
BLAST of UBX domain containing protein 1 vs. Ensembl Zebrafish
Match: ubxn1 (UBX domain protein 1 [Source:NCBI gene;Acc:322073])

HSP 1 Score: 105.916 bits (263), Expect = 2.853e-26
Identity = 77/239 (32.22%), Postives = 135/239 (56.49%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSM-----AKEMPKMLPAETNTSV---KNFDSCRIQ 849
            D L++MGF +++ EKA+  T N G++ A+DWL+ HE+     +   +PP  N  G  E   QS T      ED               T+ G+          +P+TEEE++ Q+++L++ +K ++ ER  ++ +E ++RE+ RR+QG+ ++  + K ++DE+++LADQ+R+EK EDRL ++++K++IA DRE +  +    + S        E P + P E   +    K++D CRIQ
Sbjct:    8 DSLLEMGFGRNRAEKAVAHTGNQGIERAMDWLMEHENDPDIDEPY-VPPAGNTLGPAEEQSQSPTEIPESIED---------------TEEGNAR--------QPMTEEERKEQVKRLEDLMKARQEERRERERQEGIEREKQRRKQGQELLQVRQKLQDDEMKKLADQRRKEKMEDRLAKQRVKDKIARDREERAQKFGGGSSSTGLSSPPAEAPALSPPENQGAPPAKKDYDDCRIQ 222          
BLAST of UBX domain containing protein 1 vs. Ensembl Zebrafish
Match: ubxn1 (UBX domain protein 1 [Source:NCBI gene;Acc:322073])

HSP 1 Score: 52.373 bits (124), Expect = 3.466e-8
Identity = 39/124 (31.45%), Postives = 64/124 (51.61%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKT 528
            D L++MGF +++ EKA+  T N G++ A+DWL+ HE  D  +D+  +PP  N  G  E   QS T      ED               T+ G+          +P+TEEE++ Q+++L++ +K 
Sbjct:    8 DSLLEMGFGRNRAEKAVAHTGNQGIERAMDWLMEHE-NDPDIDEPYVPPAGNTLGPAEEQSQSPTEIPESIED---------------TEEGNAR--------QPMTEEERKEQVKRLEDLMKA 107          
BLAST of UBX domain containing protein 1 vs. Ensembl Xenopus
Match: ubxn1 (UBX domain protein 1 [Source:NCBI gene;Acc:448372])

HSP 1 Score: 119.013 bits (297), Expect = 1.932e-30
Identity = 96/318 (30.19%), Postives = 159/318 (50.00%), Query Frame = 1
Query:  148 SDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQL---PSENVSMAKE--MPKMLPAETN-----TSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            S  + LI+MGF  S+ EKAL +T N G++ A+DWLV HED     +   + P ++ SG                          TD Q   T           EE  PLTEEEK  Q +++ E +  K+ ERE ++ +E +++E+ RR+QG+ +   K K +E E+++  + +RREK+E++L R++++ +IA D+  +  +     SE +S   E  +P   P+ ++      + K +D CRIQVR   G+ + +TF   + L  V L+        +       T+ P + +  E M + ++ELG  PS VL+   K
Sbjct:    5 STLESLIEMGFSPSRAEKALAATGNQGIEPAMDWLVEHEDDPDIDEPSVVVPEDSDSGT-------------------------TDTQGMDT----------CEERLPLTEEEKEKQTKRMMELIAQKQKEREEREKRERIEQEKQRRKQGQELSAVKQKIQEQEMQKAVEDRRREKQEEKLARDRVREKIARDKAERARRFGGAGSEPISPPAEASIPATTPSPSSPVQEPPTKKEYDQCRIQVRLLDGSALSQTFRAREQLAAVRLYVELNWPGGAPGPFNLLTSFPRRVFTEEDMEKPLQELGLVPSAVLIVARK 287          
BLAST of UBX domain containing protein 1 vs. Ensembl Xenopus
Match: fbxw9 (F-box and WD repeat domain containing 9 [Source:Xenbase;Acc:XB-GENE-5726702])

HSP 1 Score: 53.9138 bits (128), Expect = 2.644e-7
Identity = 32/96 (33.33%), Postives = 64/96 (66.67%), Query Frame = 1
Query:  445 SESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDR 732
            +E V+ I+P  EEE   +++++ +KL+ +R +R+  + +  +++E  RR+ GK +++ K K EED  +R  +++ REK E++  R++++ QIA DR
Sbjct:  252 TECVQPIQP--EEEFADRVQRVTQKLEERREQRKKDEEQVEIKKEIERRKMGKDMLEYKRKQEEDLAKRALEERNREKAEEKAARDRIRQQIAQDR 345          
BLAST of UBX domain containing protein 1 vs. Ensembl Mouse
Match: Ubxn1 (UBX domain protein 1 [Source:MGI Symbol;Acc:MGI:1289301])

HSP 1 Score: 90.8929 bits (224), Expect = 2.693e-20
Identity = 94/314 (29.94%), Postives = 158/314 (50.32%), Query Frame = 1
Query:  163 LIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKP-LTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSV-------KNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTG---LCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            LI+MGF + + EKAL  T N G++AA+DWL+ HE               +   +DE  +  L+           +L RE      + + G      +  E +P LTEEE++ Q +++ E +  K+ ERE ++ +E+L+RE+ RR+QG+ +  A+ K +EDE+RR A+++RREK E+   R++++ +I  D+ A++ +    +V      P   P    +S        + +D CRIQVR   G  + +TF   + L  V L+     G      +  V+  +  P + +    M R ++ELG  PS VL+   K
Sbjct:   10 LIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHE---------------DDPDVDEPLETPLS----------HVLGREP---TPSEQVGPEGSGSAAGESRPILTEEERQEQTKRMLELVAQKQREREEREEREALEREKQRRRQGQELSVARQKLQEDEMRRAAEERRREKAEELAARQRVREKIERDK-AERAKKYGGSVGSRSSPPATDPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEEPGQDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKK 294          
BLAST of UBX domain containing protein 1 vs. Ensembl Mouse
Match: Ubxn1 (UBX domain protein 1 [Source:MGI Symbol;Acc:MGI:1289301])

HSP 1 Score: 90.8929 bits (224), Expect = 2.693e-20
Identity = 94/314 (29.94%), Postives = 158/314 (50.32%), Query Frame = 1
Query:  163 LIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKP-LTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSV-------KNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTG---LCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            LI+MGF + + EKAL  T N G++AA+DWL+ HE               +   +DE  +  L+           +L RE      + + G      +  E +P LTEEE++ Q +++ E +  K+ ERE ++ +E+L+RE+ RR+QG+ +  A+ K +EDE+RR A+++RREK E+   R++++ +I  D+ A++ +    +V      P   P    +S        + +D CRIQVR   G  + +TF   + L  V L+     G      +  V+  +  P + +    M R ++ELG  PS VL+   K
Sbjct:   10 LIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHE---------------DDPDVDEPLETPLS----------HVLGREP---TPSEQVGPEGSGSAAGESRPILTEEERQEQTKRMLELVAQKQREREEREEREALEREKQRRRQGQELSVARQKLQEDEMRRAAEERRREKAEELAARQRVREKIERDK-AERAKKYGGSVGSRSSPPATDPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEEPGQDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKK 294          
BLAST of UBX domain containing protein 1 vs. Ensembl Mouse
Match: Ubxn1 (UBX domain protein 1 [Source:MGI Symbol;Acc:MGI:1289301])

HSP 1 Score: 62.7734 bits (151), Expect = 8.685e-11
Identity = 69/227 (30.40%), Postives = 120/227 (52.86%), Query Frame = 1
Query:  424 KTGHMNFSESVEEIKP-LTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSV-------KNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTG---LCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            + G      +  E +P LTEEE++ Q +++ E +  K+ ERE ++ +E+L+RE+ RR+QG+ +  A+ K +EDE+RR A+++RREK E+   R++++ +I  D+ A++ +    +V      P   P    +S        + +D CRIQVR   G  + +TF   + L  V L+     G      +  V+  +  P + +    M R ++ELG  PS VL+   K
Sbjct:   34 QVGPEGSGSAAGESRPILTEEERQEQTKRMLELVAQKQREREEREEREALEREKQRRRQGQELSVARQKLQEDEMRRAAEERRREKAEELAARQRVREKIERDK-AERAKKYGGSVGSRSSPPATDPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEEPGQDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKK 259          
BLAST of UBX domain containing protein 1 vs. Ensembl Mouse
Match: Ubxn4 (UBX domain protein 4 [Source:MGI Symbol;Acc:MGI:1915062])

HSP 1 Score: 63.1586 bits (152), Expect = 1.879e-10
Identity = 59/202 (29.21%), Postives = 105/202 (51.98%), Query Frame = 1
Query:  481 EEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSVKNFDS-------CRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCP--SIVLM 1059
            E+  +++E+L +KL+ +R E+  ++A+  +++E  RR+ GK ++D K K EE+  +R+ +++ REK EDR  RE++K QIALDR  +  +      + A +   +L  +  T VK   +        RIQ R   G+     F P+D+  + A  F+ +T   +       T  P + +  E   R + +L   P  S+VL+
Sbjct:  192 EDLTVRVERLTKKLEERREEKRKEEAQREIKKEIERRKTGKEMLDYKRKQEEELTKRMLEERSREKAEDRAARERIKQQIALDRAERAARFAKTKEAEAAKAAALLTKQAGTEVKRESTARDRSTIARIQFRLPDGSSFTNQF-PSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTREDYKRRLLDLELAPSASVVLL 392          
BLAST of UBX domain containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9TXH9|UBXN1_CAEEL (UBX domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=ubxn-1 PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 8.863e-38
Identity = 101/300 (33.67%), Postives = 153/300 (51.00%), Query Frame = 1
Query:  160 QLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            QL+DMGF   K E A  + NN  L  A+DW+   +D      + D P        D G      A S KC+DCGKLL  +  + FHA+KT H NFSES E IKPLT EEK  ++ +++EK+K  + ++   +A+E+ ++E+ RR+ GK +I  K    + E+R  A  +RREK ED + R+++  QI LD+EA+K +   + V  AK  P           K++ +  +Q R   G  + + F  N+ L  V  W   +T   +       T  P K +  + M   +K L   PS  ++
Sbjct:    6 QLMDMGFPADKAEAA--AGNNRNLDQALDWI--EKDGAGVPMETDAPAQAAPGAADSG--APPVAASFKCDDCGKLLANDDAIMFHASKTKHENFSESSEAIKPLTAEEKAAKVLEIREKIKVHQAKKAKLEAEENREKEKKRREDGKAMISHKEAARDREIREAAQDRRREKNEDEIARKRVLEQIRLDKEARKAKASGQPVPEAKPAPSA---APVAPPKDYSTTTLQFRLLDGQTVRQQFEANEPLAMVRAWV--ETNHANGVPFTLMTPFPRKVFTEDDMGTPLKVLNLVPSANVI 294          
BLAST of UBX domain containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6NXA9|UBXN1_DANRE (UBX domain-containing protein 1 OS=Danio rerio OX=7955 GN=ubxn1 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.420e-35
Identity = 98/313 (31.31%), Postives = 166/313 (53.04%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSM-----AKEMPKMLPAETNTSV---KNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            D L++MGF +++ EKA+  T N G++ A+DWL+ HE+     +   +PP  N  G  E   QS T      ED               T+ G+          +P+TEEE++ Q+++L++ +K ++ ER  ++ +E ++RE+ RR+QG+ ++  + K +EDE+++LADQ+R+EK EDRL ++++K++IA DRE +  +    + S        E P + P E   +    K++D CRIQVR   G  +   F   + L  V ++  Q  G   + +    T  P + Y    M + ++ELG  PS VL+   K
Sbjct:    8 DSLLEMGFGRNRAEKAVAHTGNQGIERAMDWLMEHENDPDIDEPY-VPPAGNTLGPAEEQSQSPTEIPESIED---------------TEEGNAR--------QPMTEEERKEQVKRLEDLMKARQEERRERERQEGIEREKQRRKQGQELLQVRQKLQEDEMKKLADQRRKEKMEDRLAKQRVKDKIARDREERAQKFGGGSSSTGLSSPPAEAPALSPPENQGAPPAKKDYDDCRIQVRLLDGTTLSTVFKAQEPLAAVRVYV-QMNGANGQ-DFNLITPYPRRVYTDLDMEKPLRELGLVPSAVLVVTKK 294          
BLAST of UBX domain containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6GL77|UBXN1_XENTR (UBX domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=ubxn1 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.023e-29
Identity = 96/318 (30.19%), Postives = 159/318 (50.00%), Query Frame = 1
Query:  148 SDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQL---PSENVSMAKE--MPKMLPAETN-----TSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            S  + LI+MGF  S+ EKAL +T N G++ A+DWLV HED     +   + P ++ SG                          TD Q   T           EE  PLTEEEK  Q +++ E +  K+ ERE ++ +E +++E+ RR+QG+ +   K K +E E+++  + +RREK+E++L R++++ +IA D+  +  +     SE +S   E  +P   P+ ++      + K +D CRIQVR   G+ + +TF   + L  V L+        +       T+ P + +  E M + ++ELG  PS VL+   K
Sbjct:    5 STLESLIEMGFSPSRAEKALAATGNQGIEPAMDWLVEHEDDPDIDEPSVVVPEDSDSGT-------------------------TDTQGMDT----------CEERLPLTEEEKEKQTKRMMELIAQKQKEREEREKRERIEQEKQRRKQGQELSAVKQKIQEQEMQKAVEDRRREKQEEKLARDRVREKIARDKAERARRFGGAGSEPISPPAEASIPATTPSPSSPVQEPPTKKEYDQCRIQVRLLDGSALSQTFRAREQLAAVRLYVELNWPGGAPGPFNLLTSFPRRVFTEEDMEKPLQELGLVPSAVLIVARK 287          
BLAST of UBX domain containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6GLV4|UBX1B_XENLA (UBX domain-containing protein 1-B OS=Xenopus laevis OX=8355 GN=ubxn1-b PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.805e-28
Identity = 93/318 (29.25%), Postives = 152/318 (47.80%), Query Frame = 1
Query:  148 SDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDRE----------AKKMQLPSENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            S  + LI+MGF  S+ EKAL +T N G++ A+DWLV HED     +   + P                      ED G      TD Q   T    +          PLTEEEK  Q +++ E +  K+ ERE ++ +E +++E+ RR+ G+ +   K + +E E+++ A+ +RREK+E+RL RE+++ +IA D+           ++ +  P+E    A       P +   + K +D CRIQVR   G+ + +TF   + L  V L+                T+ P + +  E M + ++ELG  P+ VL+   K
Sbjct:    5 SALESLIEMGFSPSRAEKALSATGNQGIEPAMDWLVEHEDDPDIKEPSVVIP----------------------EDSGTDTTDTTDTQAMDTSAERL----------PLTEEEKEKQTKRMMELIAQKQKEREEREKRERIEQEKQRRKHGQELSAIKQRMQEQEMQKAAEDRRREKQEERLARERVREKIARDKADRARKFGGAGSEPISPPAETSVPATAPSPSSPVQEPPTKKEYDQCRIQVRLLDGSALSQTFRAREQLAAVRLYVELNWPGGPPEPFSLLTSFPRRVFTEEDMEKPLQELGLVPTAVLIVAKK 290          
BLAST of UBX domain containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6IP50|UBX1A_XENLA (UBX domain-containing protein 1-A OS=Xenopus laevis OX=8355 GN=ubxn1-a PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.700e-27
Identity = 95/318 (29.87%), Postives = 159/318 (50.00%), Query Frame = 1
Query:  148 SDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQL---PSENVSMAKE--MPKMLPAETN-----TSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            S  + LI+MGF  ++ EKAL +T N G++ A+DWLV HE               +   IDE         S+   +       +T      T T  M+ S    E  PLTEEEK  Q +++ E +  K+ ERE ++ KE +++E+ RR+ G+ +   K K +E E+++ A+ +RREK+E+++ RE+++ +IA D+  +  +     SE +S   E  +P   P+ ++      + K +D CRIQVR   G+ + +TF   + L  V L+                T+ P + +  E M + ++ELG  P+ VL+   K
Sbjct:    5 STLESLIEMGFSSTRAEKALTATGNQGIEPAMDWLVEHE---------------DDPDIDE--------PSVVVPEGSSTDTADTTDTTDTTDTQGMDTSA---ERLPLTEEEKEKQTKRMMELVAQKQNEREEREKKERIEQEKQRRKHGQELSAIKQKMQEQEMQKAAEDRRREKQEEKMARERVREKIARDKADRARRFGGASSEPISPPAETSIPATTPSPSSPVQEPPTKKEYDQCRIQVRLLDGSALSQTFRAREQLAAVRLYVELNWPGGPPGPFSLLTSFPQRVFTEEDMEKPLQELGLVPTAVLIVAKK 296          
BLAST of UBX domain containing protein 1 vs. TrEMBL
Match: A0A0V0J920 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR96424 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 3.618e-68
Identity = 133/339 (39.23%), Postives = 199/339 (58.70%), Query Frame = 1
Query:  142 MESDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPP----PENASGIDEGDKQS--------LTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQ------------LPSENV--SMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQK------TGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMA 1062
            M SD + L++MG+ +   EKAL+ TN  GLQAA++W+V H            PP    P   S I EGD  +        L  +S KCEDCGK L  E ++Q H+ +TGH NFSES + +KPLTEEEK+ Q++++ E L+ K+++R+ ++    ++ E+ RR+QGKT++ AK KF+E+E+RR+A+Q RREK ED+ YRE+L+ +IA DRE K  +            LP   V   +A   PK  P  +  +      CR+QVR   G  ++ TF P++ L  V L+ SQ+       G+ +  E+  +TT PT+ +  E + R++++LG CPS VLMA
Sbjct:    1 MSSDLEYLVEMGWTRDHAEKALKETNYQGLQAALEWIVDH------------PPEEKEPAKTSTI-EGDLSADQEPPLTALVCQSYKCEDCGKQLKSEEEIQVHSARTGHANFSESADTVKPLTEEEKQAQIKRISEYLEKKKIQRQEEERVRQIEDEKRRREQGKTLVSAKIKFQEEEMRRVAEQTRREKAEDKAYRERLRAEIARDREEKMARAAAAKAEASGSPLPPSPVHQPVAATTPKNAPTYSRPT-----ECRLQVRTPTGQPVVATFKPSEPLSAVVLYVSQQWPGAPPNGVDTR-EITLQTTFPTRKFTEEDLQRSLEDLGLCPSAVLMA 320          
BLAST of UBX domain containing protein 1 vs. TrEMBL
Match: A0A4S2LSM3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006378 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 5.300e-68
Identity = 139/311 (44.69%), Postives = 196/311 (63.02%), Query Frame = 1
Query:  142 MESDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSE----YEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMA 1062
            M SD DQL++MGF++S  EKAL++T N GL AA+DW+V H+  +       I     A+  +  + +S  A+  KCE+C K+L  + +VQ H+ +TGH+N+SES E +KPLTEEE+++QMEKLQE L+ K+L+REA++ +E L+RE+ RR+QGK I+ AK KFEEDE++RL +Q+RREKEEDR YRE+LK  IA +RE KKM+   E  ++A      LP +T  S      CR+ +R   G  +   F  N+ L  V L+  Q     S+      V   TT P + Y  + M  T+ +LG CPS VLMA
Sbjct:   25 MASDLDQLLEMGFERSLAEKALKNTGNNGLSAAMDWIVEHQGDNE------ITESGGAAAEECKEAESPAARVFKCEECSKMLRNDEEVQLHSVRTGHVNYSESAESLKPLTEEERKLQMEKLQELLQQKKLQREAKEREEELEREKQRRRQGKDIVSAKAKFEEDEMKRLVEQRRREKEEDRAYRERLKADIAREREEKKMRERGEAAAVAPSSKPTLPPQTTKSDATI--CRLHIRLPTGQPLKYDFGANEPLSAVRLYVCQHWPDGSDELDPTTVNLFTTFPKRDYAEDDMQTTLSDLGLCPSAVLMA 327          
BLAST of UBX domain containing protein 1 vs. TrEMBL
Match: A0A4Z2CRM1 (UBX domain-containing protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_008118 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.072e-63
Identity = 130/312 (41.67%), Postives = 190/312 (60.90%), Query Frame = 1
Query:  142 MESDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSVK-NFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEY----EVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMA 1062
            M S  +QLI+MGF ++K EKAL+ + N GL+ A++W++ ++  D           E   G  E  K+  +A S KCEDC K L  + DVQ H+ +TGH+N+SES + + PLTE+E++ QMEKLQE L+ K+++RE Q+  E  +RE+ RRQQ KT+  AK KFEEDE+RRL +QK+REKEEDR YREKLK +IA ++E K+ +   E++ +      +    +NT+ K N   CR+Q+R   G  I   F  N+ L  V L+ SQ     S +     +   T  P + +  E MS+++ +LG CPS VL+ 
Sbjct:    1 MSSVLEQLIEMGFTQAKAEKALKFSGNKGLEEAMEWIIENDSGDEKE--------EALDGTGE-TKKIASALSYKCEDCNKCLRNDEDVQMHSARTGHVNYSESSDSVSPLTEDERKQQMEKLQELLRIKKVQREEQEKHEEFEREKKRRQQCKTLSSAKAKFEEDEIRRLIEQKKREKEEDRAYREKLKAEIAREQEEKRAREAGESLVITSNSAPV----SNTAPKINPTICRLQIRLPSGQPIKGEFGVNEPLSAVTLYVSQNWPNSSTFIDPQSIHLMTNFPKQEFTDEDMSKSLLDLGLCPSAVLIV 299          
BLAST of UBX domain containing protein 1 vs. TrEMBL
Match: Q17M31 (AAEL001154-PA OS=Aedes aegypti OX=7159 GN=AAEL001154 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 3.688e-62
Identity = 121/319 (37.93%), Postives = 189/319 (59.25%), Query Frame = 1
Query:  148 SDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSH-------EXXXXXXXXXXIPPPE-----NASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMP-KMLPAETN--TSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            SD   L+DMGF K K E+AL+ TNN G++AA++WL++H                   PP E     +A+G    ++ +  AKS+KC++CGKL   + +V+FHA KT H +FSES EE KPLTE+E++ Q+  L+EK+K KR ERE  + KE+ +RER R + GK +++AK K EE E++++ +Q+RREK E++  R+++K QI  D+ A++ +   E+   A  +P    P E +   + K + + RIQ+R   G+ ++ETF   + L  V L+   K G  S       T+ P K + GE    ++++LG  PS VL+
Sbjct:    2 SDIQTLVDMGFPKEKAERALQVTNNKGVEAAMEWLLAHADEDIPSGSGSSSSTTEQQPPAEEGTSPDATGGTATEESAQVAKSLKCDECGKLFKSQDEVEFHAAKTQHSSFSESTEEKKPLTEDERKAQLALLEEKMKRKRQEREENEKKEAQERERLRIKSGKDMLEAKRKLEEQEMKKVMEQRRREKMEEKAARDRVKAQIEADKAARRAKQAGESPIAAAPVPVATTPTEPSKPATPKTYTNARIQIRMLDGSTLVETFDAKEQLAAVRLFVQLKLGSGS-APFGLMTSFPRKVFDGEDFDNSLEKLGLVPSAVLI 319          
BLAST of UBX domain containing protein 1 vs. TrEMBL
Match: A0A182GYK1 (Uncharacterized protein OS=Aedes albopictus OX=7160 GN=RP20_CCG018214 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.772e-62
Identity = 124/319 (38.87%), Postives = 189/319 (59.25%), Query Frame = 1
Query:  148 SDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHE-------XXXXXXXXXXIPPPENASGIDEG-----DKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKM-LPAETN--TSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            SD   L+DMGF K K E+AL+ TNN G++AA++WL++H          +        PP E ++  D       ++ +  AKS+KC++CGKL   + +V+FHA KT H +FSES EE KPLTEEEK+ Q+  L+EK+K KR ERE  + KE+ +RER R + GK +++AK K EE E++++ +Q+RREK E++  R+++K QI  D+ A++ +   E+   A   P +  P E N   + K + + RIQVR   G+ ++ETF   + L  V L+   K G  S       T+ P K +GG+    +++ LG  PS VL+
Sbjct:    2 SDIQTLVDMGFPKEKAERALQVTNNKGVEAAMEWLLAHADEDIPSASGESTSSAEQQPPAEGSASSDAAPAATTEESAAVAKSLKCDECGKLFKSQDEVEFHAAKTQHSSFSESTEEKKPLTEEEKKAQLALLEEKMKRKRQEREDNEKKEAQERERLRIKSGKDMLEAKRKLEEQEMKKVMEQRRREKMEEKAARDRVKAQIEADKAARRAKQAGESPLAAAPAPVVTTPTEPNKPATPKTYTNARIQVRMLDGSTLVETFDAKEQLAAVRLFVQLKLGDGS-APFGLMTSFPRKVFGGDDYDNSLEMLGLVPSAVLI 319          
BLAST of UBX domain containing protein 1 vs. Ensembl Cavefish
Match: ubxn1 (UBX domain protein 1 [Source:NCBI gene;Acc:103036863])

HSP 1 Score: 131.724 bits (330), Expect = 2.772e-35
Identity = 90/311 (28.94%), Postives = 160/311 (51.45%), Query Frame = 1
Query:  163 LIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPS------ENVSMAKEMPKMLPAETN--TSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIK 1071
            L++MGFD+++ EKA+  T N G++ A+DWL+ HE+     +   +PP  N  G  E +  S  A        G++L  E D +                  +P+TEEEK+ Q+++L+E ++ K+ ER  ++ ++ + RE+ RR+QG+ +   + K +EDE+++LAD +RREK ED++ ++++K +IA DRE +  +          +   +   P+  P       + K++D CRIQVR   G+ +   F   + L  V ++    +    ++     +  P + Y    M + + ELG  PS VL+   K
Sbjct:   10 LLEMGFDRNRAEKAVAHTGNQGIERAMDWLMEHENDPDIDEPY-VPPAGNVLGSPEQESPSQPATEPIISPDGEIL--EGDSK------------------RPMTEEEKKEQVKRLEELMRVKQEERRERERQDEVDREKQRRKQGQELQQVRQKLQEDEMKKLADDRRREKMEDKMAKQRVKEKIARDREERARKFGGSSSSTSLSSPTSDTTPQSPPESQGPPPAKKDYDECRIQVRLLDGSALTTVFKAQEPLAAVRVYVQMNSSESQDF--TLLSPYPRRVYTDLDMEKPLSELGLVPSAVLVVAKK 297          
BLAST of UBX domain containing protein 1 vs. Ensembl Sea Lamprey
Match: UBXN4 (UBX domain protein 4 [Source:HGNC Symbol;Acc:HGNC:14860])

HSP 1 Score: 66.2402 bits (160), Expect = 3.037e-12
Identity = 56/200 (28.00%), Postives = 98/200 (49.00%), Query Frame = 1
Query:  493 IQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSEN---------VSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAV 1065
            I ++KL  KL+ KR ++   + + +++RE  RR+ GK + + K + EE++ +R+ D++ REK E+R  +E+++ QIA DR  +  +   E             AKE  K    E  T        RIQ R   G+     FS   +L + A  F+Q+    +  +    T  P + +  +   RT++ELG  PS  ++ +
Sbjct:  193 IFVKKLNRKLEEKRQQKAKDEEESNIRREIERRKLGKDMAEFKQRKEEEQAKRVMDERNREKAEERAAKERIRQQIAQDRAERAARYNREKEEVDAARVAAQQAKEAEKRA-KEQQTQQDRTAIARIQYRLPDGSYFTNQFSSETTLAE-ARTFAQQVVKNAYGDFTLATAFPRRNFTVDDYPRTLQELGLAPSAAIIVL 390          
BLAST of UBX domain containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008603.1 (pep scaffold:Pmarinus_7.0:GL480855:23890:24793:-1 gene:ENSPMAG00000007795.1 transcript:ENSPMAT00000008603.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.771e-8
Identity = 25/80 (31.25%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  823 KNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFS-QKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            +++D CRIQVR   G+Q++++F+  ++L  V L+    +    + + +   T  P + +G E M + + ELG  PS VL+
Sbjct:   40 RDYDQCRIQVRMPDGSQLMQSFAAKETLAAVRLFVELHRQDEATPFVL--LTNFPRRLFGDEDMEKPLSELGLVPSAVLI 117          
BLAST of UBX domain containing protein 1 vs. Ensembl Nematostella
Match: EDO38113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDP9])

HSP 1 Score: 82.4185 bits (202), Expect = 9.689e-18
Identity = 69/232 (29.74%), Postives = 117/232 (50.43%), Query Frame = 1
Query:  142 MESDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIP------------PPENA-SGIDEGDKQSL-----------------TAKSMKCEDCGKLLLRETDVQ-----FHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDR 732
            M ++   L++MGF +++ EKAL  T   G++AA++WL +H +     +   +P            PP+ A      GD QS+                  A S+ C+DCGK L  E DVQ         +T       +   + P+     ++   +LQ+K+K +R E+   + KE L++E+ RR+ GK I   K + E DE ++LAD KRREK+E+++ R++++ +I  D+
Sbjct:    1 MSNEVQTLMEMGFPQNRAEKALAVTGKRGVEAAMEWLFAHSEDPDIDEPYKLPQGHKLGSADDTAPPQEAMCAAAPGDSQSVGDQEEGQGGESGEAAPQQALSLVCDDCGKRLRSENDVQDFCKILKKLQTDLNVPPSATSTMNPVALYNIKL---RLQQKIKERRQEKAEIEKKEKLEKEKIRRKTGKEITQIKQQMELDEAKKLADFKRREKQEEKMARQRVREKIEKDK 229          
BLAST of UBX domain containing protein 1 vs. Ensembl Nematostella
Match: EDO42505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1H1])

HSP 1 Score: 68.1662 bits (165), Expect = 1.317e-12
Identity = 53/192 (27.60%), Postives = 95/192 (49.48%), Query Frame = 1
Query:  520 LKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALD---REAKKMQLPSENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPS--IVLMAVIKKSG 1080
            ++ KR E+  ++ +E +++E  RR++G+ +++AK + EE + + L +Q R ++ ++R  RE ++ QIA D   REA+K     E             A T T   ++ + R+Q R   G+ I   F P D+L   A  +           V   TT P + +  + M R++ +LG  PS  I++  + K  G
Sbjct:  182 IEQKRKEKAEREKQEQIEKEAKRREEGQQLVNAKRQIEERKQQELVNQIREDRAKERAAREAVRQQIARDKAEREAQKQAELKERQQAQDTSASTTAASTYTGGGSYSNVRLQFRLPDGSGITHLF-PADALLSTAHQYVVSHTGSRLPSVAMSTTYPRRQFTDDDMQRSLTDLGLAPSATIIVTEIFKHVG 372          
BLAST of UBX domain containing protein 1 vs. Ensembl Medaka
Match: ubxn1 (UBX domain protein 1 [Source:NCBI gene;Acc:101158616])

HSP 1 Score: 142.895 bits (359), Expect = 2.191e-39
Identity = 99/309 (32.04%), Postives = 169/309 (54.69%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDRE--AKKMQLPSENVSMAKEMPKMLPAETNTSV------KNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            D L++MGFD+++ E+A+ ST N G++ A+DWL++HE+     +   +PP  N  G +  D QS T    + ED               T  G  +F E  E  +P++EEEK+ Q+++L+E ++ K+ ER  ++  E ++RE+ RR+QG+ +   + K ++DE+++LA+Q+RREK ED++ R+++K++IA DRE  A+K    + + + A   P +    + TS       K +D  RIQVR   G+ I   F   + L  V ++    +      +    +  P   Y  + M + +KELG  PS VL+
Sbjct:    8 DSLLEMGFDRNRAERAVASTGNQGIEQAMDWLMAHENDPDIDEPY-VPPVGNVLG-EAADTQSGTEPPTR-EDPA-----------EGTAEGDGSFVEDEENKRPMSEEEKQEQVKRLEELMRVKQAERRERERAEEVEREKQRRRQGQELQQIRQKIQDDEMKKLAEQRRREKMEDKMARQRVKDKIARDREERAQKFGGGAASTTSASSQPNLPSPSSPTSQGPPPSKKEYDESRIQVRLLDGSTITAAFKAQEPLAAVRVYIQMNSNTPEGQDFTLLSPYPRHIYTEQDMEKPLKELGLVPSAVLV 302          
BLAST of UBX domain containing protein 1 vs. Ensembl Medaka
Match: ubxn1 (UBX domain protein 1 [Source:NCBI gene;Acc:101158616])

HSP 1 Score: 142.895 bits (359), Expect = 2.191e-39
Identity = 99/309 (32.04%), Postives = 169/309 (54.69%), Query Frame = 1
Query:  157 DQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDRE--AKKMQLPSENVSMAKEMPKMLPAETNTSV------KNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLM 1059
            D L++MGFD+++ E+A+ ST N G++ A+DWL++HE+     +   +PP  N  G +  D QS T    + ED               T  G  +F E  E  +P++EEEK+ Q+++L+E ++ K+ ER  ++  E ++RE+ RR+QG+ +   + K ++DE+++LA+Q+RREK ED++ R+++K++IA DRE  A+K    + + + A   P +    + TS       K +D  RIQVR   G+ I   F   + L  V ++    +      +    +  P   Y  + M + +KELG  PS VL+
Sbjct:    8 DSLLEMGFDRNRAERAVASTGNQGIEQAMDWLMAHENDPDIDEPY-VPPVGNVLG-EAADTQSGTEPPTR-EDPA-----------EGTAEGDGSFVEDEENKRPMSEEEKQEQVKRLEELMRVKQAERRERERAEEVEREKQRRRQGQELQQIRQKIQDDEMKKLAEQRRREKMEDKMARQRVKDKIARDREERAQKFGGGAASTTSASSQPNLPSPSSPTSQGPPPSKKEYDESRIQVRLLDGSTITAAFKAQEPLAAVRVYIQMNSNTPEGQDFTLLSPYPRHIYTEQDMEKPLKELGLVPSAVLV 302          
BLAST of UBX domain containing protein 1 vs. Planmine SMEST
Match: SMESG000028619.1 (SMESG000028619.1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 313/314 (99.68%), Postives = 313/314 (99.68%), Query Frame = 1
Query:  142 MESDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEXXXXXXXXXXIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPSENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIKKSGF 1083
            MESDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEDVDVHVDDMDIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLP ENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIKKSGF
Sbjct:    1 MESDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEDVDVHVDDMDIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMNFSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRRQQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAKKMQLPRENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFSPNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFCPSIVLMAVIKKSGF 314          
The following BLAST results are available for this feature:
BLAST of UBX domain containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBXN17.467e-1529.75UBX domain protein 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
UBXN11.185e-1429.81UBX domain protein 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
UBXN12.176e-1331.09UBX domain protein 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
UBXN11.475e-1128.76UBX domain protein 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
UBXN42.306e-726.92UBX domain protein 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ubxn-16.967e-3933.67UBX domain-containing protein 1 [Source:UniProtKB... [more]
ubxn-16.967e-3933.67UBX domain-containing protein 1 [Source:UniProtKB... [more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG82091.386e-5035.38gene:FBgn0035830 transcript:FBtr0076753[more]
CG80425.139e-1125.73gene:FBgn0027554 transcript:FBtr0076766[more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ubxn11.996e-3530.99UBX domain protein 1 [Source:NCBI gene;Acc:322073][more]
ubxn12.853e-2632.22UBX domain protein 1 [Source:NCBI gene;Acc:322073][more]
ubxn13.466e-831.45UBX domain protein 1 [Source:NCBI gene;Acc:322073][more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ubxn11.932e-3030.19UBX domain protein 1 [Source:NCBI gene;Acc:448372][more]
fbxw92.644e-733.33F-box and WD repeat domain containing 9 [Source:Xe... [more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ubxn12.693e-2029.94UBX domain protein 1 [Source:MGI Symbol;Acc:MGI:12... [more]
Ubxn12.693e-2029.94UBX domain protein 1 [Source:MGI Symbol;Acc:MGI:12... [more]
Ubxn18.685e-1130.40UBX domain protein 1 [Source:MGI Symbol;Acc:MGI:12... [more]
Ubxn41.879e-1029.21UBX domain protein 4 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of UBX domain containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9TXH9|UBXN1_CAEEL8.863e-3833.67UBX domain-containing protein 1 OS=Caenorhabditis ... [more]
sp|Q6NXA9|UBXN1_DANRE4.420e-3531.31UBX domain-containing protein 1 OS=Danio rerio OX=... [more]
sp|Q6GL77|UBXN1_XENTR1.023e-2930.19UBX domain-containing protein 1 OS=Xenopus tropica... [more]
sp|Q6GLV4|UBX1B_XENLA1.805e-2829.25UBX domain-containing protein 1-B OS=Xenopus laevi... [more]
sp|Q6IP50|UBX1A_XENLA1.700e-2729.87UBX domain-containing protein 1-A OS=Xenopus laevi... [more]
back to top
BLAST of UBX domain containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J9203.618e-6839.23Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A4S2LSM35.300e-6844.69Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2CRM11.072e-6341.67UBX domain-containing protein isoform 1 OS=Schisto... [more]
Q17M313.688e-6237.93AAEL001154-PA OS=Aedes aegypti OX=7159 GN=AAEL0011... [more]
A0A182GYK14.772e-6238.87Uncharacterized protein OS=Aedes albopictus OX=716... [more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ubxn12.772e-3528.94UBX domain protein 1 [Source:NCBI gene;Acc:1030368... [more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
UBXN43.037e-1228.00UBX domain protein 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSPMAT00000008603.13.771e-831.25pep scaffold:Pmarinus_7.0:GL480855:23890:24793:-1 ... [more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO381139.689e-1829.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425051.317e-1227.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UBX domain containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ubxn12.191e-3932.04UBX domain protein 1 [Source:NCBI gene;Acc:1011586... [more]
ubxn12.191e-3932.04UBX domain protein 1 [Source:NCBI gene;Acc:1011586... [more]
back to top
BLAST of UBX domain containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028619.10.000e+099.68SMESG000028619.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022643 ID=SMED30022643|Name=UBX domain containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1130bp
CTTGATTCGAAAAAAAGATTGGAAAAGATTGTGATTGTTTTAATAACCTC
TATATAATAAATTAGTAACTAAATTAGTGATAATTTATTATTTTAAATTT
ATTTGATTTTCTTTATATAACTTAAGCAATATTTTCTACGTATGGAATCA
GATTATGATCAGTTAATTGATATGGGATTTGATAAATCCAAAGTTGAAAA
AGCGTTGGAATCAACTAATAATGGTGGACTTCAAGCAGCCATAGACTGGT
TAGTGTCACATGAAGATGTCGATGTGCATGTTGATGATATGGATATACCT
CCTCCAGAAAATGCCAGTGGTATTGATGAAGGTGATAAACAAAGTCTTAC
AGCTAAATCAATGAAATGTGAAGATTGTGGCAAGTTATTACTTCGAGAAA
CGGACGTTCAATTTCACGCTACTAAAACTGGTCATATGAATTTCTCTGAA
AGTGTCGAAGAAATCAAACCACTAACTGAAGAAGAAAAGAGAATTCAAAT
GGAAAAGCTACAAGAGAAATTGAAAACGAAACGTCTTGAACGAGAAGCAC
AGGATGCCAAAGAATCATTACAACGTGAAAGATACAGGCGACAACAAGGT
AAAACAATAATAGATGCCAAAACGAAATTTGAGGAGGATGAATTACGAAG
GCTAGCTGACCAAAAACGCAGAGAAAAAGAAGAAGATCGTCTGTATAGAG
AGAAACTGAAAAATCAGATTGCCTTAGATCGCGAGGCCAAGAAAATGCAA
TTACCTAGTGAAAACGTTTCTATGGCCAAAGAAATGCCTAAAATGTTACC
GGCTGAAACAAATACTTCTGTTAAAAATTTTGATTCATGCCGAATTCAAG
TTAGACACTCTCAGGGTGCCCAAATTATTGAAACCTTTTCGCCGAATGAT
TCTCTTTTTAAAGTGGCTTTGTGGTTTTCACAAAAAACTGGTTTGTGTAG
TGAATATGAAGTTGAATTCCGAACGACAATGCCGACTAAGACATATGGAG
GAGAATTCATGAGCAGAACTGTCAAGGAATTAGGATTTTGCCCATCAATC
GTTCTTATGGCTGTCATCAAGAAATCTGGATTTTAGGAAATTTTTGTTTT
TACAAAATATTCAAATGTTTGACTTTAAAA
back to top

protein sequence of SMED30022643-orf-1

>SMED30022643-orf-1 ID=SMED30022643-orf-1|Name=SMED30022643-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=315bp
MESDYDQLIDMGFDKSKVEKALESTNNGGLQAAIDWLVSHEDVDVHVDDM
DIPPPENASGIDEGDKQSLTAKSMKCEDCGKLLLRETDVQFHATKTGHMN
FSESVEEIKPLTEEEKRIQMEKLQEKLKTKRLEREAQDAKESLQRERYRR
QQGKTIIDAKTKFEEDELRRLADQKRREKEEDRLYREKLKNQIALDREAK
KMQLPSENVSMAKEMPKMLPAETNTSVKNFDSCRIQVRHSQGAQIIETFS
PNDSLFKVALWFSQKTGLCSEYEVEFRTTMPTKTYGGEFMSRTVKELGFC
PSIVLMAVIKKSGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR015940UBA
IPR001012UBX_dom
IPR007087Znf_C2H2
IPR029071Ubiquitin-like_domsf
IPR009060UBA-like_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 113..149
NoneNo IPR availableCOILSCoilCoilcoord: 161..192
NoneNo IPR availableGENE3DG3DSA:1.10.8.10coord: 5..42
e-value: 1.7E-13
score: 52.3
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 223..308
e-value: 2.4E-15
score: 58.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..150
NoneNo IPR availablePANTHERPTHR46340FAMILY NOT NAMEDcoord: 1..307
NoneNo IPR availableCDDcd01772UBX_UBXN1coord: 228..306
e-value: 1.5831E-13
score: 63.1007
IPR015940Ubiquitin-associated domainSMARTSM00165uba_6coord: 1..39
e-value: 8.9E-5
score: 31.9
IPR015940Ubiquitin-associated domainPFAMPF00627UBAcoord: 3..37
e-value: 5.1E-10
score: 39.1
IPR015940Ubiquitin-associated domainPROSITEPS50030UBAcoord: 1..40
score: 13.366
IPR001012UBX domainPFAMPF00789UBXcoord: 231..305
e-value: 3.2E-5
score: 24.0
IPR001012UBX domainPROSITEPS50033UBXcoord: 228..307
score: 12.246
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 76..98
IPR009060UBA-like superfamilySUPERFAMILYSSF46934UBA-likecoord: 6..44
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 178..306