G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30022628
Length (bp)786
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30022628) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30022628) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30022628) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30022628) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022628

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 2 cellSMED30022628SMESG000060403.1 SMED30022628smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30022628SMESG000060403.1 SMED30022628smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30022628SMESG000060403.1 SMED30022628smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30022628SMESG000060403.1 SMED30022628smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30022628SMESG000060403.1 dd_Smed_v4_361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022628SMESG000060403.1 dd_Smed_v4_361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022628SMESG000060403.1 dd_Smed_v4_361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022628SMESG000060403.1 dd_Smed_v4_361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022628SMESG000060403.1 dd_Smed_v4_361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022628SMESG000060403.1 Contig39263newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022628SMESG000060403.1 Contig39263uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30022628SMESG000060403.1 dd_Smed_v6_361_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022628SMESG000060403.1 dd_Smed_v6_361_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30022628SMESG000060403.1 dd_Smed_v6_361_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022628SMESG000060403.1 dd_Smed_v4_361_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 56.9954 bits (136), Expect = 5.668e-10
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDF 427
             + +WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG +V           +R+  R R  IPGS C+D+
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTSV----------AMRTLYRTRYGIPGSICDDY 88          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 56.9954 bits (136), Expect = 5.668e-10
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDF 427
             + +WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG +V           +R+  R R  IPGS C+D+
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTSV----------AMRTLYRTRYGIPGSICDDY 88          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 56.9954 bits (136), Expect = 5.668e-10
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDF 427
             + +WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG +V           +R+  R R  IPGS C+D+
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTSV----------AMRTLYRTRYGIPGSICDDY 88          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 56.9954 bits (136), Expect = 5.668e-10
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDF 427
             + +WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG +V           +R+  R R  IPGS C+D+
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTSV----------AMRTLYRTRYGIPGSICDDY 88          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 53.9138 bits (128), Expect = 5.552e-9
Identity = 32/81 (39.51%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFCPCYT-VGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCV 433
             + +WQ  LC CF DCG+CL   F  C+T +G    A    CCLCG          T   +R+  R R  IPGS C+D+ V
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG----------TTVAMRTLYRTRYGIPGSICDDYMV 87          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 53.9138 bits (128), Expect = 5.552e-9
Identity = 32/81 (39.51%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFCPCYT-VGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCV 433
             + +WQ  LC CF DCG+CL   F  C+T +G    A    CCLCG          T   +R+  R R  IPGS C+D+ V
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG----------TTVAMRTLYRTRYGIPGSICDDYMV 87          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 53.9138 bits (128), Expect = 5.552e-9
Identity = 32/81 (39.51%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFCPCYT-VGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCV 433
             + +WQ  LC CF DCG+CL   F  C+T +G    A    CCLCG          T   +R+  R R  IPGS C+D+ V
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG----------TTVAMRTLYRTRYGIPGSICDDYMV 87          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NZF1|PLAC8_HUMAN (Placenta-specific gene 8 protein OS=Homo sapiens OX=9606 GN=PLAC8 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.722e-9
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDF 427
             + +WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG +V           +R+  R R  IPGS C+D+
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTSV----------AMRTLYRTRYGIPGSICDDY 88          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5REK4|PLAC8_PONAB (Placenta-specific gene 8 protein OS=Pongo abelii OX=9601 GN=PLAC8 PE=3 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.040e-9
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDF 427
             + +WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG +V           +R+  R R  IPGS C+D+
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTSV----------AMRTLYRTRYGIPGSICDDY 88          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3ZCB2|PLAC8_BOVIN (Placenta-specific gene 8 protein OS=Bos taurus OX=9913 GN=PLAC8 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.111e-8
Identity = 33/81 (40.74%), Postives = 42/81 (51.85%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCV 433
             + +WQ GLC CF DCG+CL   FC  C    V ++     CCLCG +V           +R+  R R  IPGS C+DF V
Sbjct:   23 QNSNWQTGLCDCFSDCGVCLCGTFCFTCLACQVASDM--NECCLCGTSV----------AMRTLYRTRYGIPGSICDDFMV 91          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JI48|PLAC8_MOUSE (Placenta-specific gene 8 protein OS=Mus musculus OX=10090 GN=Plac8 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.884e-8
Identity = 32/81 (39.51%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  194 HDYDWQHGLCSCFDDCGLCLVAFFCPCYT-VGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCV 433
             + +WQ  LC CF DCG+CL   F  C+T +G    A    CCLCG          T   +R+  R R  IPGS C+D+ V
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG----------TTVAMRTLYRTRYGIPGSICDDYMV 87          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|D9HP23|CNR7_MAIZE (Cell number regulator 7 OS=Zea mays OX=4577 GN=CNR7 PE=2 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 9.513e-7
Identity = 28/55 (50.91%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAV--GENCCLCGFAVLTPAACFT 361
             W  GLC+CFDDCGLC +  +CPC T G  AE V  G   C    A+ T  ACFT
Sbjct:   39 QWSSGLCACFDDCGLCCMTCWCPCVTFGRIAEVVDRGATSCAAAGAIYTLLACFT 93          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267H0G2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011900g1 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.049e-23
Identity = 42/78 (53.85%), Postives = 58/78 (74.36%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVF 436
            ++QHGLC C DDC LC++ +FCPCYT G +AEAVG +CCLCG  ++    C   P+IR  IR+RQ I GS+C+D+C++
Sbjct:    7 EFQHGLCGCLDDCSLCIITYFCPCYTFGRNAEAVGSSCCLCGVGLILGFGCIIGPMIRGKIRERQGIDGSFCKDWCIW 84          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8JKZ3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018606g1 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.435e-23
Identity = 42/78 (53.85%), Postives = 58/78 (74.36%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVF 436
            ++QHGLC C DDC LC++ +FCPCYT G +AEAVG +CCLCG  ++    C   P+IR  IR+RQ I GS+C+D+C++
Sbjct:    7 EFQHGLCGCLDDCSLCIITYFCPCYTFGRNAEAVGSSCCLCGVGLILGFGCIIGPMIRGKIRERQGIDGSFCKDWCIW 84          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267EXF1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011533g1 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.297e-23
Identity = 41/78 (52.56%), Postives = 58/78 (74.36%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVF 436
            ++QHGLC C DDC +C++ +FCPCYT G +AEAVG +CCLCG  ++    C   P+IR  IR+RQ I GS+C+D+C++
Sbjct:    7 EFQHGLCGCLDDCSICIITYFCPCYTFGRNAEAVGSSCCLCGLGLILGFGCIIGPMIRGKIRERQGIDGSFCKDWCIW 84          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8HNW2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.067e-21
Identity = 41/78 (52.56%), Postives = 58/78 (74.36%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVF 436
            ++QHGLC C DDC +C++ +FCPCYT G +AEAVG +CCLCG  ++    C   P+IR  IR+RQ I GS+C+D+C++
Sbjct:    7 EFQHGLCGCLDDCSICIITYFCPCYTFGRNAEAVGSSCCLCGLGLILGFGCIIGPMIRGKIRERQGIDGSFCKDWCIW 84          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267GVB5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020929g1 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.201e-20
Identity = 42/77 (54.55%), Postives = 57/77 (74.03%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCV 433
            ++QHGL +CFDDCGLCL+ +  PCYT G++AEAVGENC +CG  ++   +    P+IRS IR+RQ IPGS+  D C+
Sbjct:    3 EFQHGLFACFDDCGLCLITYLVPCYTFGMNAEAVGENCFVCGLGMVCGLSFILGPMIRSKIRERQGIPGSFMADCCI 79          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 46.595 bits (109), Expect = 2.313e-6
Identity = 35/109 (32.11%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCL----CGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVFS--GV----LVVRLRKCIKKPTNSVRI 499
             W  G+C C +D G+C   F+CP   +    +  GE  CL      F  L P   ++   +RS +R+R  I GS C+D CV +  G+     + R  K  ++ TN+ RI
Sbjct:   23 QWSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYS---MRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKYRRQHTNNARI 128          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: plac8.1 (placenta associated 8 [Source:NCBI gene;Acc:103039126])

HSP 1 Score: 45.8246 bits (107), Expect = 2.878e-6
Identity = 31/78 (39.74%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCV 433
            ++Q GL  C DDC  C+  +FC PC    + A  +GE CCLCG  +           IRS  R +  I GS C+DFC+
Sbjct:   21 EFQTGLFECCDDCCTCMYGYFCLPCLGCSI-ASDMGE-CCLCGLGM----------PIRSVYRTKYNIKGSMCKDFCI 86          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: plac8.1 (placenta associated 8 [Source:NCBI gene;Acc:103039126])

HSP 1 Score: 45.4394 bits (106), Expect = 3.157e-6
Identity = 31/78 (39.74%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFC-PCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCV 433
            ++Q GL  C DDC  C+  +FC PC    + A  +GE CCLCG  +           IRS  R +  I GS C+DFC+
Sbjct:   14 EFQTGLFECCDDCCTCMYGYFCLPCLGCSI-ASDMGE-CCLCGLGM----------PIRSVYRTKYNIKGSMCKDFCI 79          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO50068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFB0])

HSP 1 Score: 75.0998 bits (183), Expect = 1.977e-17
Identity = 35/75 (46.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTV-PLIRSYIRDRQKIPGSYCED 424
            DW +GL  CF+DCG CL+ +  PCYT G +AEAVG++C LCG A   P     V   +R  IR++  I GS+  D
Sbjct:    4 DWNNGLFGCFNDCGTCLITYIAPCYTFGKNAEAVGDSCLLCGLAFFVPVVDLIVMSSVRGKIREQHGISGSFIGD 78          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR8])

HSP 1 Score: 66.2402 bits (160), Expect = 4.422e-14
Identity = 33/75 (44.00%), Postives = 42/75 (56.00%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGF-AVLTPAACFTVPLIRSYIRDRQKIPGSYCED 424
             W  G+C CF+D   C + +FCPC   G +AEAVGENC L GF + L     F    IR  IR++  I GS+  D
Sbjct:    2 SWSSGICGCFEDINTCALTYFCPCVVAGKNAEAVGENCFLHGFLSTLGCVGIFCGAKIREKIREKHGIEGSFGND 76          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK5])

HSP 1 Score: 65.4698 bits (158), Expect = 7.413e-14
Identity = 36/102 (35.29%), Postives = 53/102 (51.96%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTP-AACFTVPLIRSYIRDRQKIPGSYCEDF-----CVFSGVLVVRLRKCIKKPTNS 490
             + +GL  CF D  LCL  +  PCYT G  AEAVGE+C +CG  ++ P A  +    IR  +R+++ I GS+  D      C F  ++   L   +K P  +
Sbjct:    3 QFSNGLFGCFSDIPLCLTTYCVPCYTFGKTAEAVGEDCLMCGIVLMVPCANIWFATQIRGKVREQKGIEGSFVNDLLMTWCCGFCSIIQEALEMGVKAPIGN 104          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO42612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W1])

HSP 1 Score: 50.447 bits (119), Expect = 5.281e-8
Identity = 25/76 (32.89%), Postives = 37/76 (48.68%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFC 430
            DW  G+C CFDD G CL+ +FCPC+ +   ++ +GE                 +  +R  +R  Q I GS   D+C
Sbjct:   53 DWHSGMCGCFDDIGSCLLGYFCPCFLLIDVSQRMGEG------CCFPCCCPGALVGLRVKLRVEQNIQGSLINDYC 122          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO42647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V8])

HSP 1 Score: 47.3654 bits (111), Expect = 4.303e-7
Identity = 29/78 (37.18%), Postives = 36/78 (46.15%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGE----NCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCED 424
            DW  GL  C  D G CLV F CPC T+   ++ +GE     CC    A  T         +R+ +R  Q I GS C D
Sbjct:   29 DWSSGLFECTKDIGGCLVTFLCPCVTLCQISQRMGEGLAYGCCCADIAAFT---------LRAKLRTEQNIQGSLCND 97          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028572.1 (cornifelin homolog [Source:NCBI gene;Acc:101172524])

HSP 1 Score: 48.521 bits (114), Expect = 3.635e-7
Identity = 27/80 (33.75%), Postives = 39/80 (48.75%), Query Frame = 2
Query:  185 SDYHDYDWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCED 424
            ++    +W  GLCSCF+DC +C + FFCP       A   GEN CL       P     +  +R+++R    I G+ C D
Sbjct:   17 TNVQTGEWSTGLCSCFNDCLICALGFFCPAGLSCYTAHKYGENFCL----GCVPGG---MTAMRTHMRLTYGIQGTVCND 89          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000060403.1 (SMESG000060403.1)

HSP 1 Score: 182.185 bits (461), Expect = 1.666e-58
Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 2
Query:  176 MSESDYHDYDWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVF 436
            MSESDYHDYDWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVF
Sbjct:    1 MSESDYHDYDWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVF 87          

HSP 2 Score: 60.077 bits (144), Expect = 1.741e-11
Identity = 27/30 (90.00%), Postives = 27/30 (90.00%), Query Frame = 1
Query:  424 FLRVFWCPCCTTAQMHQETYEFSPHSMSRE 513
            F   FWCPCCTTAQMHQETYEFSPHSMSRE
Sbjct:   84 FCVFFWCPCCTTAQMHQETYEFSPHSMSRE 113          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000060415.1 (SMESG000060415.1)

HSP 1 Score: 163.31 bits (412), Expect = 4.643e-51
Identity = 75/87 (86.21%), Postives = 83/87 (95.40%), Query Frame = 2
Query:  176 MSESDYHDYDWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVF 436
            MS+S+YH+Y WQHGLCSCFDDCGLCLV+FFCPCYTVG+DA+AVGE+CCLCGFA +TPAA FTVPLIRSYIRDRQKIPGSY EDFCVF
Sbjct:    1 MSDSEYHEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVF 87          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023846.1 (SMESG000023846.1)

HSP 1 Score: 83.1889 bits (204), Expect = 3.718e-20
Identity = 37/75 (49.33%), Postives = 51/75 (68.00%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDF 427
            +WQHGLC CF DCG CL+++F PCY VG DAEAVG++C LCG   L    C    ++R  +R+++ I G++C D 
Sbjct:    3 EWQHGLCGCFSDCGTCLLSYFVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVG-AIVRKKVREKRGISGNFCFDL 76          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023831.1 (SMESG000023831.1)

HSP 1 Score: 77.0258 bits (188), Expect = 7.277e-18
Identity = 45/107 (42.06%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVFSGVL----VVRLRKCIKKPTNSVRIACRE 511
            DWQ G+C CF D G C++A+F PCY VG+DAE V +NC LC  A L    C T   IR  +R ++ IPG  C D CV S  L    V ++   +K  + +     RE
Sbjct:    3 DWQQGICGCFGDLGTCVLAYFAPCYLVGLDAETVDKNCVLCCIAFLFFPPCITCH-IRGKVRSKRNIPGGSCND-CVVSLFLPCCTVAQMHHEVKHMSGTAMALERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023836.1 (SMESG000023836.1)

HSP 1 Score: 69.707 bits (169), Expect = 4.301e-15
Identity = 33/74 (44.59%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  203 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCED 424
            +WQ G+C CF D G CL+++F PCY +G+DAEAV  +C LCG   +    C  +  +R  IR++Q I G  C D
Sbjct:    3 EWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVISIFFPPCI-ICYVRGKIREKQNIDGGCCTD 75          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PLAC85.668e-1040.51placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC85.668e-1040.51placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC85.668e-1040.51placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC85.668e-1040.51placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Plac85.552e-939.51placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac85.552e-939.51placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac85.552e-939.51placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NZF1|PLAC8_HUMAN2.722e-940.51Placenta-specific gene 8 protein OS=Homo sapiens O... [more]
sp|Q5REK4|PLAC8_PONAB3.040e-940.51Placenta-specific gene 8 protein OS=Pongo abelii O... [more]
sp|Q3ZCB2|PLAC8_BOVIN1.111e-840.74Placenta-specific gene 8 protein OS=Bos taurus OX=... [more]
sp|Q9JI48|PLAC8_MOUSE3.884e-839.51Placenta-specific gene 8 protein OS=Mus musculus O... [more]
sp|D9HP23|CNR7_MAIZE9.513e-750.91Cell number regulator 7 OS=Zea mays OX=4577 GN=CNR... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H0G27.049e-2353.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JKZ37.435e-2353.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EXF19.297e-2352.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HNW24.067e-2152.56G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A267GVB51.201e-2054.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ponzr62.313e-632.11cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
plac8.12.878e-639.74placenta associated 8 [Source:NCBI gene;Acc:103039... [more]
plac8.13.157e-639.74placenta associated 8 [Source:NCBI gene;Acc:103039... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO500681.977e-1746.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447944.422e-1444.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361167.413e-1435.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426125.281e-832.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426474.303e-737.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000028572.13.635e-733.75cornifelin homolog [Source:NCBI gene;Acc:101172524... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060403.11.666e-58100.00SMESG000060403.1[more]
SMESG000060415.14.643e-5186.21SMESG000060415.1[more]
SMESG000023846.13.718e-2049.33SMESG000023846.1[more]
SMESG000023831.17.277e-1842.06SMESG000023831.1[more]
SMESG000023836.14.301e-1544.59SMESG000023836.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022628 ID=SMED30022628|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=786bp
AAATTTGAATATAAAAAAAGTCAGTGCCGAGCGTGTTGTTTTTACAACAT
ATAATTTTCAACTTTGTGTGGTGAATTTTGTTTCCACTCATTTTTGTTTC
ACCTGAATGAGCTTGATATTATTCATCATTTTTTATTTAAACTATATTCA
GTAAATAAAATTGAGATAAATTGAAATGTCTGAATCGGACTATCATGATT
ACGATTGGCAACACGGACTGTGCAGCTGCTTCGATGATTGCGGCCTATGC
TTGGTGGCGTTCTTTTGTCCGTGCTACACAGTTGGTGTAGATGCTGAAGC
GGTTGGAGAGAACTGTTGCCTGTGTGGATTTGCCGTATTGACACCGGCTG
CCTGCTTTACAGTTCCACTAATTAGGAGTTACATTCGAGATCGGCAAAAA
ATTCCTGGCAGCTATTGTGAAGATTTTTGCGTGTTTTCTGGTGTCCTTGT
TGTACGACTGCGCAAATGCATCAAGAAACCTACGAATTCAGTCCGCATAG
CATGTCGAGAGAATAGAATAATAATAATAAATTATTATAATGATAATTGG
CGAGAAATTTTGAAATTTTGCCTGAAATCGTTTTGTTTCAATCTAACATT
TGTTGAAATGTTTTATGTATTTTGACGTGGACAATAGTTAATTTATTTAT
TAATAAGATTTGTTTAAATGTAAGTTAATTTATTTTAATTTAAATCTTTC
TGTAATAACTTTTGCTATTATTTGTCTTGTTGATTTTGAAAGCTTTGAAG
ATTTGTTTTGATAAAACTTTAGTATTTTACAATGGG
back to top

protein sequence of SMED30022628-orf-1

>SMED30022628-orf-1 ID=SMED30022628-orf-1|Name=SMED30022628-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
MSESDYHDYDWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLC
GFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVFSGVLVVRLRKCIK
KPTNSVRIACRENRIIIINYYNDNWREILKFCLKSFCFNLTFVEMFYVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane