Centrosomal protein 350

Overview
NameCentrosomal protein 350
Smed IDSMED30022622
Length (bp)5055
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein 350 (SMED30022622) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein 350 (SMED30022622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein 350 (SMED30022622) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein 350 (SMED30022622) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30022622SMESG000033533.1 dd_Smed_v4_5967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein 350 vs. Ensembl Human
Match: CEP350 (centrosomal protein 350 [Source:HGNC Symbol;Acc:HGNC:24238])

HSP 1 Score: 54.299 bits (129), Expect = 2.106e-6
Identity = 43/145 (29.66%), Postives = 77/145 (53.10%), Query Frame = 1
Query: 4501 TTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQS---KIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            +T   V K+ VF +  EI  EIF+ + +L QP W+    +  N+ Y  ++  + P + D ++  +   V  L + K           KE   ++   K++K+  R+++D VD +L+ +L +EE +W+ YD+ E  VK Q+A+ IF
Sbjct:  429 STSKRVYKQAVFDLTKEIFEEIFAEDPNLNQPVWMKPCRI--NSSY--FRRVKNPNNLDEIKSFIASEVLKLFSLK-----------KEPNHKTDWQKMMKFG-RKKRDRVDHILVQELHEEEAQWVNYDEDELCVKMQLADGIF 557          
BLAST of Centrosomal protein 350 vs. Ensembl Human
Match: CEP350 (centrosomal protein 350 [Source:HGNC Symbol;Acc:HGNC:24238])

HSP 1 Score: 53.9138 bits (128), Expect = 3.161e-6
Identity = 43/145 (29.66%), Postives = 77/145 (53.10%), Query Frame = 1
Query: 4501 TTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQS---KIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            +T   V K+ VF +  EI  EIF+ + +L QP W+    +  N+ Y  ++  + P + D ++  +   V  L + K           KE   ++   K++K+  R+++D VD +L+ +L +EE +W+ YD+ E  VK Q+A+ IF
Sbjct: 1140 STSKRVYKQAVFDLTKEIFEEIFAEDPNLNQPVWMKPCRI--NSSY--FRRVKNPNNLDEIKSFIASEVLKLFSLK-----------KEPNHKTDWQKMMKFG-RKKRDRVDHILVQELHEEEAQWVNYDEDELCVKMQLADGIF 1268          
BLAST of Centrosomal protein 350 vs. Ensembl Human
Match: CEP350 (centrosomal protein 350 [Source:HGNC Symbol;Acc:HGNC:24238])

HSP 1 Score: 53.5286 bits (127), Expect = 5.238e-6
Identity = 43/145 (29.66%), Postives = 77/145 (53.10%), Query Frame = 1
Query: 4501 TTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQS---KIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            +T   V K+ VF +  EI  EIF+ + +L QP W+    +  N+ Y  ++  + P + D ++  +   V  L + K           KE   ++   K++K+  R+++D VD +L+ +L +EE +W+ YD+ E  VK Q+A+ IF
Sbjct: 2965 STSKRVYKQAVFDLTKEIFEEIFAEDPNLNQPVWMKPCRI--NSSY--FRRVKNPNNLDEIKSFIASEVLKLFSLK-----------KEPNHKTDWQKMMKFG-RKKRDRVDHILVQELHEEEAQWVNYDEDELCVKMQLADGIF 3093          
BLAST of Centrosomal protein 350 vs. Ensembl Mouse
Match: Cep350 (centrosomal protein 350 [Source:MGI Symbol;Acc:MGI:1921331])

HSP 1 Score: 54.299 bits (129), Expect = 2.081e-6
Identity = 56/214 (26.17%), Postives = 103/214 (48.13%), Query Frame = 1
Query: 4306 IPLNSENIEPLVESATRYLLEYKKK----HGFIADTAFSDEENELPDLYVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQS---KIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            +P  +E +E LV +A   L ++K+     HG    T F    ++  D+                    +T+R  V K+ VF +  EI  EIF+ + ++ QP W+    +  N+ Y  ++  + P + D ++  +   V  L++ K           KE   ++   K++K+  R+++D VD +L+ +L +EE +W+ YD+ E  VK Q+A+ IF
Sbjct: 2894 VPHTAEEVESLVHNAAEELWKWKELGQDLHGLSLPTTFLGGASKGLDIG-------------------STSR-RVYKQAVFDLTKEIFEEIFAEDPNVNQPVWMKPCRI--NSSY--FRRVKNPNNLDEIKHFITTEVLKLLSLK-----------KEPNHKTDWQKMMKFG-RKKRDRVDHILVQELHEEEAQWVNYDEDELCVKMQLADGIF 3071          
BLAST of Centrosomal protein 350 vs. TrEMBL
Match: gnl|BL_ORD_ID|23908653 (tr|K1PSG8|K1PSG8_CRAGI CAP-Gly domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10015427 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.802e-8
Identity = 45/139 (32.37%), Postives = 72/139 (51.80%), Query Frame = 1
Query: 4513 HVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERV-DVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
             V K+++F +  E+L EI+  E     P W       K      ++G  PP+  D +  IV+E V D+L          G  G+++ +      KW +R++KD VD +L+ +LR+EE EW+ YD+ E  VK Q+ + IF
Sbjct:  995 RVYKKLLFDLTGELLKEIYKNELKEDPPPWQKP----KQRRQKYFRGASPPKGVDTLTPIVQEAVIDML----------GLNGSRKLDRN----KWNVRKKKDHVDNILVQELREEEPEWVNYDNDEIAVKMQLTDNIF 1115          
BLAST of Centrosomal protein 350 vs. TrEMBL
Match: gnl|BL_ORD_ID|21126512 (tr|A0A2T7NM33|A0A2T7NM33_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18044 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.011e-7
Identity = 49/149 (32.89%), Postives = 75/149 (50.34%), Query Frame = 1
Query: 4492 EPTTTRPH-VDKRI---VFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            EPT T  H VD       F +  EIL E++ +EN +  P+W     + K   Y  +KG  PP + D++  +V+      I+   L    G    K A       KW +R++KD VD +L+ +L++EE +WI Y+  E  VK Q+ + IF
Sbjct:  321 EPTQTLSHAVDAPTGIFCFDLTGEILREMYQYENEVEPPAW--QKPVPKRQRY--YKGITPPTTVDVLLPVVQT---AAISILGLNGAVGKMRGKTAN------KWSVRKKKDHVDAVLVKELQEEEADWISYNHDETAVKLQLTDTIF 456          
BLAST of Centrosomal protein 350 vs. TrEMBL
Match: gnl|BL_ORD_ID|23512272 (tr|A0A210PH66|A0A210PH66_MIZYE Centrosome-associated protein 350 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04426 PE=4 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.186e-7
Identity = 46/169 (27.22%), Postives = 80/169 (47.34%), Query Frame = 1
Query: 4423 ELPDLYVDTEPITNE-EEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            E PD Y  TE   N+ +     +FE          +++F    +I+ +I+  E+     +W  +    K      ++G  PP + D+++ IV++ V  ++        D N             +W +R++KD VD +L+ +LR+EE +W+ YDD E  VK Q+ E IF
Sbjct: 2844 EPPDTYYSTEDNNNDVDSKSRRVFE----------KLLFDSTGDIIRDIYKEEDQDTTCAWKQT----KRTRQKYYRGANPPTTIDVLKPIVQKAVIEILGLNGSRKVDKN-------------RWSVRKKKDHVDNILVEELREEEPDWVNYDDDETAVKMQLTEAIF 2985          
BLAST of Centrosomal protein 350 vs. TrEMBL
Match: gnl|BL_ORD_ID|173771053 (tr|A0A3B3BYI6|A0A3B3BYI6_ORYME Centrosomal protein 350 OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.001e-7
Identity = 63/227 (27.75%), Postives = 110/227 (48.46%), Query Frame = 1
Query: 4282 LKEKLSWLIPLNSENIEPLVESATRYLLEYK--KKHGFIADTAFSDEENELPDL-YVDTEPITNEEE-IFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSL-WKGDRPPESFDLVRRIVRERVDVLINQKNLFVTD---GNFGAKEAESQ----SKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            L E+ + ++P ++  +  +V +ATR + E     K G + D+      N  P L Y+  E    E+E + +  +          K+ VF +  EIL +I+S +    QP WV    +  ++IY +   GD                    IN+   FVT      FG K+ ++Q     K++K+  R+++D VD++L+ +L++EE +W+ YD+ E  VK Q+A+ IF
Sbjct: 2656 LPEQPAMVVPHSATEVGKMVHAATREIWEACNLGKAGTLMDSQMP---NPKPSLEYLSEESHKQEQEAVSIRSY----------KQAVFDLTWEILQQIYSEDPVTDQPQWVKPRQVKSSSIYQVKTSGD--------------------INRIQEFVTTEVLKLFGLKQDQNQKTDWQKMLKFG-RKKRDRVDQILVQELQEEEAQWVNYDEDEFSVKMQLADSIF 2848          
BLAST of Centrosomal protein 350 vs. TrEMBL
Match: gnl|BL_ORD_ID|15728133 (tr|R7V3Q2|R7V3Q2_CAPTE CAP-Gly domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226518 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.110e-7
Identity = 53/225 (23.56%), Postives = 102/225 (45.33%), Query Frame = 1
Query: 4261 LDINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEEN---ELPDLYVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            LD+ +  L E+L + +P   E + PL+ +      E ++++G   D+     ++      D   D E  + +                V KR+VF +  E+L +++  E H  +  W       +       +   PP +   ++ ++  RV  ++++ +         AKE     ++  W  R++KD VD++L+ +LR EE +WI YDD E  VK Q+++ +F
Sbjct:  786 LDLRK--LNEELIYAVPNQKEQLVPLIHNTAEVFWE-RRRYGEAWDSTVQPPQDFFDAAEDQGADMESRSKK----------------VYKRMVFDLTAEVLRDLYKDEGHSEESFW----PQFRTQRAWPVRERTPPTTLQALKPVLESRVLKVLHRAD--------PAKEGAPSRRLKTWSSRKKKDHVDQILVQELRHEEPDWINYDDDELAVKMQLSDALF 979          
BLAST of Centrosomal protein 350 vs. Ensembl Nematostella
Match: EDO47207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMU3])

HSP 1 Score: 52.373 bits (124), Expect = 1.362e-7
Identity = 42/145 (28.97%), Postives = 67/145 (46.21%), Query Frame = 1
Query: 4492 EPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            +P        +++VF +  ++  +I   E+   +P W+      K+ IY   +   P    D   ++V+ RV  LI    L     N      ++  K  K      KD VD +LI +LR+EE +W+ YDD E  VKFQ+A+ I 
Sbjct:    2 DPNAASKQSYQKLVFDLTGDVFRDILHEESPPARPLWMKQRRRQKSRIY---RSLTPLRDEDDYLQVVQSRVMNLIG---LGTERPNLETLRRKTPLKAGK------KDAVDAILIQELREEEPQWVDYDDDELAVKFQVADAIL 134          
BLAST of Centrosomal protein 350 vs. Ensembl Medaka
Match: cep350 (centrosomal protein 350 [Source:ZFIN;Acc:ZDB-GENE-030131-6975])

HSP 1 Score: 60.8474 bits (146), Expect = 1.739e-8
Identity = 54/217 (24.88%), Postives = 101/217 (46.54%), Query Frame = 1
Query: 4297 SWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEENELPDL---YVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQ----SKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            + ++P +   +  +V +ATR + E     G     A  D +  +P     Y+  E    E+E         + R +  K+ VF +  EI+ +I++ +    QP WV       ++IY                  V+   D  +  + L +    FG K+ ++Q     K++K+  R+++D VD++L+ +L++EE +W+ YD+ E  VK Q+A+ IF
Sbjct: 2230 AMVVPHSVSEVGKMVHAATREIWEA---CGLGKGGALLDSQTPIPTPSLEYLSDESCKQEQEAV-------SIRSY--KQAVFDLTWEIIQQIYAKDPVTDQPQWVKPRQFKSSSIYQ-----------------VKTSGDEFVTAEILKL----FGLKQDQNQKTDWQKMLKFG-RKKRDRVDQILVQELQEEEAQWVNYDEDELSVKMQLADSIF 2412          
BLAST of Centrosomal protein 350 vs. Ensembl Medaka
Match: cep350 (centrosomal protein 350 [Source:ZFIN;Acc:ZDB-GENE-030131-6975])

HSP 1 Score: 53.9138 bits (128), Expect = 1.961e-6
Identity = 38/138 (27.54%), Postives = 71/138 (51.45%), Query Frame = 1
Query: 4525 RIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQ----SKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIF 4926
            + VF +  EI+ +I++ +    QP WV       ++IY                  V+   D  +  + L +    FG K+ ++Q     K++K+  R+++D VD++L+ +L++EE +W+ YD+ E  VK Q+A+ IF
Sbjct: 2262 QAVFDLTWEIIQQIYAKDPVTDQPQWVKPRQFKSSSIYQ-----------------VKTSGDEFVTAEILKL----FGLKQDQNQKTDWQKMLKFG-RKKRDRVDQILVQELQEEEAQWVNYDEDELSVKMQLADSIF 2377          
BLAST of Centrosomal protein 350 vs. Planmine SMEST
Match: SMESG000033533.1 (SMESG000033533.1)

HSP 1 Score: 2950.61 bits (7648), Expect = 0.000e+0
Identity = 1594/1625 (98.09%), Postives = 1599/1625 (98.40%), Query Frame = 1
Query:   55 MISKESEYLIQIAEEQLERLNKSLYLYQKNSEMESDIXXXXXXXXXXNNFKESSSMNVDINTNVLNLKTDLKPIYKIIKKQKDECSSGSSFKRKLKDNEKKKQHLTMPPPISNPDHIRDWRNGVNLVKKTLGSNNRISQKSPINKSQSTSPCSLKKKQRISTFWNDECNKRICKSPKKDISNSDKTLNNCCSRRTSDKEEIQRYIKNKQKAAREKRLETEMMAKARKENIKASLNNLENHHQNNFLQYLSSKQNYIKPSSEQDYVKSRSMSSLNKTKLVTPIYDELEREGFLEYFDVSNCDHHFISNLTSKYKNGLNSTVDSGIETGEWYRSLTPEKFRSSYERINEHNXXXXXXXXXXXXXXXXXDLRLDKSYKNSKLKTDHYNKLKQKYQEQISAYDASSENEFANENFDKNTASPEFSVVSDEIAKIPKSPLVRMKVDSNDNLDLLQVNLKISENFEKPNEITDRNDKRIIELYENLTKALLTAQIPSKFEDKESERDKLDKISQAVQNFIKTKESIEYSKASSCLSLHSAFNSYQNINDTNCKSKSKLVTITDSNYEKKNSRKVIPXXXXXXXXXXXXXXXXXKTAPNNNHGFPKESIELKIQKENVPEYLSINSEIITNYNVPEPININEYKETLQKREERANELINLTKNLRKESKRVIKLEKKAFEVSKRFIPNIKSDKKSTTDERNSTRVDSRNEESLKFSPISCLKMDPKSTENQQTLKMTYPQFHPSDNANESPQFVKDFQSQSSQSENDXXXXXXXXXXXXXXDQXXXXXXXXXXXXXXXKKKQLVSTLKRRQKEIKRDKIKQKEIVLQKQIDMYDNYLEKLQTTMDQLSSKIXXXXXXXXXXXHTLTGSNCNLTDLDCKKDHVDIQDDFHSSAHFVDNNKNESEMILTINAIPILSKENNETXXXXXXXXXXXXXXXXXXXXXXENNKHIQTNDLDNLSDMVGNYQEEVDNESLNEINKPQSDVENLINFSPPEECSQRNTGEMVYGDVEESNFPNFAKKDHLFDLFFNSNSGDCSTDANRNGNIVLEHDQVSSYLNDLLSKNVEDNESVHDDVLQQLYINANSSDPVETNTVLDALLSTNSLPNIPVTVPNSVNSWIPFSDLDALGSSESKNDQDEKKTPEMVKDIVEICIEEKENAKEYEFSNSSVSVKLVENLXXXXXXXXXXXIDENNFKLFIAKADTIKPVAILVENIYDEEENSGNRIQNAETISIDGSSISEVDSFNNFIEEDSLENANLCRISPKNSDESLYANKTIQPNATSLNIHAENIEESSNHLLKDDIFSFIPEQSLSSCRVDELVDILLNKLILTEIENIKPNLAETEQQKVNTYTPESVVEFQLAPFNDEETDNVPIIQEKGSFFDVLKSEDLWELGDLTIEDSNKVLTLDGPSTLDINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEENELPDLYVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIFH 4929
            MISKESEYLIQIAEEQLERLNKSLYLYQKNSEMESDILSSSLSLSCSNNFKESSSMNVDINTNVLNLKTDLKPIYKIIKKQKDECSSGSSFKRKLKDNEKKKQHLTMPPPISNPDHIRDWRNGVNLVKKTLGSNNRISQKSPINKSQSTSPCSLKKKQRISTFWNDECNKRICKSPKKDISNSDKTLNNCCSRRTSDKEEIQRYIKNKQKAAREKRLETEMMAKARKENIKASLNNLENHHQNNF+QYLSSKQNYIKPSSEQDYVKSRSMSSLNKTKLVTPIYDELEREGFLEYFDVSNCDHHFISNLTSKYKNGLNSTVDSGIETGEWYRSLTPEKFRSSYERINE+NSYLPPPLPPSSKPVSQSDLRLDKSYKNSKLKTDHYNKLKQKYQEQISAYDASSENEFANENFDKNTASPEFSVVSDEIAKIPKSPLVRMKVDSNDNLDLLQVNLKISENFEKPNEITDRNDKRIIELYENLT ALLTAQIPSKFEDKESERDKLDKISQAVQNFIKTKESIEYSKASSCLSLHSAFNSYQNINDTNCKSKSKLVTITDSNYEKKNSRKVIPTELEASEMELELATLSSKTAPNNNHGFPKESIELKIQKENVPEYLSINSEIITNYNVPEPININEYKETLQKREERANELINLTKNLRKESKRVIKLEKKAFEVSKRFIPNIKSDKKSTTDERNSTRVDSRNEESLKFSPISCLKMDPKSTENQQTLKMTYPQFHPSDNANESPQF KDFQSQSSQSENDEITISISEVTTTLTDQSELEARLLALRSEMEKKKQLVSTLKRRQKEIKRDKIKQKEIVLQKQIDMYDNYLEKLQTTMDQLSSKIDDDDGNNSDDSHTLTGSNCNLTDLDCKKDHVDIQDDFHSSAHFVDNNKNESEMILT N IPILSKENNETRDLNRDLILNLRSRSSSLDSLIENNKHIQTNDLDNLSDMVGNYQEEVDNESLNEINKPQSDVENLINFSPPEECSQRNTGEMVYGDVEESNFPNFAKKDHLFDLFFNSNSGDCSTDANRNGNIVLEHDQVSSYLNDLLSKNVEDNESVHDDVLQQLYINANSSDPVETNTVLDALLSTNSLPNIPVTVPNSVNSWIPFSDLDALGSSESKND DEKKTPEMVKDIVEICIEEKENAKE EFSNSSVSVKLVENLS            ++NF       DTIKPVAILVENIYDEEENSGNRIQNAETISIDGSSISEVDSFNNFIEEDSLENANLCRISPKNSDESLYANKTIQPNATSLNIHAENIEESSNHLLKDDIFSFIPEQSLSSCRVDELVDILLNKLILTEIENIKPNLAETEQQKVNTYTPESVVEFQLAPFNDE+TDNVPIIQEKGSFFDVLKSEDLWELGDLTIEDSNKVLTLDGPSTLDINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEENELPD YVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIFH
Sbjct:    1 MISKESEYLIQIAEEQLERLNKSLYLYQKNSEMESDILSSSLSLSCSNNFKESSSMNVDINTNVLNLKTDLKPIYKIIKKQKDECSSGSSFKRKLKDNEKKKQHLTMPPPISNPDHIRDWRNGVNLVKKTLGSNNRISQKSPINKSQSTSPCSLKKKQRISTFWNDECNKRICKSPKKDISNSDKTLNNCCSRRTSDKEEIQRYIKNKQKAAREKRLETEMMAKARKENIKASLNNLENHHQNNFMQYLSSKQNYIKPSSEQDYVKSRSMSSLNKTKLVTPIYDELEREGFLEYFDVSNCDHHFISNLTSKYKNGLNSTVDSGIETGEWYRSLTPEKFRSSYERINEYNSYLPPPLPPSSKPVSQSDLRLDKSYKNSKLKTDHYNKLKQKYQEQISAYDASSENEFANENFDKNTASPEFSVVSDEIAKIPKSPLVRMKVDSNDNLDLLQVNLKISENFEKPNEITDRNDKRIIELYENLTNALLTAQIPSKFEDKESERDKLDKISQAVQNFIKTKESIEYSKASSCLSLHSAFNSYQNINDTNCKSKSKLVTITDSNYEKKNSRKVIPTELEASEMELELATLSSKTAPNNNHGFPKESIELKIQKENVPEYLSINSEIITNYNVPEPININEYKETLQKREERANELINLTKNLRKESKRVIKLEKKAFEVSKRFIPNIKSDKKSTTDERNSTRVDSRNEESLKFSPISCLKMDPKSTENQQTLKMTYPQFHPSDNANESPQFGKDFQSQSSQSENDEITISISEVTTTLTDQSELEARLLALRSEMEKKKQLVSTLKRRQKEIKRDKIKQKEIVLQKQIDMYDNYLEKLQTTMDQLSSKIDDDDGNNSDDSHTLTGSNCNLTDLDCKKDHVDIQDDFHSSAHFVDNNKNESEMILTTNVIPILSKENNETRDLNRDLILNLRSRSSSLDSLIENNKHIQTNDLDNLSDMVGNYQEEVDNESLNEINKPQSDVENLINFSPPEECSQRNTGEMVYGDVEESNFPNFAKKDHLFDLFFNSNSGDCSTDANRNGNIVLEHDQVSSYLNDLLSKNVEDNESVHDDVLQQLYINANSSDPVETNTVLDALLSTNSLPNIPVTVPNSVNSWIPFSDLDALGSSESKNDHDEKKTPEMVKDIVEICIEEKENAKEDEFSNSSVSVKLVENLS------------DSNF------TDTIKPVAILVENIYDEEENSGNRIQNAETISIDGSSISEVDSFNNFIEEDSLENANLCRISPKNSDESLYANKTIQPNATSLNIHAENIEESSNHLLKDDIFSFIPEQSLSSCRVDELVDILLNKLILTEIENIKPNLAETEQQKVNTYTPESVVEFQLAPFNDEDTDNVPIIQEKGSFFDVLKSEDLWELGDLTIEDSNKVLTLDGPSTLDINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEENELPDWYVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIFH 1607          
BLAST of Centrosomal protein 350 vs. Planmine SMEST
Match: SMESG000033533.1 (SMESG000033533.1)

HSP 1 Score: 2929.43 bits (7593), Expect = 0.000e+0
Identity = 1576/1625 (96.98%), Postives = 1582/1625 (97.35%), Query Frame = 1
Query:   55 MISKESEYLIQIAEEQLERLNKSLYLYQKNSEMESDIXXXXXXXXXXNNFKESSSMNVDINTNVLNLKTDLKPIYKIIKKQKDECSSGSSFKRKLKDNEKKKQHLTMPPPISNPDHIRDWRNGVNLVKKTLGSNNRISQKSPINKSQSTSPCSLKKKQRISTFWNDECNKRICKSPKKDISNSDKTLNNCCSRRTSDKEEIQRYIKNKQKAAREKRLETEMMAKARKENIKASLNNLENHHQNNFLQYLSSKQNYIKPSSEQDYVKSRSMSSLNKTKLVTPIYDELEREGFLEYFDVSNCDHHFISNLTSKYKNGLNSTVDSGIETGEWYRSLTPEKFRSSYERINEHNXXXXXXXXXXXXXXXXXDLRLDKSYKNSKLKTDHYNKLKQKYQEQISAYDASSENEFANENFDKNTASPEFSVVSDEIAKIPKSPLVRMKVDSNDNLDLLQVNLKISENFEKPNEITDRNDKRIIELYENLTKALLTAQIPSKFEDKESERDKLDKISQAVQNFIKTKESIEYSKASSCLSLHSAFNSYQNINDTNCKSKSKLVTITDSNYEKKNSRKVIPXXXXXXXXXXXXXXXXXKTAPNNNHGFPKESIELKIQKENVPEYLSINSEIITNYNVPEPININEYKETLQKREERANELINLTKNLRKESKRVIKLEKKAFEVSKRFIPNIKSDKKSTTDERNSTRVDSRNEESLKFSPISCLKMDPKSTENQQTLKMTYPQFHPSDNANESPQFVKDFQSQSSQSENDXXXXXXXXXXXXXXDQXXXXXXXXXXXXXXXKKKQLVSTLKRRQKEIKRDKIKQKEIVLQKQIDMYDNYLEKLQTTMDQLSSKIXXXXXXXXXXXHTLTGSNCNLTDLDCKKDHVDIQDDFHSSAHFVDNNKNESEMILTINAIPILSKENNETXXXXXXXXXXXXXXXXXXXXXXENNKHIQTNDLDNLSDMVGNYQEEVDNESLNEINKPQSDVENLINFSPPEECSQRNTGEMVYGDVEESNFPNFAKKDHLFDLFFNSNSGDCSTDANRNGNIVLEHDQVSSYLNDLLSKNVEDNESVHDDVLQQLYINANSSDPVETNTVLDALLSTNSLPNIPVTVPNSVNSWIPFSDLDALGSSESKNDQDEKKTPEMVKDIVEICIEEKENAKEYEFSNSSVSVKLVENLXXXXXXXXXXXIDENNFKLFIAKADTIKPVAILVENIYDEEENSGNRIQNAETISIDGSSISEVDSFNNFIEEDSLENANLCRISPKNSDESLYANKTIQPNATSLNIHAENIEESSNHLLKDDIFSFIPEQSLSSCRVDELVDILLNKLILTEIENIKPNLAETEQQKVNTYTPESVVEFQLAPFNDEETDNVPIIQEKGSFFDVLKSEDLWELGDLTIEDSNKVLTLDGPSTLDINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEENELPDLYVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIFH 4929
            MISKESEYLIQIAEEQLERLNKSLYLYQKNSEME                 +SSSMNVDINTNVLNLKTDLKPIYKIIKKQKDECSSGSSFKRKLKDNEKKKQHLTMPPPISNPDHIRDWRNGVNLVKKTLGSNNRISQKSPINKSQSTSPCSLKKKQRISTFWNDECNKRICKSPKKDISNSDKTLNNCCSRRTSDKEEIQRYIKNKQKAAREKRLETEMMAKARKENIKASLNNLENHHQNNF+QYLSSKQNYIKPSSEQDYVKSRSMSSLNKTKLVTPIYDELEREGFLEYFDVSNCDHHFISNLTSKYKNGLNSTVDSGIETGEWYRSLTPEKFRSSYERINE+NSYLPPPLPPSSKPVSQSDLRLDKSYKNSKLKTDHYNKLKQKYQEQISAYDASSENEFANENFDKNTASPEFSVVSDEIAKIPKSPLVRMKVDSNDNLDLLQVNLKISENFEKPNEITDRNDKRIIELYENLT ALLTAQIPSKFEDKESERDKLDKISQAVQNFIKTKESIEYSKASSCLSLHSAFNSYQNINDTNCKSKSKLVTITDSNYEKKNSRKVIPTELEASEMELELATLSSKTAPNNNHGFPKESIELKIQKENVPEYLSINSEIITNYNVPEPININEYKETLQKREERANELINLTKNLRKESKRVIKLEKKAFEVSKRFIPNIKSDKKSTTDERNSTRVDSRNEESLKFSPISCLKMDPKSTENQQTLKMTYPQFHPSDNANESPQF KDFQSQSSQSENDEITISISEVTTTLTDQSELEARLLALRSEMEKKKQLVSTLKRRQKEIKRDKIKQKEIVLQKQIDMYDNYLEKLQTTMDQLSSKIDDDDGNNSDDSHTLTGSNCNLTDLDCKKDHVDIQDDFHSSAHFVDNNKNESEMILT N IPILSKENNETRDLNRDLILNLRSRSSSLDSLIENNKHIQTNDLDNLSDMVGNYQEEVDNESLNEINKPQSDVENLINFSPPEECSQRNTGEMVYGDVEESNFPNFAKKDHLFDLFFNSNSGDCSTDANRNGNIVLEHDQVSSYLNDLLSKNVEDNESVHDDVLQQLYINANSSDPVETNTVLDALLSTNSLPNIPVTVPNSVNSWIPFSDLDALGSSESKND DEKKTPEMVKDIVEICIEEKENAKE EFSNSSVSVKLVENLS            ++NF       DTIKPVAILVENIYDEEENSGNRIQNAETISIDGSSISEVDSFNNFIEEDSLENANLCRISPKNSDESLYANKTIQPNATSLNIHAENIEESSNHLLKDDIFSFIPEQSLSSCRVDELVDILLNKLILTEIENIKPNLAETEQQKVNTYTPESVVEFQLAPFNDE+TDNVPIIQEKGSFFDVLKSEDLWELGDLTIEDSNKVLTLDGPSTLDINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEENELPD YVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIFH
Sbjct:    1 MISKESEYLIQIAEEQLERLNKSLYLYQKNSEME-----------------KSSSMNVDINTNVLNLKTDLKPIYKIIKKQKDECSSGSSFKRKLKDNEKKKQHLTMPPPISNPDHIRDWRNGVNLVKKTLGSNNRISQKSPINKSQSTSPCSLKKKQRISTFWNDECNKRICKSPKKDISNSDKTLNNCCSRRTSDKEEIQRYIKNKQKAAREKRLETEMMAKARKENIKASLNNLENHHQNNFMQYLSSKQNYIKPSSEQDYVKSRSMSSLNKTKLVTPIYDELEREGFLEYFDVSNCDHHFISNLTSKYKNGLNSTVDSGIETGEWYRSLTPEKFRSSYERINEYNSYLPPPLPPSSKPVSQSDLRLDKSYKNSKLKTDHYNKLKQKYQEQISAYDASSENEFANENFDKNTASPEFSVVSDEIAKIPKSPLVRMKVDSNDNLDLLQVNLKISENFEKPNEITDRNDKRIIELYENLTNALLTAQIPSKFEDKESERDKLDKISQAVQNFIKTKESIEYSKASSCLSLHSAFNSYQNINDTNCKSKSKLVTITDSNYEKKNSRKVIPTELEASEMELELATLSSKTAPNNNHGFPKESIELKIQKENVPEYLSINSEIITNYNVPEPININEYKETLQKREERANELINLTKNLRKESKRVIKLEKKAFEVSKRFIPNIKSDKKSTTDERNSTRVDSRNEESLKFSPISCLKMDPKSTENQQTLKMTYPQFHPSDNANESPQFGKDFQSQSSQSENDEITISISEVTTTLTDQSELEARLLALRSEMEKKKQLVSTLKRRQKEIKRDKIKQKEIVLQKQIDMYDNYLEKLQTTMDQLSSKIDDDDGNNSDDSHTLTGSNCNLTDLDCKKDHVDIQDDFHSSAHFVDNNKNESEMILTTNVIPILSKENNETRDLNRDLILNLRSRSSSLDSLIENNKHIQTNDLDNLSDMVGNYQEEVDNESLNEINKPQSDVENLINFSPPEECSQRNTGEMVYGDVEESNFPNFAKKDHLFDLFFNSNSGDCSTDANRNGNIVLEHDQVSSYLNDLLSKNVEDNESVHDDVLQQLYINANSSDPVETNTVLDALLSTNSLPNIPVTVPNSVNSWIPFSDLDALGSSESKNDHDEKKTPEMVKDIVEICIEEKENAKEDEFSNSSVSVKLVENLS------------DSNF------TDTIKPVAILVENIYDEEENSGNRIQNAETISIDGSSISEVDSFNNFIEEDSLENANLCRISPKNSDESLYANKTIQPNATSLNIHAENIEESSNHLLKDDIFSFIPEQSLSSCRVDELVDILLNKLILTEIENIKPNLAETEQQKVNTYTPESVVEFQLAPFNDEDTDNVPIIQEKGSFFDVLKSEDLWELGDLTIEDSNKVLTLDGPSTLDINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEENELPDWYVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEIFH 1590          
BLAST of Centrosomal protein 350 vs. Planmine SMEST
Match: SMESG000026378.1 (SMESG000026378.1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.927e-13
Identity = 64/230 (27.83%), Postives = 109/230 (47.39%), Query Frame = 1
Query: 4264 DINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTAFSDEENELPDLYVDTEPITNEEEIFVT--LFEPTTTR------PHVDKRIVFHIVLEILLEIFSFENHLCQPSWVHSS-AMLKNNIYSLWKGDRPPESFDLVRRIVRERVDVLINQKNLFVTDGNFGA-KEAESQSKIIKWCIRQQKDDVDKLLINDLRKEENEWIYYDDAEEEVKFQIAEEI 4923
            D+  DLL +    LIP   ENI PL++ A   L   ++        AF+     +P  +++      +  I+ T  + E   +R      P++ K  VFH+VLEI+  I+  ++ L    W+  +  + KN    LW+G   P S +L+R+IV          K L   +   GA  ++ ++++  +W  +Q  D VD+LLI++   E+  W  YD A E   F + ++I
Sbjct: 1441 DVQYDLLDD----LIPWVDENILPLIDVAIEQLFHARQNRTGTLSEAFAHCCKNIPSRFIEKNSSAEKINIYHTWQVNESLASRNLQVKQPYIPKIAVFHLVLEIMERIYELDDQLDPVPWMEDAFNIFKNRKLILWEGTEAPNSIELLRKIV---------TKQLMSVNILSGAPSKSTNRTRQHRWFHKQTDDIVDRLLIDETLHEDILWQNYDAALETTIFALIDDI 1657          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein 350 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CEP3502.106e-629.66centrosomal protein 350 [Source:HGNC Symbol;Acc:HG... [more]
CEP3503.161e-629.66centrosomal protein 350 [Source:HGNC Symbol;Acc:HG... [more]
CEP3505.238e-629.66centrosomal protein 350 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cep3502.081e-626.17centrosomal protein 350 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Centrosomal protein 350 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 350 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|239086537.802e-832.37tr|K1PSG8|K1PSG8_CRAGI CAP-Gly domain-containing p... [more]
gnl|BL_ORD_ID|211265121.011e-732.89tr|A0A2T7NM33|A0A2T7NM33_POMCA Uncharacterized pro... [more]
gnl|BL_ORD_ID|235122721.186e-727.22tr|A0A210PH66|A0A210PH66_MIZYE Centrosome-associat... [more]
gnl|BL_ORD_ID|1737710533.001e-727.75tr|A0A3B3BYI6|A0A3B3BYI6_ORYME Centrosomal protein... [more]
gnl|BL_ORD_ID|157281333.110e-723.56tr|R7V3Q2|R7V3Q2_CAPTE CAP-Gly domain-containing p... [more]
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO472071.362e-728.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosomal protein 350 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep3501.739e-824.88centrosomal protein 350 [Source:ZFIN;Acc:ZDB-GENE-... [more]
cep3501.961e-627.54centrosomal protein 350 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Centrosomal protein 350 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000033533.10.000e+098.09SMESG000033533.1[more]
SMESG000033533.10.000e+096.98SMESG000033533.1[more]
SMESG000026378.12.927e-1327.83SMESG000026378.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022622 ID=SMED30022622|Name=Centrosomal protein 350|organism=Schmidtea mediterranea sexual|type=transcript|length=5055bp
TCTATATAAATCTTATATGAAACGACTTTTGTCTTATTTTCCATTCACCA
AATTATGATTTCTAAAGAAAGTGAATATTTGATTCAAATTGCCGAAGAGC
AACTTGAAAGATTAAATAAATCATTATATTTATATCAGAAAAACAGCGAA
ATGGAAAGTGATATTTTGAGTTCTTCGTTATCATTAAGTTGTTCTAATAA
TTTTAAAGAGAGCAGCAGCATGAATGTAGATATCAACACAAATGTTCTCA
ATTTGAAAACAGATTTAAAGCCAATTTATAAAATTATCAAAAAGCAAAAA
GATGAATGCTCATCTGGTTCATCGTTTAAAAGAAAACTGAAAGACAATGA
AAAAAAAAAACAGCACCTTACAATGCCCCCTCCAATTTCAAATCCAGACC
ATATCAGAGATTGGAGAAATGGAGTTAACCTCGTCAAGAAAACCCTTGGA
TCTAATAACCGGATTTCCCAAAAATCTCCCATCAACAAAAGCCAGTCGAC
TTCCCCTTGTAGTTTAAAGAAAAAACAAAGAATTTCCACATTTTGGAACG
ATGAATGTAACAAAAGAATTTGTAAATCACCAAAAAAGGATATCTCAAAT
TCTGACAAAACACTTAACAACTGTTGTTCACGAAGGACTTCCGATAAAGA
GGAAATTCAGAGATATATAAAAAATAAGCAAAAAGCTGCCAGAGAAAAAC
GTCTTGAAACCGAGATGATGGCAAAAGCTAGAAAAGAAAATATTAAAGCT
TCTTTAAATAATTTAGAAAACCATCACCAAAATAATTTTTTGCAATATCT
ATCTTCCAAACAAAATTACATAAAACCGAGCAGTGAACAGGATTATGTGA
AAAGTAGGTCGATGTCATCTCTAAATAAAACCAAGTTGGTTACACCGATT
TATGATGAATTAGAACGAGAAGGATTTCTAGAATATTTCGATGTGAGCAA
CTGTGATCATCATTTTATATCTAATTTGACCAGTAAATATAAAAACGGTC
TCAATAGCACAGTTGATTCAGGAATTGAAACTGGTGAATGGTACAGATCA
TTAACTCCTGAAAAATTCCGAAGTTCGTATGAAAGAATCAATGAGCATAA
TTCTTATTTACCACCTCCGTTGCCACCCTCTTCAAAGCCAGTATCACAAT
CAGATCTGAGATTGGATAAAAGTTATAAGAATTCTAAATTGAAAACAGAT
CATTACAACAAACTCAAACAAAAATATCAAGAGCAAATATCAGCATATGA
CGCCAGCAGTGAGAATGAATTCGCAAATGAAAATTTTGATAAAAACACTG
CATCACCAGAATTTTCGGTGGTTTCCGATGAAATCGCTAAAATTCCGAAA
TCTCCTTTGGTTCGAATGAAAGTTGATTCAAATGATAATTTAGATTTATT
ACAAGTGAACCTAAAAATTTCTGAAAATTTCGAAAAACCTAATGAAATAA
CGGATAGAAATGATAAAAGAATAATTGAACTTTATGAAAATCTTACAAAG
GCACTTCTTACGGCCCAAATTCCATCGAAATTTGAAGACAAAGAAAGCGA
AAGAGATAAATTAGATAAAATATCTCAAGCAGTTCAGAATTTTATTAAAA
CAAAGGAATCAATAGAATATAGCAAAGCTTCAAGTTGCTTAAGTTTACAT
TCCGCTTTTAATTCTTATCAAAATATAAACGATACAAATTGTAAATCAAA
ATCCAAATTGGTTACAATAACTGACTCTAACTATGAAAAGAAGAACAGTA
GAAAAGTTATCCCAACAGAATTAGAGGCTTCAGAAATGGAATTGGAATTG
GCGACATTGTCCTCCAAAACAGCACCAAACAATAATCATGGATTCCCTAA
AGAAAGTATTGAATTAAAAATTCAAAAAGAAAATGTTCCAGAATATCTGT
CGATAAATAGTGAAATTATCACAAACTATAATGTTCCAGAGCCGATTAAT
ATTAATGAATATAAAGAAACGTTACAAAAAAGAGAGGAAAGAGCAAATGA
ACTTATTAATTTGACGAAAAACCTACGGAAAGAATCAAAAAGAGTAATTA
AATTAGAAAAGAAAGCGTTTGAAGTAAGTAAAAGATTTATCCCAAATATC
AAATCAGATAAAAAGAGCACAACTGATGAACGAAATAGTACTAGAGTTGA
TTCTAGAAATGAAGAAAGTCTCAAGTTTTCACCAATTTCTTGTTTGAAAA
TGGATCCAAAATCGACGGAAAATCAGCAAACATTGAAAATGACATATCCA
CAATTTCACCCATCCGACAATGCCAATGAGTCGCCACAGTTCGTCAAAGA
CTTTCAGAGTCAATCTTCCCAGTCGGAAAACGATGAAATAACAATTTCAA
TTTCAGAAGTCACAACAACATTGACGGATCAGAGTGAGCTGGAAGCTCGT
CTTCTTGCGCTGCGATCGGAAATGGAAAAGAAAAAGCAGCTCGTTTCGAC
TTTGAAACGACGTCAGAAAGAAATTAAGCGAGATAAAATAAAACAAAAAG
AAATCGTATTACAGAAACAAATCGATATGTATGATAACTATTTAGAAAAA
CTGCAAACAACAATGGATCAACTCAGTAGTAAAATTGATGATGATGATGG
CAATAATAGCGATGATTCGCATACTCTTACCGGTTCAAATTGCAATCTAA
CTGATCTGGATTGTAAAAAGGATCACGTTGATATCCAAGATGATTTTCAT
TCAAGTGCTCACTTTGTAGATAATAATAAAAATGAAAGTGAAATGATTTT
GACCATAAATGCCATTCCGATATTGTCAAAAGAAAATAATGAAACTCGAG
ATCTTAATCGCGATTTGATATTGAATTTGAGGTCGAGGTCGAGCTCACTG
GACTCTTTGATTGAAAACAATAAGCATATACAAACAAATGATTTAGATAA
TTTGTCTGACATGGTAGGGAATTATCAGGAAGAAGTTGATAATGAATCTT
TAAATGAAATAAATAAACCCCAGTCAGATGTAGAGAATCTCATTAATTTT
TCTCCTCCTGAAGAGTGCTCTCAAAGAAATACTGGAGAAATGGTTTACGG
GGATGTTGAAGAATCAAATTTTCCCAACTTTGCCAAAAAAGATCATTTAT
TTGATTTATTTTTTAACTCAAATAGTGGGGACTGCAGTACAGATGCAAAC
CGGAATGGCAATATCGTGTTGGAACACGACCAAGTTTCCAGTTATTTAAA
TGACTTACTGTCCAAAAATGTAGAAGACAATGAATCTGTACATGATGATG
TCTTGCAACAACTATATATTAACGCCAACAGCTCTGACCCAGTCGAGACC
AATACTGTCCTAGATGCTTTGCTGTCAACTAATAGCCTGCCAAATATACC
AGTTACAGTTCCGAACTCCGTAAATAGCTGGATACCATTTTCTGATTTGG
ATGCTCTTGGATCCTCAGAGTCAAAGAATGATCAAGATGAAAAGAAAACA
CCAGAAATGGTTAAGGATATTGTGGAAATATGCATTGAAGAAAAAGAGAA
TGCCAAAGAATATGAATTTTCCAATTCGTCAGTTTCTGTGAAACTCGTTG
AAAACTTGTCCGATTCTAACTTCAGTTCTAGCTCATCCTCAATTGATGAG
AACAACTTCAAACTATTTATTGCTAAAGCTGATACCATCAAGCCTGTGGC
TATATTAGTAGAGAATATATATGACGAAGAAGAAAACTCCGGAAATCGAA
TTCAAAATGCAGAAACAATCTCCATTGACGGATCTTCCATTTCTGAAGTT
GATTCTTTCAATAATTTTATTGAGGAGGATTCTCTTGAAAACGCTAATTT
ATGCAGAATTTCTCCAAAGAACTCAGATGAAAGTTTATATGCCAACAAAA
CTATTCAACCGAATGCTACCTCCTTGAATATTCACGCAGAAAATATCGAA
GAATCTTCGAATCATTTATTGAAAGATGACATATTTAGCTTTATTCCTGA
ACAATCCTTGAGTTCGTGTCGTGTCGATGAACTTGTCGATATTCTTTTAA
ACAAATTAATTCTGACTGAAATAGAAAATATCAAACCAAATCTTGCCGAA
ACTGAACAGCAGAAAGTAAATACCTATACACCAGAATCAGTTGTCGAGTT
TCAGTTGGCTCCATTCAATGATGAAGAGACAGACAATGTGCCTATTATAC
AAGAAAAGGGTTCGTTTTTCGATGTTTTAAAGTCAGAAGACCTATGGGAG
TTGGGTGACTTAACTATAGAAGATTCCAATAAAGTTCTAACTTTGGATGG
ACCGTCTACTTTAGATATAAATAGAGATTTATTAAAAGAAAAGCTTTCGT
GGTTAATTCCATTAAATTCTGAGAACATAGAACCATTAGTTGAATCTGCA
ACAAGATATCTATTAGAATACAAAAAGAAACACGGCTTCATTGCAGATAC
TGCGTTTTCCGATGAAGAAAATGAACTTCCTGATTTGTATGTAGATACAG
AACCTATTACTAATGAAGAAGAAATCTTTGTGACATTATTCGAACCGACA
ACAACCCGGCCACATGTAGATAAAAGAATCGTGTTCCACATAGTATTAGA
AATACTGTTGGAAATATTTTCATTCGAAAACCATTTGTGCCAGCCTTCAT
GGGTACATTCGTCGGCCATGCTGAAAAACAATATCTACTCACTATGGAAA
GGTGATAGGCCTCCAGAGTCATTTGATCTAGTCAGGCGAATAGTTCGCGA
ACGCGTAGACGTCTTAATTAATCAGAAAAACTTATTTGTTACCGATGGGA
ATTTCGGTGCGAAAGAAGCTGAGAGCCAGTCAAAAATCATTAAATGGTGC
ATACGTCAACAGAAGGATGATGTGGACAAATTATTAATTAATGATTTACG
CAAGGAAGAGAATGAATGGATTTATTACGACGACGCTGAAGAGGAGGTCA
AATTTCAGATAGCCGAGGAGATTTTTCACATTATGATTATTGATACTATT
TCTTGGATCAAGTCAATTTCAGACATTAAATGAAACTGCTGAAAATTTTT
TTTAAGTATTTTGAATGCTGTGTTTTAAATGACTGAAGTTGTGATATAAA
ATACA
back to top

protein sequence of SMED30022622-orf-1

>SMED30022622-orf-1 ID=SMED30022622-orf-1|Name=SMED30022622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1643bp
MISKESEYLIQIAEEQLERLNKSLYLYQKNSEMESDILSSSLSLSCSNNF
KESSSMNVDINTNVLNLKTDLKPIYKIIKKQKDECSSGSSFKRKLKDNEK
KKQHLTMPPPISNPDHIRDWRNGVNLVKKTLGSNNRISQKSPINKSQSTS
PCSLKKKQRISTFWNDECNKRICKSPKKDISNSDKTLNNCCSRRTSDKEE
IQRYIKNKQKAAREKRLETEMMAKARKENIKASLNNLENHHQNNFLQYLS
SKQNYIKPSSEQDYVKSRSMSSLNKTKLVTPIYDELEREGFLEYFDVSNC
DHHFISNLTSKYKNGLNSTVDSGIETGEWYRSLTPEKFRSSYERINEHNS
YLPPPLPPSSKPVSQSDLRLDKSYKNSKLKTDHYNKLKQKYQEQISAYDA
SSENEFANENFDKNTASPEFSVVSDEIAKIPKSPLVRMKVDSNDNLDLLQ
VNLKISENFEKPNEITDRNDKRIIELYENLTKALLTAQIPSKFEDKESER
DKLDKISQAVQNFIKTKESIEYSKASSCLSLHSAFNSYQNINDTNCKSKS
KLVTITDSNYEKKNSRKVIPTELEASEMELELATLSSKTAPNNNHGFPKE
SIELKIQKENVPEYLSINSEIITNYNVPEPININEYKETLQKREERANEL
INLTKNLRKESKRVIKLEKKAFEVSKRFIPNIKSDKKSTTDERNSTRVDS
RNEESLKFSPISCLKMDPKSTENQQTLKMTYPQFHPSDNANESPQFVKDF
QSQSSQSENDEITISISEVTTTLTDQSELEARLLALRSEMEKKKQLVSTL
KRRQKEIKRDKIKQKEIVLQKQIDMYDNYLEKLQTTMDQLSSKIDDDDGN
NSDDSHTLTGSNCNLTDLDCKKDHVDIQDDFHSSAHFVDNNKNESEMILT
INAIPILSKENNETRDLNRDLILNLRSRSSSLDSLIENNKHIQTNDLDNL
SDMVGNYQEEVDNESLNEINKPQSDVENLINFSPPEECSQRNTGEMVYGD
VEESNFPNFAKKDHLFDLFFNSNSGDCSTDANRNGNIVLEHDQVSSYLND
LLSKNVEDNESVHDDVLQQLYINANSSDPVETNTVLDALLSTNSLPNIPV
TVPNSVNSWIPFSDLDALGSSESKNDQDEKKTPEMVKDIVEICIEEKENA
KEYEFSNSSVSVKLVENLSDSNFSSSSSSIDENNFKLFIAKADTIKPVAI
LVENIYDEEENSGNRIQNAETISIDGSSISEVDSFNNFIEEDSLENANLC
RISPKNSDESLYANKTIQPNATSLNIHAENIEESSNHLLKDDIFSFIPEQ
SLSSCRVDELVDILLNKLILTEIENIKPNLAETEQQKVNTYTPESVVEFQ
LAPFNDEETDNVPIIQEKGSFFDVLKSEDLWELGDLTIEDSNKVLTLDGP
STLDINRDLLKEKLSWLIPLNSENIEPLVESATRYLLEYKKKHGFIADTA
FSDEENELPDLYVDTEPITNEEEIFVTLFEPTTTRPHVDKRIVFHIVLEI
LLEIFSFENHLCQPSWVHSSAMLKNNIYSLWKGDRPPESFDLVRRIVRER
VDVLINQKNLFVTDGNFGAKEAESQSKIIKWCIRQQKDDVDKLLINDLRK
EENEWIYYDDAEEEVKFQIAEEIFHIMIIDTISWIKSISDIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
Vocabulary: biological process
TermDefinition
GO:0034453microtubule anchoring