T-complex protein 1 subunit alpha

Overview
NameT-complex protein 1 subunit alpha
Smed IDSMED30022614
Length (bp)1962
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of T-complex protein 1 subunit alpha (SMED30022614) t-SNE clustered cells

Violin plots show distribution of expression levels for T-complex protein 1 subunit alpha (SMED30022614) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of T-complex protein 1 subunit alpha (SMED30022614) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for T-complex protein 1 subunit alpha (SMED30022614) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022614

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30022614h1SMcG0002864 Contig49594newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022614h1SMcG0002864 Contig49594uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30022614h1SMcG0002864 dd_Smed_v4_1025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022614h1SMcG0002864 dd_Smed_v4_1025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022614h1SMcG0002864 dd_Smed_v4_1025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022614h1SMcG0002864 dd_Smed_v4_1025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30022614h1SMcG0002863 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30022614h1SMcG0002863 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30022614h1SMcG0002863 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30022614h1SMcG0002863 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
head regionSMED30022614h1SMcG0002863 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogonial stem cellSMED30022614h1SMcG0002863 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30022614h1SMcG0002864 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30022614h1SMcG0002864 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30022614h1SMcG0002864 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30022614h1SMcG0002864 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
head regionSMED30022614h1SMcG0002864 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogonial stem cellSMED30022614h1SMcG0002864 MF669561.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
epidermisSMED30022614h1SMcG0002864 dd_Smed_v6_1025_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30022614h1SMcG0002864 dd_Smed_v6_1025_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Human
Match: TCP1 (t-complex 1 [Source:HGNC Symbol;Acc:HGNC:11655])

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 374/543 (68.88%), Postives = 462/543 (85.08%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD 1748
            L++ G+R+TG+ +R QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT++ISGYR+AC+EA +Y+  NL ++ D+LG++C+ +AAKTSMSSK+IGI+ DFFANM V+A +A+K +D +G  RYP+ ++N+LKAHG+S  ESMLI GYALNC + SQ MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFVEA AMAVRR  K DLKRIAKA+G ++  +LA ++GEE F+ A LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIP  LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL+N    +NK+AG+FEP++ K+KSLKFATEAAITILRIDD++KL  E K  K G  +D
Sbjct:    5 LSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYED 547          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Human
Match: TCP1 (t-complex 1 [Source:HGNC Symbol;Acc:HGNC:11655])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 301/426 (70.66%), Postives = 370/426 (86.85%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTI 1397
            L++ G+R+TG+ +R QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT++ISGYR+AC+EA +Y+  NL ++ D+LG++C+ +AAKTSMSSK+IGI+ DFFANM V+A +A+K +D +G  RYP+ ++N+LKAHG+S  ESMLI GYALNC + SQ MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFVEA AMAVRR  K DLKRIAKA+G ++  +LA ++GEE F+ A LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++
Sbjct:    5 LSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSM 430          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Human
Match: TCP1 (t-complex 1 [Source:HGNC Symbol;Acc:HGNC:11655])

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 267/392 (68.11%), Postives = 325/392 (82.91%), Query Frame = 3
Query:  573 MSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD 1748
            MSSK+IGI+ DFFANM V+A +A+K +D +G  RYP+ ++N+LKAHG+S  ESMLI GYALNC + SQ MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFVEA AMAVRR  K DLKRIAKA+G ++  +LA ++GEE F+ A LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIP  LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL+N    +NK+AG+FEP++ K+KSLKFATEAAITILRIDD++KL  E K  K G  +D
Sbjct:    1 MSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYED 392          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Human
Match: TCP1 (t-complex 1 [Source:HGNC Symbol;Acc:HGNC:11655])

HSP 1 Score: 442.58 bits (1137), Expect = 1.818e-151
Identity = 225/323 (69.66%), Postives = 270/323 (83.59%), Query Frame = 3
Query:  780 MPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD 1748
            MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFVEA AMAVRR  K DLKRIAKA+G ++  +LA ++GEE F+ A LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIP  LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL+N    +NK+AG+FEP++ K+KSLKFATEAAITILRIDD++KL  E K  K G  +D
Sbjct:    1 MPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYED 323          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Human
Match: CCT7 (chaperonin containing TCP1 subunit 7 [Source:HGNC Symbol;Acc:HGNC:1622])

HSP 1 Score: 310.071 bits (793), Expect = 4.841e-97
Identity = 192/519 (36.99%), Postives = 293/519 (56.45%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGK----ECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            N+ A Q IA  V+T+LGP G+DK++VD  G+ TISNDGATILKLL+V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK  +  +++ +HP  II  +R A + A   ++  + + V K  K    + +   A T++SSKLI     FFA M V+A M +            +K I + K  G ++++S L+ G A   T +    +  P+     KIALL+  L+    K   ++ V   E  + I   E +I  +K+EKI  +GA V+L+   I D+  +YF +       R  + DLKR   A GGS+  S+  +  +       LG  +   + +I  +      GC      + ILRG  + +++E ERS+HD+  +V+R +++ SVV GGGA E  L  YL  Y+ TI  ++Q+ I  +AKAL +IP+QL  NA  D+T ++ KLRA H             WYG+D+ N ++++N EA ++EP+M +I +L  A+EAA  I+ +D+ +K
Sbjct:   25 NISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIK-EIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDD-------LLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADV------LGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGG--------TWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIK 521          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Celegans
Match: cct-1 (T-complex protein 1 subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P41988])

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 365/551 (66.24%), Postives = 450/551 (81.67%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD 1748
            M+S   S LA+ G+RTTG  +R QNV A+  IANIVK+SLGPVGLDKMLVDDVG+V ++NDGATILK LEVEHPA K+LVELAQLQDEEVGDGTTSVVI+AAELLK A+E +KQK+HPTTII+GYR+AC+EA KY+  N++   D +G++ + +AAKTSMSSK+IG D+DFF  + V+A  AV+V +  G   YPI A+NVLKAHGKS +ES+L+ GYALNCT+ASQ MP  ++ AKIA LDFSL KAK+ LG+ V+V DP KLE IR+ E DITK +I+KILK GANV+LTTGGIDD+C+K FVE+ AMAVRRCKK DLKRIAKATG +L VSLAT++G+EAFD + LG+A+++ QERI DDELILIKG K+R+A+S+ILRGAND  +DEMERS+HDS CVV+RVLESK +V GGGA E +L ++LE YA T+SSREQ+A+AEFA ALL+IPK LA NAA DST++V KLRA H  +Q  P L H KW GLDL    + +NKEAGI EP++SK+KSLKFATEAAITILRIDD++KLD++    +P  GDD
Sbjct:    1 MASAGDSILALTGKRTTGQGIRSQNVTAAVAIANIVKSSLGPVGLDKMLVDDVGDVIVTNDGATILKQLEVEHPAGKVLVELAQLQDEEVGDGTTSVVIVAAELLKRADELVKQKVHPTTIINGYRLACKEAVKYISENISFTSDSIGRQSVVNAAKTSMSSKIIGPDADFFGELVVDAAEAVRV-ENNGKVTYPINAVNVLKAHGKSARESVLVKGYALNCTVASQAMPLRVQNAKIACLDFSLMKAKMHLGISVVVEDPAKLEAIRREEFDITKRRIDKILKAGANVVLTTGGIDDLCLKQFVESGAMAVRRCKKSDLKRIAKATGATLTVSLATLEGDEAFDASLLGHADEIVQERISDDELILIKGPKSRTASSIILRGANDVMLDEMERSVHDSLCVVRRVLESKKLVAGGGAVETSLSLFLETYAQTLSSREQLAVAEFASALLIIPKVLASNAARDSTDLVTKLRAYHSKAQLIPQLQHLKWAGLDLEEGTIRDNKEAGILEPALSKVKSLKFATEAAITILRIDDLIKLDKQ----EPLGGDD 546          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Celegans
Match: cct-7 (T-complex protein 1 subunit eta [Source:UniProtKB/TrEMBL;Acc:Q9TZS5])

HSP 1 Score: 278.87 bits (712), Expect = 1.072e-85
Identity = 177/529 (33.46%), Postives = 287/529 (54.25%), Query Frame = 3
Query:  129 GGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQN-NLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            G E   G      N+ A Q +A+ ++T+LGP GLDK++VD  G  TISNDGATILKLL++  PAA  +V++A+ QD EVGDGTTSVV++AAE+LK  +  I+  +HP  +I     AC +  K L +  + I+ +   +E +   A T++SSKL+  +  FFANM V+A   +           P+  I + K +G ++ ES LI G A     +    +  P+     K+ALL+  L+    K   ++ +T+    + +   E +I  +K++KI  +GANV+L+   I D+  ++F +       R  + DL R+  A GGS+  +++ +D +    +    Y + V  ER         + C    A +++LRG  + ++ E ERS+HD+  +V+R  ++ S+V GGGA E  L   + +++  I  ++Q     + +A  +IP+QL  NA LD+ +++ KLR  H   +        KW G+D+    V +N  A ++EPS+ K  ++  ATEAA  +L ID  VK
Sbjct:   12 GTENKQGKGQIISNINACQVVADSIRTTLGPRGLDKLIVDSKGATTISNDGATILKLLDIVFPAASTMVDIARSQDAEVGDGTTSVVVLAAEILKQMKPFIEDGVHPQLLIRAIGKACEKTLKNLADLEIKINGETELREMLVKCAATTLSSKLVSQERLFFANMIVDAVNTLDA-------HLPLNMIGIKKVNGGNLHESRLIKGVAFQKAFSYAGFEMQPKKYSNVKVALLNIELELKAEKENAEMRLTNVSDFQAVVDAEWNILYDKLQKIHDSGANVVLSKLPIGDVATQWFADRDMFCAGRIPQDDLDRLMSACGGSVLTTVSQID-DSVLGKCGKFYEQQVGSERYN-----FFEDCSKAQACTLLLRGGAEQFIAETERSLHDAIMIVRRAKKNDSIVAGGGAIEMELSRLIREHSKGIEGKDQAFWMAYGQAFEIIPRQLCQNAGLDALDVLNKLRHRHAQGE--------KWAGIDIHREAVGDNLVACVWEPSIVKRNAITAATEAACLVLSIDQTVK 519          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Celegans
Match: cct-7 (T-complex protein 1 subunit eta [Source:UniProtKB/TrEMBL;Acc:Q9TZS5])

HSP 1 Score: 278.87 bits (712), Expect = 1.072e-85
Identity = 177/529 (33.46%), Postives = 287/529 (54.25%), Query Frame = 3
Query:  129 GGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQN-NLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            G E   G      N+ A Q +A+ ++T+LGP GLDK++VD  G  TISNDGATILKLL++  PAA  +V++A+ QD EVGDGTTSVV++AAE+LK  +  I+  +HP  +I     AC +  K L +  + I+ +   +E +   A T++SSKL+  +  FFANM V+A   +           P+  I + K +G ++ ES LI G A     +    +  P+     K+ALL+  L+    K   ++ +T+    + +   E +I  +K++KI  +GANV+L+   I D+  ++F +       R  + DL R+  A GGS+  +++ +D +    +    Y + V  ER         + C    A +++LRG  + ++ E ERS+HD+  +V+R  ++ S+V GGGA E  L   + +++  I  ++Q     + +A  +IP+QL  NA LD+ +++ KLR  H   +        KW G+D+    V +N  A ++EPS+ K  ++  ATEAA  +L ID  VK
Sbjct:   12 GTENKQGKGQIISNINACQVVADSIRTTLGPRGLDKLIVDSKGATTISNDGATILKLLDIVFPAASTMVDIARSQDAEVGDGTTSVVVLAAEILKQMKPFIEDGVHPQLLIRAIGKACEKTLKNLADLEIKINGETELREMLVKCAATTLSSKLVSQERLFFANMIVDAVNTLDA-------HLPLNMIGIKKVNGGNLHESRLIKGVAFQKAFSYAGFEMQPKKYSNVKVALLNIELELKAEKENAEMRLTNVSDFQAVVDAEWNILYDKLQKIHDSGANVVLSKLPIGDVATQWFADRDMFCAGRIPQDDLDRLMSACGGSVLTTVSQID-DSVLGKCGKFYEQQVGSERYN-----FFEDCSKAQACTLLLRGGAEQFIAETERSLHDAIMIVRRAKKNDSIVAGGGAIEMELSRLIREHSKGIEGKDQAFWMAYGQAFEIIPRQLCQNAGLDALDVLNKLRHRHAQGE--------KWAGIDIHREAVGDNLVACVWEPSIVKRNAITAATEAACLVLSIDQTVK 519          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Celegans
Match: cct-2 (T-complex protein 1 subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P47207])

HSP 1 Score: 257.299 bits (656), Expect = 1.253e-77
Identity = 184/525 (35.05%), Postives = 292/525 (55.62%), Query Frame = 3
Query:  147 GDNVRRQNVLASQTIANIVKTSLGPVGLDKMLV----DDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLK-LGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCV-VKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            G++ R  + + +  I ++VK++LGP G+DK+L+    +  G + ++NDGATILK + V++PAAK+LV+++  QD EVGDGTTSV ++AAELLK AE+ + Q+IHP TIISGYR A   A + L+ +     D + ++ +   A+T++ SK++    + FA +AV+A + +K   G G     + AI ++K  G SM ES L  G+ L   +     PR ++ AKI + +  +   K+K  G +V V    K+ E+   E    KEK++KIL    NV +    I +   + F +AK MA+       ++R+A   GG +   ++T D  +    A  G  + + +  I +D L+   G K   A SV+LRGA    +DE ERS+HD+ CV V  V ESK+V  G GA E  +   +   A  ++ +E +A+  F +AL  +P  +  NA LDS E+V +LRA H + +           G+D+    V++  + G+ E    K+  +  A EA   ILR+DD++K
Sbjct:   16 GESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGYRRALGIAQESLKKSSIESGDNI-RDDLLKIARTTLGSKILSQHKEHFAQLAVDAVLRLK---GSGN----LDAIQIIKKLGGSMNESYLDEGFLLE-KLPGMFQPRRVEKAKILIANTPMDTDKVKVFGSRVRVDGVAKVAELEAAEKLKMKEKVDKILAHNCNVFINRQLIYNYPEQLFADAKVMAIEHADFEGIERLALVLGGEI---VSTFDSPQT---AQFGSCDLIEEIMIGEDRLLRFSGVKLGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVA-GAGASEILMSSAIAVEAQKVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRH--------NMGIDIEKGEVADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDIIK 516          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Celegans
Match: cct-2 (T-complex protein 1 subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P47207])

HSP 1 Score: 257.299 bits (656), Expect = 1.253e-77
Identity = 184/525 (35.05%), Postives = 292/525 (55.62%), Query Frame = 3
Query:  147 GDNVRRQNVLASQTIANIVKTSLGPVGLDKMLV----DDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLK-LGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCV-VKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            G++ R  + + +  I ++VK++LGP G+DK+L+    +  G + ++NDGATILK + V++PAAK+LV+++  QD EVGDGTTSV ++AAELLK AE+ + Q+IHP TIISGYR A   A + L+ +     D + ++ +   A+T++ SK++    + FA +AV+A + +K   G G     + AI ++K  G SM ES L  G+ L   +     PR ++ AKI + +  +   K+K  G +V V    K+ E+   E    KEK++KIL    NV +    I +   + F +AK MA+       ++R+A   GG +   ++T D  +    A  G  + + +  I +D L+   G K   A SV+LRGA    +DE ERS+HD+ CV V  V ESK+V  G GA E  +   +   A  ++ +E +A+  F +AL  +P  +  NA LDS E+V +LRA H + +           G+D+    V++  + G+ E    K+  +  A EA   ILR+DD++K
Sbjct:   16 GESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGYRRALGIAQESLKKSSIESGDNI-RDDLLKIARTTLGSKILSQHKEHFAQLAVDAVLRLK---GSGN----LDAIQIIKKLGGSMNESYLDEGFLLE-KLPGMFQPRRVEKAKILIANTPMDTDKVKVFGSRVRVDGVAKVAELEAAEKLKMKEKVDKILAHNCNVFINRQLIYNYPEQLFADAKVMAIEHADFEGIERLALVLGGEI---VSTFDSPQT---AQFGSCDLIEEIMIGEDRLLRFSGVKLGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVA-GAGASEILMSSAIAVEAQKVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRH--------NMGIDIEKGEVADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDIIK 516          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084290)

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 376/543 (69.24%), Postives = 455/543 (83.79%), Query Frame = 3
Query:  102 SNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRK 1730
            S + S L+I G R +G +VR QNV+A+ +I+NIVK+SLGPVGLDKMLVDD+G+VT++NDGATIL+LLEVEHPAAK+LVELAQLQDEEVGDGTTSVVI+AAELLK A+E +KQKIHPT+IISGYRIAC+EACKY+  +LT  VD+LG++ + + AKTSMSSK+IG D++FF+ M V+A  +VK++D +G   Y IKAINVLKAHGKS +ES+LI GYALNCTIASQQMP+ I  AKIA LDFSLQK K+K+GVQVL+ DP+KLE IR RE DITKE+I  IL TG NV+L +GG+DD+CMKYFVEA AMAVRR KK DLK IAKATG +   SL  MDGEE+FD + +G A +V+QERICDDELILIKG KAR+AAS+ILRG NDFY DEMERS+HD+ CVVKRVLESK VV GGG  EAAL +YLE +A +++SREQ+AIAEFAK+LLVIPK L+VNAA D+T++VAKLR+ H+SSQ  P+ +  KW GLDL    V +NK+AG+ EP+MSKIKSLKFATEAAITILRIDDM+KL+ E K  K
Sbjct:    2 STLASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLNPEDKSGK 544          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084291)

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 376/543 (69.24%), Postives = 455/543 (83.79%), Query Frame = 3
Query:  102 SNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRK 1730
            S + S L+I G R +G +VR QNV+A+ +I+NIVK+SLGPVGLDKMLVDD+G+VT++NDGATIL+LLEVEHPAAK+LVELAQLQDEEVGDGTTSVVI+AAELLK A+E +KQKIHPT+IISGYRIAC+EACKY+  +LT  VD+LG++ + + AKTSMSSK+IG D++FF+ M V+A  +VK++D +G   Y IKAINVLKAHGKS +ES+LI GYALNCTIASQQMP+ I  AKIA LDFSLQK K+K+GVQVL+ DP+KLE IR RE DITKE+I  IL TG NV+L +GG+DD+CMKYFVEA AMAVRR KK DLK IAKATG +   SL  MDGEE+FD + +G A +V+QERICDDELILIKG KAR+AAS+ILRG NDFY DEMERS+HD+ CVVKRVLESK VV GGG  EAAL +YLE +A +++SREQ+AIAEFAK+LLVIPK L+VNAA D+T++VAKLR+ H+SSQ  P+ +  KW GLDL    V +NK+AG+ EP+MSKIKSLKFATEAAITILRIDDM+KL+ E K  K
Sbjct:    2 STLASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLNPEDKSGK 544          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Fly
Match: CCT7 (gene:FBgn0037632 transcript:FBtr0081918)

HSP 1 Score: 301.597 bits (771), Expect = 3.672e-94
Identity = 192/532 (36.09%), Postives = 297/532 (55.83%), Query Frame = 3
Query:  129 GGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKE----CITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            G + + G      N+ A Q+I + V+T+LGP G+DK++VD  G+ TISNDGATI+KLLE+ HPAAK LV++A+ QD EVGDGTTSVV++A E LK  +  +++ +HP  II   R A  + C    N + + + +  K+     +   A T+MSSKLI    DFF+ + V+A +++           P+  I + K  G S++ES L+ G A   T +    +  P++    KIALL+  L+    +   ++ V + ++ +++   E  I   K+ KI ++GANV+L+   I D+  +YF +       R  + DLKR  KA GG      A M          LG  E   + ++  +   L +GC     +++ILRG  + +++E ERS+HD+  +V+R ++  SVV GGGA E  L   L  Y+ TI+ +EQ+ IA  AK L +IP+QL  NA  D+T ++ KLR  H    Q        WYG+D+   ++S+N E  ++EPS+ KI +L  A EAA  IL +D+ +K
Sbjct:   11 GTDSSQGKPQLVSNINACQSIVDAVRTTLGPRGMDKLIVDAHGKATISNDGATIMKLLEIIHPAAKTLVDIAKSQDAEVGDGTTSVVLLAGEFLKQVKPFVEEGVHPRVIIKAIRKAL-QLCMEKINEMAVQIVEQSKDQQRALLEKCAATAMSSKLIHQQKDFFSRIVVDAVLSLDE-------LLPLNMIGIKKVTGGSLEESQLVSGVAFKKTFSYAGFEMAPKSYDNCKIALLNIELELKAERDNAEIRVDNVKEYQKVVDAEWQILYNKLAKIHESGANVVLSKLPIGDVATQYFADRDIFCAGRVPEEDLKRTMKACGG------AVMTTANDIKPNVLGLCEHFEERQVGGERFNLFQGCPNAKTSTLILRGGAEQFLEETERSLHDAIMIVRRTIKHDSVVAGGGAIEMELSKLLRDYSRTIAGKEQLLIAAIAKGLEIIPRQLCDNAGFDATNILNKLRQKHAQGGQ--------WYGVDINKEDISDNYEQCVWEPSIIKINALTAAAEAACMILSVDETIK 520          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Fly
Match: CCT2 (gene:FBgn0030086 transcript:FBtr0071289)

HSP 1 Score: 271.552 bits (693), Expect = 6.902e-83
Identity = 189/559 (33.81%), Postives = 316/559 (56.53%), Query Frame = 3
Query:   90 FKMSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLV---DDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYL----QNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLK-LGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKK-PRKPGC 1739
             +MS N    L    +    +  R  + + +  I ++VK++LGP G+DK+LV    + G V ++NDGATIL+ + V++PAAKILV+++++QDEEVGDGTTSV ++A+ELL+ AE+ ++QK+HP  I+SG+R A + A + L    Q+N + D +K   + + + A+T++SSK++    DFFAN+AV+A M +K   G G     +K+I ++K  G ++ +S L  G+ L+      Q P+ I+ A+I + +  +   K+K  G  + V    K+ ++   E +  KEK++KILK   NV +    I +   + F +A+ M++       ++R+A  TGG +  +       E      LG  + + Q  I +D L+   G K   A ++++RGA    +DE +RS+HD+ CV+   ++   ++ GGG  EA +   + K A     +E IAI  FA+ALL +P  +A NA  DS ++V++LRA H   +Q          GLD+    V++ +E GI E    K + L  A+EAA  ILR+D++++    ++ P +  C
Sbjct:    1 MEMSLNPVRVLKNEAQEEKAEMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVALEALTAAAQDNSSSD-EKFRNDLL-NIARTTLSSKILHQHKDFFANLAVDAVMRLK---GSG----ELKSIQIIKKSGGTLGDSFLDEGFLLDKKPGVHQ-PQRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIADLEMAEKEKMKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCTGGEIVSTF------ENPSLVKLGECDVIEQVMIGEDTLLRFSGVKLGEACTIVIRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAFARALLSLPTAIADNAGYDSAQLVSELRAGHAQGKQ--------TLGLDMELGKVADVRELGITESFAVKRQVLMSASEAAEMILRVDNIIRCAPRRRVPDRGYC 535          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0302371)

HSP 1 Score: 259.225 bits (661), Expect = 5.228e-78
Identity = 171/542 (31.55%), Postives = 292/542 (53.87%), Query Frame = 3
Query:  135 ERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAI-NVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQ-ERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQI--AIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLD-----LTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKP 1733
            +R +G  V+ +N+ A + IA++++T LGP  + KML+D +G + ++NDG  IL+ + V+HPAAK ++E+A+ QDEEVGDGTTSV+++A E+L  AE  ++Q+IHPT II  YR A  +   +LQ+ L+I +D   K  +    K  + +K IG  SD    +A++A   V +S+  G     IK    V K  G +++ES ++ G  +N  +   +M R I+  +I LLD SL+  K +    V +   +    + + E +  +     I+    +++ T  G+ D+   Y ++A   A+RR +K D  RIA+A G ++      ++  E   + ++G    + + ++I D+    +  CK   A +++LRGA+   ++E ER++ D+  V + ++    +V GGGA E A        A  + +R+Q+       A AL +IP+ LA N   ++   +  LRA H S       A    +G+D     + + NV N     I+EP   K+++ K A E AI +LRIDD+V   +++   +P
Sbjct:   16 KRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSE-NGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATI------VNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMA--------ASQLLTRKQVKGPYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCA----WGIDGESGEIVDMNVKN-----IWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKRGGNEP 533          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 773.852 bits (1997), Expect = 0.000e+0
Identity = 378/548 (68.98%), Postives = 465/548 (84.85%), Query Frame = 3
Query:  102 SNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGD 1745
            S + S L++ G+RTTG++VR QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA+LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT+IISGYR+AC+EA +Y+  NLTI  D LG+EC+ +AAKTSMSSK+IG+D++FFANM V+A +AVK  DGKG  RYPI ++NVLKAHG+S KES L++GYALNCT+ SQ M + +  AKIA LDFSLQK K+KLGVQV++ DPEKL++IR+RESDITKE+++KIL +GANV+LTTGGIDDMC+KYFV+  AMAVRR  K DLKRIAKATG ++C SL+ ++GEE F+ + LG AE+V QER+CDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIPK LAVNAA DST++VAKLRA H+ +Q  PD  + KW GLDL N    +NK+AG++EP+M K KSLKFATEAAITILRIDD++KL  ++K   P   D
Sbjct:    2 SMIDSPLSVLGQRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGGPSYQD 549          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 377/546 (69.05%), Postives = 464/546 (84.98%), Query Frame = 3
Query:  108 VTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGD 1745
            + S L++ G+RTTG++VR QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA+LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT+IISGYR+AC+EA +Y+  NLTI  D LG+EC+ +AAKTSMSSK+IG+D++FFANM V+A +AVK  DGKG  RYPI ++NVLKAHG+S KES L++GYALNCT+ SQ M + +  AKIA LDFSLQK K+KLGVQV++ DPEKL++IR+RESDITKE+++KIL +GANV+LTTGGIDDMC+KYFV+  AMAVRR  K DLKRIAKATG ++C SL+ ++GEE F+ + LG AE+V QER+CDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIPK LAVNAA DST++VAKLRA H+ +Q  PD  + KW GLDL N    +NK+AG++EP+M K KSLKFATEAAITILRIDD++KL  ++K   P   D
Sbjct:    2 IDSPLSVLGQRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGGPSYQD 547          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Zebrafish
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 322.783 bits (826), Expect = 3.368e-102
Identity = 197/518 (38.03%), Postives = 303/518 (58.49%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQN-NLTIDVD--KLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            N+ A Q +A  V+T+LGP G+DK++VD+ G+ TISNDGATILKLL+V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK  +  +++ +HP TII  +RIA + A K ++   +TI  D  +  +  +   A T+++SKLI    DFF+ M V+A M +           P+K I V K  G +++ES L+ G A   T +    +  P+     KIALL+  L+    K   +V V   E  + I   E +I  +K+EKI K+GA V+L+   I D+  +YF +       R  + DLKR   A GGS+  S+ ++  +       LG  E   + ++  +     KGC      ++ILRG  + +++E +RS+HD+  +V+R +++ S+V GGGA E  L  YL  Y+ TI  ++Q+ I  +AKAL +IP+QL  NA  D+T ++ KLRA H             WYG+D+ N ++++N +A ++EPS+ +I +L  A+EAA  IL +D+ +K
Sbjct:   25 NINACQVVAEAVRTTLGPRGMDKLVVDNRGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIKEIAVTIKKDDKQEQRRLLEKCAATALNSKLIAGQKDFFSKMVVDAVMMLD-------DLLPLKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYMNPKIALLNIELELKAEKDNAEVRVNSVEDYQAIVDAEWNILYDKLEKIHKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVVEEDLKRTMMACGGSIQTSVGSLTDDV------LGQCELFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFMEETDRSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQGGM--------WYGVDVNNEDIADNFQACVWEPSIVRINALTAASEAACLILSVDETIK 521          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Zebrafish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 263.848 bits (673), Expect = 8.258e-80
Identity = 172/529 (32.51%), Postives = 293/529 (55.39%), Query Frame = 3
Query:  135 ERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGI-----DDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERI-CDDELILIKGCKARS-AASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV 1700
            +R     +R  N+ A + +A+ ++TSLGP G+DKM+ D  G+VTI+NDGATILK ++V HPAAK++VEL++ QD E GDGTTSVV+IA  LL    + +++ IHPT I   ++ A  +  + L  +++  +    +E + ++A TS+ SK++  +S   A M+V+A M  KV D        ++ INV+K  G ++ +  L+ G  L   +AS  + R ++ AKI L+ F L   K  +  Q++V+D  +++ + + E       ++++ K G  V+L    I      D+ + +  + K M ++  ++ +++ I K  G      +A +D    F    LG AE V +  +    +L+ I GC +     S+++RG+N   ++E ERSIHD+ CV++ +++ ++++ GGGA E  L + L +YA ++   E   +  +A AL VIP  LA NA L+    V +LR  H   +           G+++    +SN  E  + +P +  I +L  ATE   +IL+IDD+V
Sbjct:   20 DRDKPAQIRYSNINAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMMVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTIISESFQKAVDKGVEVL-TSISTPLLLSDRESLLNSASTSLCSKVVSQNSSLLAPMSVDAVM--KVIDPATATSVDLRDINVVKKLGGTIDDCELVDGMVLTQRVASTGVSR-VEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQVKKAGCTVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREEIEFICKTIGTK---PIAHID---QFTPEMLGSAELVEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEYARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGET--------TAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDLV 530          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 258.84 bits (660), Expect = 8.285e-78
Identity = 175/542 (32.29%), Postives = 288/542 (53.14%), Query Frame = 3
Query:  138 RTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQN-NLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERIC----DDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD 1748
            R TG    + ++LA++ +AN ++TSLGP GLDKM+VD  GEVT++NDGATIL +++V+H  AK++VEL++ QD+E+GDGTT VV++A  LL+ AE+ + + IHP  I  GY  A + A + L     +  VD    E +   A T++ SK+I       A +AV A + V   + K       + I V    G  ++++ LI G  ++   +  QMP+ +K  KIA+L    +  K K   ++ VT  E  + ++K E D  +E I ++ + GAN+ +   G DD      ++ +  A+R     +++ IA ATGG +      +  E+      LG A  V +  IC     D +++I+ CK   A ++ +RG N   ++E +R++HD+ CV++ ++    +V GGGA E A  + + + A    S EQ A+  FA AL VIP  LA N+ L+  + + ++RA                 G+D  + + ++ K+  + E  + K + +  AT+    IL+IDD+         R PG  +D
Sbjct:   27 RLTGLEALKSHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKD---VDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKDKFQEMIRQVKENGANLAICQWGFDDEANHLLLQNELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEK------LGTAGLVKE--ICFGTTKDRMLVIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKENN-------SALGIDCLHLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI---------RGPGEPED 541          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Xenopus
Match: TCP1 (t-complex 1 [Source:NCBI gene;Acc:100487607])

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 378/537 (70.39%), Postives = 456/537 (84.92%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRK 1730
            LA+ GER+TG+ VR QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD EVGDGTTSVVIIAAELLK A+E +KQKIHPT++I GYR+AC+EA +Y+  NLTI+ D+LGKEC+ +AA+TSMSSK+IG+DSDFF+ M V+A +AVK  D KG  RYPI +INVLKAHG+S KES+L++GYALNC + SQ M + I  AKIA LDFSLQK K+KLGVQV+++DP KL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFV+A AMAVRR  K DLKRIAKATG  +C +LA ++GEE+F+ + LG AE+V QERICDDELIL+K  KAR+ AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA+ALLVIPK LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL N    +NK+AG+FEP++ K KSLKFATEAAITILRIDD++KL  E K  K
Sbjct:    5 LAVFGERSTGEAVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDNEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVIGGYRLACKEAVRYINENLTINTDELGKECLLNAARTSMSSKIIGVDSDFFSAMVVDAALAVKYVDPKGQARYPINSINVLKAHGRSQKESILVNGYALNCVVGSQSMNKRIVNAKIACLDFSLQKTKMKLGVQVIISDPTKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVLKKDLKRIAKATGAIMCSTLANLEGEESFEASMLGQAEEVVQERICDDELILVKNTKARTCASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARALLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLNGKPRDNKQAGVFEPTLVKTKSLKFATEAAITILRIDDLIKLHPEAKEEK 541          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Xenopus
Match: TCP1 (t-complex 1 [Source:NCBI gene;Acc:100487607])

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 366/519 (70.52%), Postives = 441/519 (84.97%), Query Frame = 3
Query:  174 LASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRK 1730
            +A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD EVGDGTTSVVIIAAELLK A+E +KQKIHPT++I GYR+AC+EA +Y+  NLTI+ D+LGKEC+ +AA+TSMSSK+IG+DSDFF+ M V+A +AVK  D KG  RYPI +INVLKAHG+S KES+L++GYALNC + SQ M + I  AKIA LDFSLQK K+KLGVQV+++DP KL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFV+A AMAVRR  K DLKRIAKATG  +C +LA ++GEE+F+ + LG AE+V QERICDDELIL+K  KAR+ AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA+ALLVIPK LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL N    +NK+AG+FEP++ K KSLKFATEAAITILRIDD++KL  E K  K
Sbjct:   15 MAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDNEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVIGGYRLACKEAVRYINENLTINTDELGKECLLNAARTSMSSKIIGVDSDFFSAMVVDAALAVKYVDPKGQARYPINSINVLKAHGRSQKESILVNGYALNCVVGSQSMNKRIVNAKIACLDFSLQKTKMKLGVQVIISDPTKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVLKKDLKRIAKATGAIMCSTLANLEGEESFEASMLGQAEEVVQERICDDELILVKNTKARTCASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARALLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLNGKPRDNKQAGVFEPTLVKTKSLKFATEAAITILRIDDLIKLHPEAKEEK 533          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Xenopus
Match: TCP1 (t-complex 1 [Source:NCBI gene;Acc:100487607])

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 367/520 (70.58%), Postives = 442/520 (85.00%), Query Frame = 3
Query:  171 VLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRK 1730
            V+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD EVGDGTTSVVIIAAELLK A+E +KQKIHPT++I GYR+AC+EA +Y+  NLTI+ D+LGKEC+ +AA+TSMSSK+IG+DSDFF+ M V+A +AVK  D KG  RYPI +INVLKAHG+S KES+L++GYALNC + SQ M + I  AKIA LDFSLQK K+KLGVQV+++DP KL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFV+A AMAVRR  K DLKRIAKATG  +C +LA ++GEE+F+ + LG AE+V QERICDDELIL+K  KAR+ AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA+ALLVIPK LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL N    +NK+AG+FEP++ K KSLKFATEAAITILRIDD++KL  E K  K
Sbjct:   27 VMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDNEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVIGGYRLACKEAVRYINENLTINTDELGKECLLNAARTSMSSKIIGVDSDFFSAMVVDAALAVKYVDPKGQARYPINSINVLKAHGRSQKESILVNGYALNCVVGSQSMNKRIVNAKIACLDFSLQKTKMKLGVQVIISDPTKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVLKKDLKRIAKATGAIMCSTLANLEGEESFEASMLGQAEEVVQERICDDELILVKNTKARTCASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARALLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLNGKPRDNKQAGVFEPTLVKTKSLKFATEAAITILRIDDLIKLHPEAKEEK 546          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Xenopus
Match: TCP1 (t-complex 1 [Source:NCBI gene;Acc:100487607])

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 308/427 (72.13%), Postives = 369/427 (86.42%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTIS 1400
            LA+ GER+TG+ VR QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD EVGDGTTSVVIIAAELLK A+E +KQKIHPT++I GYR+AC+EA +Y+  NLTI+ D+LGKEC+ +AA+TSMSSK+IG+DSDFF+ M V+A +AVK  D KG  RYPI +INVLKAHG+S KES+L++GYALNC + SQ M + I  AKIA LDFSLQK K+KLGVQV+++DP KL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFV+A AMAVRR  K DLKRIAKATG  +C +LA ++GEE+F+ + LG AE+V QERICDDELIL+K  KAR+ AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA TIS
Sbjct:    5 LAVFGERSTGEAVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDNEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVIGGYRLACKEAVRYINENLTINTDELGKECLLNAARTSMSSKIIGVDSDFFSAMVVDAALAVKYVDPKGQARYPINSINVLKAHGRSQKESILVNGYALNCVVGSQSMNKRIVNAKIACLDFSLQKTKMKLGVQVIISDPTKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVLKKDLKRIAKATGAIMCSTLANLEGEESFEASMLGQAEEVVQERICDDELILVKNTKARTCASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYA-TIS 430          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Xenopus
Match: TCP1 (t-complex 1 [Source:NCBI gene;Acc:100487607])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 293/408 (71.81%), Postives = 353/408 (86.52%), Query Frame = 3
Query:  174 LASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTI 1397
            +A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD EVGDGTTSVVIIAAELLK A+E +KQKIHPT++I GYR+AC+EA +Y+  NLTI+ D+LGKEC+ +AA+TSMSSK+IG+DSDFF+ M V+A +AVK  D KG  RYPI +INVLKAHG+S KES+L++GYALNC + SQ M + I  AKIA LDFSLQK K+KLGVQV+++DP KL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFV+A AMAVRR  K DLKRIAKATG  +C +LA ++GEE+F+ + LG AE+V QERICDDELIL+K  KAR+ AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++
Sbjct:    1 MAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDNEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVIGGYRLACKEAVRYINENLTINTDELGKECLLNAARTSMSSKIIGVDSDFFSAMVVDAALAVKYVDPKGQARYPINSINVLKAHGRSQKESILVNGYALNCVVGSQSMNKRIVNAKIACLDFSLQKTKMKLGVQVIISDPTKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVLKKDLKRIAKATGAIMCSTLANLEGEESFEASMLGQAEEVVQERICDDELILVKNTKARTCASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSM 408          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Mouse
Match: Tcp1 (t-complex protein 1 [Source:MGI Symbol;Acc:MGI:98535])

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 369/539 (68.46%), Postives = 455/539 (84.42%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPG 1736
            L++ G+R+TG+ VR QNV+A+ +IANIVK+S GPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT++ISGYR+AC+EA +Y+  NL I+ D+LG++C+ +AAKTSMSSK+IGI+ D+FANM V+A +AVK +D +G  RYP+ ++N+LKAHG+S  ESMLI+GYALNC + SQ MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+I+KIL TGANVILTTGGIDDM +KYFVEA AMAVRR  K DLK +AKA+G S+  +LA ++GEE F+   LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLE KSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIP  LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL +    +NK+AG+FEP++ K+KSLKFATEAAITILRIDD++KL  E K  K G
Sbjct:    5 LSVFGDRSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAKTSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNSVNILKAHGRSQIESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILSTLANLEGEETFEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHG 543          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Mouse
Match: Tcp1 (t-complex protein 1 [Source:MGI Symbol;Acc:MGI:98535])

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 338/493 (68.56%), Postives = 414/493 (83.98%), Query Frame = 3
Query:  258 EVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPG 1736
            +VTI+NDGATILKLLEVEHPAAK+L ELA LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT++ISGYR+AC+EA +Y+  NL I+ D+LG++C+ +AAKTSMSSK+IGI+ D+FANM V+A +AVK +D +G  RYP+ ++N+LKAHG+S  ESMLI+GYALNC + SQ MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+I+KIL TGANVILTTGGIDDM +KYFVEA AMAVRR  K DLK +AKA+G S+  +LA ++GEE F+   LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLE KSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIP  LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL +    +NK+AG+FEP++ K+KSLKFATEAAITILRIDD++KL  E K  K G
Sbjct:    2 DVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAKTSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNSVNILKAHGRSQIESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILSTLANLEGEETFEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHG 494          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Mouse
Match: Cct7 (chaperonin containing Tcp1, subunit 7 (eta) [Source:MGI Symbol;Acc:MGI:107184])

HSP 1 Score: 316.235 bits (809), Expect = 1.174e-99
Identity = 199/533 (37.34%), Postives = 299/533 (56.10%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGK----ECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEK-KPRKPGCG 1742
            N+ A Q IA  V+T+LGP G+DK++VD  G+ TISNDGATILKLL+V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK  +  +++ +HP  II  +R A + A   ++  + + V K  K    + +   A T++SSKLI     FFA M V+A M +            +K I + K  G +++ES L+ G A   T +    +  P+  K  KIALL+  L+    K   ++ V   E  + I   E +I  +K+EKI ++GA VIL+   I D+  +YF +       R  + DLKR   A GGS+  S+       A     LG+ +   + +I  +      GC      ++ILRG  + +++E ERS+HD+  +V+R +++ SVV GGGA E  L  YL  Y+ TI  ++Q+ I  +AKAL +IP+QL  NA  D+T ++ KLRA H             WYG+D+ N N+++N +A ++EP+M +I +L  A+EAA  I+ +D+ +K       P  P  G
Sbjct:   25 NISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIK-EIAVTVKKQDKVEQRKMLEKCAMTALSSKLISQQKVFFAKMVVDAVMMLDE-------LLQLKMIGIKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKKYKNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHQSGAKVILSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSV------NALVPDVLGHCQVFEETQIGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGM--------WYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAG 535          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 275.789 bits (704), Expect = 3.701e-84
Identity = 178/547 (32.54%), Postives = 303/547 (55.39%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAI-NVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQ-ERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEK---KPRKPGCGD 1745
            L+   +R +G  V+  N+ A++TIA+I++T LGP  + KML+D +G + ++NDG  IL+ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L +AE  ++Q++HPT +IS YR+A  +    L+  ++  VD   +E + S   +S+++K+I   S    N+A++A   V+  +  G     IK    V K  G  +++S ++ G  +N  +   +M R IK  +I LLD SL+  K +    + +T  E    I + E +   +  E I++   +V++T  GI D+   Y + A   A+RR +K D  RIA+A G  +      +   E   + ++G    + + ++I D+    I  CK   A +++LRGA+   + E+ER++ D+  V + VL    +VPGGGA E A+   L + +  ++  EQ      A+AL VIP+ L  N    +  ++  LRA H            + +G++     + + KE GI+EP   K+++ K A E A+ +LRIDD+V   ++K   + R+ G  D
Sbjct:   10 LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLK-KISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEEN-GRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARI------VSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQES-------CETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQNRQTGAPD 541          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Mouse
Match: Cct7 (chaperonin containing Tcp1, subunit 7 (eta) [Source:MGI Symbol;Acc:MGI:107184])

HSP 1 Score: 264.233 bits (674), Expect = 2.417e-80
Identity = 179/529 (33.84%), Postives = 277/529 (52.36%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEK-KPRKPGCG 1742
            N+ A Q IA  V+T+LGP G+DK++VD  G+ TISNDGATILKLL+V HPAAK LV++A+ QD E  +    + +   +     +++++Q+                              K+ ++C    A T++SSKLI     FFA M V+A M +            +K I + K  G +++ES L+ G A   T +    +  P+  K  KIALL+  L+    K   ++ V   E  + I   E +I  +K+EKI ++GA VIL+   I D+  +YF +       R  + DLKR   A GGS+  S+       A     LG+ +   + +I  +      GC      ++ILRG  + +++E ERS+HD+  +V+R +++ SVV GGGA E  L  YL  Y+ TI  ++Q+ I  +AKAL +IP+QL  NA  D+T ++ KLRA H             WYG+D+ N N+++N +A ++EP+M +I +L  A+EAA  I+ +D+ +K       P  P  G
Sbjct:   25 NISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEAVNKIKEIAVTVKK-----QDKVEQR------------------------------KMLEKC----AMTALSSKLISQQKVFFAKMVVDAVMMLDE-------LLQLKMIGIKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKKYKNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHQSGAKVILSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSV------NALVPDVLGHCQVFEETQIGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGM--------WYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAG 493          
BLAST of T-complex protein 1 subunit alpha vs. UniProt/SwissProt
Match: sp|Q94757|TCPA_SCHMA (T-complex protein 1 subunit alpha OS=Schistosoma mansoni OX=6183 GN=TCP-1A PE=2 SV=1)

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 391/543 (72.01%), Postives = 465/543 (85.64%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPG--CG 1742
            L +GGERT+G++VR+QNVLA+ + AN VKTSLGPVGLDKMLVDDVG+VTI+NDGATILKLL+VEHPAAKILV+LAQLQDEEVGDGTTSVVI+AA LLK A+E I + +HPTT+I+GYR+ACREACKY+Q ++  DV+KLGK  + + A+T+MSSKLI +D+D F+ MAV+A MAV+VS G  G  YPIKA+N+LKAHG+SM ESMLI GYALNCT ASQQMPR IK AKIA LDFSLQK K+KLGVQV+V DP +LE IR+RE+DITKE+I+KIL  GANVILTTGGIDD+CMKYFVE  AMAVRRCKKVDLK +AKATGG L VSLA M+G+E FD   LG AE+VSQERICDDELI+++G K   +AS+ILRGANDFYVDEMERS+HD+  VVKRVLESK +VPG GACE A+ +YLE YA+T+SSREQ+AIAEFA+A+L IPKQLAVNA +DSTE+VA+LR+ H+SSQ  PD AH KW+GLDL N  V++ KE G+FEP +SKIKSLKFATEAAITILRIDD++KL EEK+P   G  CG
Sbjct:    2 LTLGGERTSGESVRKQNVLAACSFANFVKTSLGPVGLDKMLVDDVGDVTITNDGATILKLLDVEHPAAKILVQLAQLQDEEVGDGTTSVVILAAALLKNADELISRFVHPTTVINGYRLACREACKYIQEHMAYDVNKLGKAGLINVARTAMSSKLINLDADMFSQMAVDALMAVEVSGGPKGPVYPIKAVNILKAHGRSMSESMLIDGYALNCTAASQQMPRIIKKAKIAFLDFSLQKVKMKLGVQVVVKDPAQLEAIRQREADITKERIQKILNAGANVILTTGGIDDLCMKYFVEVNAMAVRRCKKVDLKNMAKATGGQLIVSLADMEGDEVFDPTKLGNAEEVSQERICDDELIILRGPKVHPSASIILRGANDFYVDEMERSLHDALLVVKRVLESKRIVPGAGACETAVSIYLENYALTLSSREQLAIAEFARAMLSIPKQLAVNAGVDSTELVARLRSCHNSSQSKPDQAHNKWWGLDLNNQYVADCKEIGVFEPLVSKIKSLKFATEAAITILRIDDLIKLKEEKQPDHDGDECG 544          
BLAST of T-complex protein 1 subunit alpha vs. UniProt/SwissProt
Match: sp|Q9XT06|TCPA_MONDO (T-complex protein 1 subunit alpha OS=Monodelphis domestica OX=13616 GN=TCP1 PE=2 SV=1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 378/539 (70.13%), Postives = 462/539 (85.71%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPG 1736
            L++ GERTTG+++R QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT+II GYR+AC+EA +Y+  NL I+ D+LGK+C+ +AAKTSMSSK+IGID DFFANM V+A +AVK +D KG  RYP+ +INVLKAHG+S KESMLI+GYALNC +ASQ MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IRKRE+DITKE+I+KIL TGANVILTTGGIDDMC+KYFVE+  +AVRR  K DLKRIAKA+G ++  +LA+++GEE+F+ + LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LL+IP  LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL N    +N++ G+FEP+M K+KSLKFATEAAITILRIDD++KL  E K  K G
Sbjct:    5 LSVFGERTTGESIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSIIGGYRLACKEAVRYINENLIINTDELGKDCLINAAKTSMSSKIIGIDGDFFANMVVDAVLAVKYTDVKGQPRYPVNSINVLKAHGRSQKESMLINGYALNCVVASQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRKREADITKERIQKILATGANVILTTGGIDDMCLKYFVESMTIAVRRVLKRDLKRIAKASGATILSTLASLEGEESFEASMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLIIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNGKPRDNRQTGVFEPTMVKVKSLKFATEAAITILRIDDLIKLHPESKDDKRG 543          
BLAST of T-complex protein 1 subunit alpha vs. UniProt/SwissProt
Match: sp|Q9W790|TCPA_PALPA (T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus OX=84099 GN=TCP1 PE=2 SV=1)

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 379/546 (69.41%), Postives = 463/546 (84.80%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD*FR 1757
            LA+ GER++GD VR QNV A+ TIANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA+LQD+EVGDGTTSVVIIAAELLK ++E +KQKIHPT+II GYR+AC+EA +Y+  NL I+ D+LG++C+ ++AKTSMSSK+IGID DFFA+M V+A  AVK +D KG  RYPI +INVLKAHG+S KES+L++GYALNC + SQ M + I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFV+A AMAVRR  K DLKRIAKA+G ++C +LA ++GEE+F+ + LG AE+V QER+CDDELILIK  KAR++AS+ILRGANDF  DEMERSIHD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LL+IP  LAVNAA D+T++VAKLRA H+ +Q  P+  + KW GLDL N    +NK+AG+FEP++ K KSLKFATEAAITILRIDD++KL  E K  K GC +D  R
Sbjct:    8 LAVLGERSSGDTVRNQNVTAAATIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKNSDELVKQKIHPTSIIGGYRLACKEAVRYINENLIINTDELGRDCLINSAKTSMSSKIIGIDGDFFASMVVDAASAVKYTDQKGQARYPINSINVLKAHGRSQKESILVNGYALNCVVGSQGMTKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVLKKDLKRIAKASGATVCSTLANLEGEESFEASMLGQAEEVVQERVCDDELILIKNTKARTSASIILRGANDFMCDEMERSIHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLIIPNTLAVNAAQDATDLVAKLRAFHNEAQVNPERKNLKWIGLDLINGKPRDNKQAGVFEPTLVKTKSLKFATEAAITILRIDDLIKLHPESKDDKGGCYEDAVR 553          
BLAST of T-complex protein 1 subunit alpha vs. UniProt/SwissProt
Match: sp|P17987|TCPA_HUMAN (T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1)

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 374/543 (68.88%), Postives = 462/543 (85.08%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD 1748
            L++ G+R+TG+ +R QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT++ISGYR+AC+EA +Y+  NL ++ D+LG++C+ +AAKTSMSSK+IGI+ DFFANM V+A +A+K +D +G  RYP+ ++N+LKAHG+S  ESMLI GYALNC + SQ MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+I+KIL TGANVILTTGGIDDMC+KYFVEA AMAVRR  K DLKRIAKA+G ++  +LA ++GEE F+ A LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIP  LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL+N    +NK+AG+FEP++ K+KSLKFATEAAITILRIDD++KL  E K  K G  +D
Sbjct:    5 LSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYED 547          
BLAST of T-complex protein 1 subunit alpha vs. UniProt/SwissProt
Match: sp|P18279|TCPA_CRIGR (T-complex protein 1 subunit alpha OS=Cricetulus griseus OX=10029 GN=TCP1 PE=2 SV=1)

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 376/539 (69.76%), Postives = 459/539 (85.16%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPG 1736
            L++ G+R+TG+ +R QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT++ISGYR+AC+EA +Y+  NL I+ D+LG++C+ +AAKTSMSSK+IGI+ DFFANM V+A +AVK +D +G  RYP+ ++N+LKAHG+S  ESMLI+GYALNC + SQ MP+ I  AKIA LDFSLQK K+KLGVQV++TDPEKL++IR+RESDITKE+IEKIL TGANVILTTGGIDDMC+KYFVEA AMAVRR  K DLKRIAKA+G S+  +LA ++GEE F+   LG AE+V QERICDDELILIK  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIP  LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL N    +NK+AG+FEP++ K+KSLKFATEAAITILRIDD++KL  E K  K G
Sbjct:    5 LSVFGDRSTGEAIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYISENLIINTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAVKYTDLRGQPRYPVNSVNILKAHGRSQVESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIEKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGASILSTLANLEGEETFEATMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLINGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPETKDDKHG 543          
BLAST of T-complex protein 1 subunit alpha vs. TrEMBL
Match: A0A0X3Q3P6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR69026 PE=3 SV=1)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 406/540 (75.19%), Postives = 483/540 (89.44%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEE 1715
            MSSN  + L++GGER TG++VR+QNV+A+ +IANIVKTSLGPVGLDKMLVDDVG+VTI+NDGATILKLL+VE PAAK+LV+LAQLQD+EVGDGTTSVVI+AAELL+ A+E I QKIHPTTIISGYR+ACREACKY+QNNL +D D LGK C+ S AKTSMSSKLI +D+DFFANMAV+A +AVK+SDG+GGF YP KAIN+LKAHG+SMKESML++GYALNCT+ASQQMP+ IK AKIA LDF+LQK KLKLGVQVLV++P+KLEEIR RE+DITKE+I+KIL++GANVILTTGGIDD+CMKYFVEA AMAVRRCK+VDLKRIAKATGG L V+L+ MDGEE F+ + LG A +V QERICDDELILI   KARS+AS+ILRGANDFYVDEMERSIHD+  VVKRVLESK +VPG GACEAA+ ++LE +AMT+ SREQ+A+AEFA+A+LVIPKQL+VNAALDST++V++LRA H++SQ   DLA  K++GLDLT   ++N KE GIFEP +SKIKSLKFATEAAITILRIDD++KL EE
Sbjct:    1 MSSNAVTALSLGGERVTGESVRKQNVMAACSIANIVKTSLGPVGLDKMLVDDVGDVTITNDGATILKLLDVEQPAAKVLVQLAQLQDDEVGDGTTSVVILAAELLRNADELISQKIHPTTIISGYRLACREACKYIQNNLVLDSDSLGKSCLVSVAKTSMSSKLITLDADFFANMAVDAALAVKISDGRGGFVYPTKAINILKAHGRSMKESMLVNGYALNCTVASQQMPKQIKNAKIAFLDFNLQKVKLKLGVQVLVSNPDKLEEIRNREADITKERIQKILQSGANVILTTGGIDDLCMKYFVEAGAMAVRRCKRVDLKRIAKATGGQLVVTLSNMDGEETFESSFLGEAGEVVQERICDDELILIHDPKARSSASIILRGANDFYVDEMERSIHDALQVVKRVLESKCIVPGAGACEAAVSIFLENFAMTMGSREQLAVAEFARAMLVIPKQLSVNAALDSTDLVSRLRACHNTSQLKADLADTKFWGLDLTRNCIANCKELGIFEPLVSKIKSLKFATEAAITILRIDDLIKLKEE 540          
BLAST of T-complex protein 1 subunit alpha vs. TrEMBL
Match: A0A0R3VSH9 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS120 PE=3 SV=1)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 403/546 (73.81%), Postives = 474/546 (86.81%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKP 1733
            MS N  + L++GGER +GD+VR+QNV+A+ +IANIVKTSLGPVGLDKMLVDDVG+VTI+NDGATILKLL+VE PAAK+LV+LAQLQD+EVGDGTTSVVI+AAELL+ A+E I Q+IHPTTI+SGYR+ACREACKY+QNNL +D D LGK C+ +AAKTSMSSKLI +D+DFFANMAVEA +AVKV DG GGF Y  KAIN+LKAHG+SM+ESMLI+GYALNCTIASQQMPR IK A+IA LDF+LQK KLKLGVQVLV+DP+KLEEIR RE+DITKE+I+ IL  GANVILTTGGIDD+CMKYFVEA AMAVRRCK+VDLKRIAKATGG L V+++ MDGEE F+ + LG A +V QERICDDELILI   K RSAAS+ILRGAND YVDEMERSIHDS  V+KRVLESKSVVPG GACE A+ V+LE +AMT+ SREQ+A+AEFA+A+L IPKQLAVNAALDST+++++LRA H++SQ   + A  K++GLDL    +SN KE GIFEP +SKIKSLKFATEAAITILRIDD++KL EEK    P
Sbjct:    1 MSGNAATPLSLGGERVSGDSVRKQNVMAAISIANIVKTSLGPVGLDKMLVDDVGDVTITNDGATILKLLDVEQPAAKVLVQLAQLQDDEVGDGTTSVVILAAELLRNADELIAQRIHPTTIMSGYRLACREACKYIQNNLVLDSDALGKACLVNAAKTSMSSKLITVDADFFANMAVEAALAVKVPDGHGGFIYATKAINILKAHGRSMRESMLINGYALNCTIASQQMPRQIKNARIAFLDFNLQKVKLKLGVQVLVSDPDKLEEIRNREADITKERIQAILAAGANVILTTGGIDDLCMKYFVEAGAMAVRRCKRVDLKRIAKATGGQLIVTMSNMDGEETFEPSFLGEAGEVVQERICDDELILIHDPKVRSAASIILRGANDLYVDEMERSIHDSLQVIKRVLESKSVVPGAGACETAVSVFLENFAMTMGSREQLAVAEFARAMLAIPKQLAVNAALDSTDLISRLRACHNTSQMKSENADMKFWGLDLQKNCISNCKELGIFEPLVSKIKSLKFATEAAITILRIDDLIKLKEEKPIDDP 546          
BLAST of T-complex protein 1 subunit alpha vs. TrEMBL
Match: K7X0V3 (T-complex protein 1 subunit alpha OS=Spirometra erinaceieuropaei OX=99802 PE=2 SV=1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 402/540 (74.44%), Postives = 476/540 (88.15%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEE 1715
            MSSN  + L++GGER TG++VR+QNV+A+ +IANIVKTSLGPVGLDKMLVDDVG+VTI+NDGATILKLL+VE PAAK+LV+LAQLQD+EVGDGTTSVVI+AAELL+ A+E I QKIHPTTIISGYR+ACREACKY+QNNL +D D LGK C+ S AKTSMSSKLI +D+DFFAN AV+A +AV++SDG+GGF YP KAIN+LKAHG+SMKESM ++GYALNCT+ASQQMP+ IK AKIA LDF+LQK KLKLGVQVLV DP+KLEEIR RE+DITKE+I+KIL+ GANVILTTGGIDD+CMKYFVEA AMAVRRCK+VDLKRIAKATGG L V+L+ MDGEE F+ + LG A +V QERICDDEL LI   KARS+AS+ILRGANDF VDEMERSIHD+  VVKRVLESKS+VPG GACEAA  ++LE +AMT+ SREQ+A+AEFA+A+LVIPKQL+VNA LDST++V++LRA H++SQ   DLA  K++GLDLT   ++N KE GIFEP +SKIKSLKFATEAAITILRIDD++KL EE
Sbjct:    1 MSSNAVTALSLGGERVTGESVRKQNVMAACSIANIVKTSLGPVGLDKMLVDDVGDVTITNDGATILKLLDVEQPAAKVLVQLAQLQDDEVGDGTTSVVILAAELLRNADELINQKIHPTTIISGYRLACREACKYIQNNLVLDSDSLGKSCLVSVAKTSMSSKLITLDADFFANTAVDAALAVRISDGRGGFLYPTKAINILKAHGRSMKESMPVNGYALNCTVASQQMPKQIKNAKIAFLDFNLQKVKLKLGVQVLVGDPDKLEEIRNREADITKERIQKILQAGANVILTTGGIDDLCMKYFVEAGAMAVRRCKRVDLKRIAKATGGQLIVTLSNMDGEETFESSLLGEAGEVVQERICDDELTLIHDPKARSSASIILRGANDFNVDEMERSIHDALQVVKRVLESKSIVPGVGACEAAASIFLENFAMTMGSREQLAVAEFARAMLVIPKQLSVNATLDSTDLVSRLRACHNTSQLKADLADTKFWGLDLTRNCIANCKELGIFEPLVSKIKSLKFATEAAITILRIDDLIKLKEE 540          
BLAST of T-complex protein 1 subunit alpha vs. TrEMBL
Match: U6IXW6 (T-complex protein 1 subunit alpha OS=Echinococcus granulosus OX=6210 GN=EGR_01327 PE=3 SV=1)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 400/546 (73.26%), Postives = 474/546 (86.81%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKP 1733
            MS+N  + L++GGER +GD+VR+QNV+A+ +IANIVKTSLGPVGLDKMLVDDVG+VTI+NDGATILKLL+VE PAAK+LV+LAQLQD+EVGDGTTSVVI+AAELL+ A+E I Q+IHPTTI+SGYR+ACREACKY+QNNL +D D LGK C+ +AAKTSMSSKLI +D+DFFANMAVEA +AVKV DG GGF Y  KAIN+LKAHG+SM+ESMLI+GYALNCTIASQQMPR I+ AKIA LDF+LQK KLKLGVQVLV+DP+KLEEIR RESDITKE+I+ IL  GANV+LTTGGIDD+CMKYFV+A AMAVRRCK+VDLKRIAKATGG L V+++ MDGEE F+ + LG A +V QERICDDELILI   K RSAAS+ILRGAND YVDEMERS+HDS  V+KRVLESKSVVPG GACE A+ V+LE +AMT+ SREQ+A+AEFA+A+L IPKQLAVNAALDST+++++LRA H++SQ   +    K++GLDL    +SN KE GIFEP +SKIKSLKFATEAAITILRIDD++KL EEK    P
Sbjct:    1 MSANAATPLSLGGERVSGDSVRKQNVMAAISIANIVKTSLGPVGLDKMLVDDVGDVTITNDGATILKLLDVEQPAAKVLVQLAQLQDDEVGDGTTSVVILAAELLRNADELIAQRIHPTTIMSGYRLACREACKYIQNNLVLDSDALGKSCLVNAAKTSMSSKLITVDADFFANMAVEAVLAVKVPDGHGGFIYATKAINILKAHGRSMRESMLINGYALNCTIASQQMPRQIRNAKIAFLDFNLQKVKLKLGVQVLVSDPDKLEEIRNRESDITKERIQTILGAGANVVLTTGGIDDLCMKYFVKAGAMAVRRCKRVDLKRIAKATGGQLIVTMSNMDGEETFEPSFLGEAGEVVQERICDDELILIHDPKVRSAASIILRGANDLYVDEMERSLHDSLQVIKRVLESKSVVPGAGACETAVSVFLENFAMTMGSREQLAVAEFARAMLAIPKQLAVNAALDSTDLISRLRACHNTSQMKSENTDMKFWGLDLQKNCISNCKELGIFEPLVSKIKSLKFATEAAITILRIDDLIKLKEEKPVDDP 546          
BLAST of T-complex protein 1 subunit alpha vs. TrEMBL
Match: A0A068YEM2 (T complex protein 1 subunit alpha OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000826700 PE=3 SV=1)

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 401/546 (73.44%), Postives = 473/546 (86.63%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKP 1733
            MS+N  + L++GGER +GD+VR+QNV+A+ +IANIVKTSLGPVGLDKMLVDDVG+VTI+NDGATILKLL+VE PAAK+LV+LAQLQD+EVGDGTTSVVI+AAELL+ A+E I Q+IHPTTI+SGYR+ACREACKY+QNNL +D D LGK C+ +AAKTSMSSKLI +D+DFFANMAVEA +AVKV DG GGF Y  KAIN+LKAHG+SM+ESMLI+GYALNCTIASQQMPR IK AKIA LDF+LQK KLKLGVQVLV+DP+KLEEIR RESDITKE+I+ IL  GANV+LTTGGIDD+CMKYFVEA AMAVRRCK+VDLKRIAKATGG L V+++ MDGEE F+ + LG A +V QERICDDELILI   K RSAAS+ILRGAND YVDEMERS+HDS  V+KRVLESKSVVPG GACE A+ V+LE +AMT+ SREQ+A+AEFA+A+L IPKQLAVNAALDST+++++LRA H++SQ   +    K++GLDL    +SN KE GIFEP +SKIK LKFATEAAITILRIDD++KL EEK    P
Sbjct:    1 MSANAATPLSLGGERVSGDSVRKQNVMAAISIANIVKTSLGPVGLDKMLVDDVGDVTITNDGATILKLLDVEQPAAKVLVQLAQLQDDEVGDGTTSVVILAAELLRNADELIAQRIHPTTIMSGYRLACREACKYIQNNLVLDSDALGKSCLVNAAKTSMSSKLITVDADFFANMAVEAVLAVKVPDGHGGFIYATKAINILKAHGRSMRESMLINGYALNCTIASQQMPRQIKNAKIAFLDFNLQKVKLKLGVQVLVSDPDKLEEIRNRESDITKERIQTILGAGANVVLTTGGIDDLCMKYFVEAGAMAVRRCKRVDLKRIAKATGGQLIVTMSNMDGEETFEPSFLGEAGEVVQERICDDELILIHDPKVRSAASIILRGANDLYVDEMERSLHDSLQVIKRVLESKSVVPGAGACETAVSVFLENFAMTMGSREQLAVAEFARAMLAIPKQLAVNAALDSTDLISRLRACHNTSQMKSENTDMKFWGLDLQKNCISNCKELGIFEPLVSKIKCLKFATEAAITILRIDDLIKLKEEKPVDDP 546          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Cavefish
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:103041096])

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 377/542 (69.56%), Postives = 461/542 (85.06%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGD 1745
            L + G+RTTG++VR QNV+A+ +IANIVK+SLGPVGLDKMLVDD+G+VTI+NDGATILKLLEVEHPAAK+L ELA LQD+EVGDGTTSVVIIAAELLK A+E +KQKIHPT+IISGYR+AC+EA +Y+  NLTI  D LG+EC+ +AAKTSMSSK+IG+DSDFFANM V+A +AVK  DGKG  RYPI ++NVLKAHG+S KES L++GYALNCT+ SQ M + ++ AKIA LDFSLQK K+KLGVQV+++DPEKL++IR+RESDITKE+I+KIL +GANV+LTTGGIDDMC+KYFV+A AMAVRR    DLKRIAKATG ++C SL+ ++GEE F+   LG AE+V QER+CDDELIL+K  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIPK LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL N    +NK+AG++EP+M K KSLKFATEAAITILRIDD++KL  ++K   P   D
Sbjct:    8 LNVLGQRTTGESVRTQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGADDLGRECLVNAAKTSMSSKIIGVDSDFFANMVVDAALAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMLKRVQNAKIACLDFSLQKTKMKLGVQVVISDPEKLDQIRQRESDITKERIQKILASGANVVLTTGGIDDMCLKYFVDAGAMAVRRVLHRDLKRIAKATGATICPSLSNLEGEETFEATMLGQAEEVVQERVCDDELILVKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGGPSYQD 549          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Cavefish
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:103041096])

HSP 1 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 307/453 (67.77%), Postives = 378/453 (83.44%), Query Frame = 3
Query:  387 VIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGD 1745
            VIIAAELLK A+E +KQKIHPT+IISGYR+AC+EA +Y+  NLTI  D LG+EC+ +AAKTSMSSK+IG+DSDFFANM V+A +AVK  DGKG  RYPI ++NVLKAHG+S KES L++GYALNCT+ SQ M + ++ AKIA LDFSLQK K+KLGVQV+++DPEKL++IR+RESDITKE+I+KIL +GANV+LTTGGIDDMC+KYFV+A AMAVRR    DLKRIAKATG ++C SL+ ++GEE F+   LG AE+V QER+CDDELIL+K  KAR++AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIPK LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL N    +NK+AG++EP+M K KSLKFATEAAITILRIDD++KL  ++K   P   D
Sbjct:    6 VIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGADDLGRECLVNAAKTSMSSKIIGVDSDFFANMVVDAALAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMLKRVQNAKIACLDFSLQKTKMKLGVQVVISDPEKLDQIRQRESDITKERIQKILASGANVVLTTGGIDDMCLKYFVDAGAMAVRRVLHRDLKRIAKATGATICPSLSNLEGEETFEATMLGQAEEVVQERVCDDELILVKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGGPSYQD 458          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Cavefish
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:103028526])

HSP 1 Score: 325.479 bits (833), Expect = 5.581e-103
Identity = 198/519 (38.15%), Postives = 304/519 (58.57%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKE----CITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            N+ A Q IA  V+T+LGP G+DK++VD+ G+ TISNDGATILKLL+V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK  +  +++ +HP TII  +RIA + A K ++  + + V K  KE     +   A T+++SKLI    +FF+ M V+A M +           P+K I V K  G +++ES L+ G A   T +    +  P+     KIALL+  L+    K   +V V   E  + I   E +I  +K+EKI K+GA V+L+   I D+  +YF +       R ++ DLKR   A GGS+  S+ ++  +       LG  E   + ++  +     KGC      ++ILRG  + +++E ERS+HD+  +V+R +++ S+V GGGA E  L  YL  Y+ TI  ++Q+ I  +AKAL +IP+QL  NA  D+T ++ KLRA H             WYG+D+ N ++++N +A ++EP++ +I +L  A+EAA  IL +D+ +K
Sbjct:   45 NINACQVIAEAVRTTLGPRGMDKLIVDNRGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIK-EIAVTVKKDNKEEQRQLLEKCAATALNSKLIAGQKEFFSKMVVDAVMMLDE-------LLPLKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYDNPKIALLNIELELKAEKDNAEVRVKSVEDYQAIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVQEEDLKRTMMACGGSIQTSVGSLTDDV------LGQCELFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQGGM--------WYGVDVNNEDIADNFQACVWEPAIVRINALTAASEAACLILSVDETIK 541          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Cavefish
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:103036471])

HSP 1 Score: 266.159 bits (679), Expect = 8.578e-81
Identity = 193/540 (35.74%), Postives = 303/540 (56.11%), Query Frame = 3
Query:  129 GGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDD--VGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYR---IACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKL-GVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRK 1730
            G +    +  R  + + +  I ++VK++LGP G+DK+L+     G VT++NDGATILK + V++PAAK+LV+++++QD+EVGDGTTSV ++AAELL+ AE  I +KIHP  IISG+R    A REA +    +   D  K  +E + + ++T++SSKL+    D FA +AVEA + +K   G G     ++AI+V++  G S+ +S L  G+ L+  I   Q P+ ++   I + +  +   K+K+ G +V V    K+ EI   E +  KEK+E+ILK G N  +    I +   + F  A  MA+     V ++R+A  TGG +    +T D  E      LG+ + + +  I +D LI   G     A +++LRGA    +DE ERS+HD+ CV+ + ++    V GGG  E  +   +   A     +E +A+  FAKAL ++P  +A NA  DS ++VA+LRA H  ++          +GLD+T   + +  E GI E    K + +  A EAA  ILR+DD++K      PRK
Sbjct:   15 GADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLGGGREGSVTVTNDGATILKAIGVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHPQIIISGWRKATQAAREALRESAVDHGNDEVKF-QEDLLNISRTTLSSKLLTHHKDHFAKLAVEAVLRLK---GSGN----LEAIHVIQKLGGSLIDSYLDEGFLLDKKIGVNQ-PKRLENVNILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFAAAGVMAIEHADFVGVERLALVTGGEIT---STFDHPELV---KLGHCKLIEEVMIGEDTLIRFSGVAMGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKETRTVYGGGCSEMLMAKVVTDLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHQENKT--------TFGLDMTQGTIGDMAELGITESFQVKRQVVLSAAEAAEMILRVDDIIK----AAPRK 527          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Cavefish
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:103023813])

HSP 1 Score: 261.536 bits (667), Expect = 5.760e-79
Identity = 168/523 (32.12%), Postives = 288/523 (55.07%), Query Frame = 3
Query:  135 ERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAI-NVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV 1700
            +R +G  V+  N+ A++TIA++++T LGP  + KML+D +G + ++NDG  IL+ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L +AE+ ++Q++HPT +IS YR A  +    L+  ++  VD+  +  +     +++++K +   S    N+A++A   V++ +  G     IK    V K  G  +++S ++ G  +N  +   +M R IK  +I LLD SL+  K +    + +T  E   +I + E +  +   E I++   ++I T  GI D+   Y ++A   A+RR +K D  RIA+A G  +      +  E+    A L        ++I D+    +  CK   A +++LRGA+   + E+ER++ D+  V + VL    ++PGGGA E A+   L + +  ++  EQ      A+AL VIP+ L  N    +  ++  LRA H             W G++     +++  E GI+EP   K ++ K A E AI +LRIDD+V
Sbjct:   14 KRESGRKVQTGNINAAKTIADVIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVISAYRQALDDMLSMLK-EISTPVDQNDRSMMLKIINSAINTKALSRWSSLACNIALDAVRTVELEE-NGRKEIDIKKYAKVEKVPGGIIEDSCVLKGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEITREEDFAKILQMEEEYIQLICEDIIRLKPDLIFTEKGISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELREEDVGTGAGL-----FEVKKIGDEYFTFVTECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMAVSHRLTERSRALTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQE------GSTSW-GVNGETGTLADMVELGIWEPLAVKAQTYKTAVETAILLLRIDDIV 522          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 262.307 bits (669), Expect = 6.836e-81
Identity = 168/451 (37.25%), Postives = 256/451 (56.76%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGK----ECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMV 1499
            N+ A   +A+ V+T+LGP G+DK+++DD G+ TISNDGATILKLLEV HPA K LV++A+ QD EVGDGTTSV ++AAELLK   + +++ +HP  I   +R A   A + ++  +++ V K  K      +   A T++SSKL+    DFFA M V+   AV + D       P+  I + K  G  +++S L+ G A   T +    +  P+T    KIALL+  L+    +   +V VT+ +  + I   E  I  +K+ KI  +GA V+L+   I D+  +YF +       R  + DLKR   A GGS+  S+++M  +       LG  E   + +I  D     KGC      ++ILRG  + ++DE ERS+HD+  +V+R +++ SVV GGGA E  +  YL   + TI  +EQ+ +  +A+AL V P+QL  NA  D+T ++
Sbjct:   24 NITACLVVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILKLLEVVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKIK-EISVPVKKEDKGELRALLVKCAATALSSKLVSQQKDFFAAMVVD---AVSMLDE----LMPLNMIGMKKVQGGGLEDSHLVAGVAFKKTFSYAGFEMQPKTYAQPKIALLNVELELKAERENAEVRVTNVQDYQAIVDAEWGILYDKLAKIEASGARVVLSKLPIGDVATQYFADRDMFCAGRVVEEDLKRTMMACGGSIQTSVSSMTDD------VLGRCELFEEVQIGGDRYNFFKGCPQAKTCTIILRGGAEQFMDETERSLHDAIMIVRRAIKNDSVVGGGGAVEMEVSRYLRDVSRTIPGKEQMLLGAYARALEVPPRQLCDNAGFDATNVL 460          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 263.462 bits (672), Expect = 2.829e-80
Identity = 165/521 (31.67%), Postives = 299/521 (57.39%), Query Frame = 3
Query:  156 VRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGI-----DDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGC-KARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV 1700
            +R  N+ A++ IA+ ++TSLGP G+DKM+ D  G+VTI+NDGATILK ++V HPAAK+LVEL++ QD E GDGTTSVV+IA  LL  + + +++ IHPT I   ++ A  +A + L+ ++++ ++   ++ + ++A T+++SK++   +   A M+V+A M  KV D        +  I +++  G ++ +  L+ G  L   I++  + R ++ AKI L+ F L   K  +  Q++++D  +++ + + E   T   ++++ K G NV+L    I      D+ + +  + K M V+  ++ D++ I K  G      +A++D    F    L  AE V +  +   +++ + GC       S+++RG+N   ++E ERS+HD+ CV++ +++ ++++ GGGA E  L + L +YA T+SS E   +  + +A+ VIP  LA NA L+    V +LR  H   +        K  G+++    +SN  E  + +P +  + ++  +TE   +IL+IDD+V
Sbjct:   40 IRSSNICAAKAIADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILE-SMSLPLELSDRQSLLNSATTALNSKVVSQYASLLAPMSVDAVM--KVIDPATATSVDLNDIKLIRKLGGTIDDCELVEGLVLTQRISNTGIIR-VEKAKIGLIQFCLSPPKTDMENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTK---PIASVD---HFTAEMLASAELVEEVSVGSSKVVKVTGCANPGKTMSILVRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEAYCVRAYGEAMEVIPYTLAENAGLNPISTVTELRNRHAQGE--------KTAGINVRKGGISNILEELVVQPLLVSLSAVSLSTETVRSILKIDDIV 542          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 245.743 bits (626), Expect = 1.024e-73
Identity = 171/538 (31.78%), Postives = 294/538 (54.65%), Query Frame = 3
Query:  138 RTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQN-NLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERI--CDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWY-GLD-LTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPG 1736
            R +G +  + +++A++++A+ ++TSLGP GLDKM+V   G++T++NDGATIL +++VEH  AK++VEL++ QD+E+GDGTT VV++A  LL+ AE+ + + IHP  I  GY  A R A  +L +   +  VD    E +   A T++ SK++       A +AV A ++V   + K       + I V    G  + ++ LI G  ++   +  QMP+ +  AKIA+L    +  K K   ++ VT  E  + + + E +   E + ++ +TGAN+ +   G DD      ++ +  AVR     +++ IA ATGG +    + +  ++      LG+A  V +       D +++I+ C    A ++ +RG N   ++E +RSIHD+ CV++ ++    VV GGG+ E +  + + + A   ++ EQ A+  FA AL VIP  LA N+ L+S   +A++R     S+Q   LA  K Y G++ + + +  + KE  + E  + K + +  AT+    IL+IDD+         R PG
Sbjct:   27 RLSGLDALKSHIMAAKSVASTLRTSLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQVAKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTESLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVADLERKD---VDFELIKVEGKVGGRLDDTALIKGVVVDKDFSHPQMPKEVINAKIAILTCPFEPPKPKTKHKLDVTCVEDYKALLQYEKEKFAEMVRQVKETGANLAICQWGFDDEANHLLLQNQLPAVRWVGGHEIELIAIATGGRIVPRFSELTADK------LGHAGIVRELSFGTTKDHMLVIEQCHNSRAVTIFIRGGNKMIIEEAKRSIHDALCVIRNLVRDNRVVYGGGSAEISCSLAVSEAADKCATLEQYAMRAFADALEVIPMALAENSGLNSIGALAEVR-----SRQ---LAEKKPYLGINCMQSSSKGDMKEQHVIETLIGKKQQISLATQMVKMILKIDDI---------RSPG 538          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002042.1 (pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 gene:ENSPMAG00000001837.1 transcript:ENSPMAT00000002042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 1.335e-56
Identity = 122/378 (32.28%), Postives = 214/378 (56.61%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAI-NVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGAN 1250
            L+   +R +G  V++ N+ A++ IA++++T LGP  + KML+D +G + ++NDG  IL+ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L +AE+ ++Q++HPT IIS YR A  +    L++  ++ VD   +  +    K+++ +K +   S+    +A++A + V+  D  G     IK    + K  G  ++ES ++ G  LN  +   +M R I+  +I LLD SL+  K +    + ++  E   +I + E D  ++    I++   +++ T  GI D+   + V+A   A+RR +K D  RIA+A G  +    +    E+    A L        ++I DD    I  CK   A +++LRGA+
Sbjct:   12 LSQNTKRESGRKVQQGNISAAKMIADVIRTCLGPRAMMKMLMDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLAVAEQFLEQQMHPTVIISAYRKALEDMLSTLKDISSVAVDVTDRVMMLRIVKSAIDTKALSRVSELACGIALDAVLTVQREDN-GRREIDIKNYAKIEKVPGGILEESCVLRGVMLNKDVTHPRMRRRIETPRILLLDCSLEFKKGESQTDIEMSREEDFAKILQAEEDYIQQICADIVRLKPDLLFTEKGISDLAQHFLVKANITAIRRIRKTDNNRIARACGARIVSRTSDAKEEDVGTGAGL-----FEVKKIGDDYFTFITECKDPKACTILLRGAS 383          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 1.635e-38
Identity = 88/213 (41.31%), Postives = 140/213 (65.73%), Query Frame = 3
Query:  129 GGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLV--DDVGE--VTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQ---NNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHG 746
            G +    +  R  + + +  I ++VK++LGP G+DK+L+     GE  VT++NDGATILK + V++PAAKILV+++++QD+EVGDGTTSV ++AAELL+ AE  I +KIHP TII+G+R +   A K L+    +   D +K   + + + ++T++SSKL+    D FA +AVEA + ++   GKG     ++AI+V+K  G ++ +S L  G
Sbjct:   13 GADEEKAETARLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHPQTIITGWRKSTAAAGKALELAAVDHGHDKEKFHVDLL-NISRTTLSSKLLTHHKDHFAKLAVEAVLRLR---GKG----TLEAIHVIKKLGGTLLDSYLDEG 217          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Yeast
Match: TCP1 (Alpha subunit of chaperonin-containing T-complex; complex mediates protein folding in the cytosol; involved in actin cytoskeleton maintenance; overexpression in neurons suppresses formation of pathogenic conformations of huntingtin protein [Source:SGD;Acc:S000002620])

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 325/547 (59.41%), Postives = 423/547 (77.33%), Query Frame = 3
Query:  111 TSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGA--KIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQF-PD---LAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKP 1733
            +  L +GGE+ +GD++R QNVLA+  +AN+VK+SLGPVGLDKMLVDD+G+ T++NDGATIL LL+V+HPA KILVELAQ QD E+GDGTTSVVIIA+ELLK A E +K KIHPTTII+G+R+A REA +++   L+  VD LGKE + + AKTSMSSK+IG DSDFF+NM V+A +AVK  + KG  +YP+KA+NVLKAHGKS  ES+L+ GYALNCT+ASQ MP+ I G   KIA LD +LQKA++ +GVQ+ + DPE+LE+IRKRE+ I  E+++KI+  GA V+LTT GIDD+C+K FVEAK M VRRCKK DL+RIA+ATG +L  S++ ++GEE F+ + LG  ++V Q +  DDE ILIKG    S++S+ILRGAND+ +DEMERS+HDS  VVKR LES +VVPGGG  EAAL++YL+ +A T+ SREQ+AIAEFA ALL+IPK LAVNAA DS+E+VAKLR+ H +SQ   P+      ++ YGLDL    + +   AG+ EP++SK+KSLK A EA + ILRID M+ +D E     P
Sbjct:   10 SDTLFLGGEKISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECILIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDP 556          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Yeast
Match: CCT7 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000003647])

HSP 1 Score: 288.115 bits (736), Expect = 8.579e-90
Identity = 183/517 (35.40%), Postives = 288/517 (55.71%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDV---DKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV 1700
            N+ A   +   +K +LGP+G D ++V    + TISNDGATILKLL+V HPAAK LV++++ QD EVGDGTTSV I+A EL+K A+  +++ I    I+ GYR A   A + + N L +D+      G+E +   A+T+MSSKLI  ++DFF  M V+A +++  +D         K I + K  G +M+ES+ I+G A   T +    +Q P+     KI  L+  L+    K   +V V   E  + I   E  +  EK+ ++ +TGAN++L+   I D+  ++F +       R    D+ R+ +A GGS+  + + +  E      +LG      + +I  +   L +GC      +++LRG  +  + E+ERS+HD+  +VKR L++K +V GGGA E  +   L  Y+ TI+ ++Q+ I  FAKAL VIP+QL  NA  D+ E++ KLR  H   +        KWYG+     N+ +N    ++EP++ KI +L  ATEA   IL +D+ +
Sbjct:   29 NINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKI-NELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAVLSLDRND------LDDKLIGIKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFNNPKILSLNVELELKAEKDNAEVRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLSKLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPE------HLGTCALFEEMQIGSERYNLFQGCPQAKTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHSKGE--------KWYGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETI 524          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 255.373 bits (651), Expect = 3.196e-77
Identity = 172/533 (32.27%), Postives = 294/533 (55.16%), Query Frame = 3
Query:  135 ERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQ---NNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTI------KGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERI--CDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV 1700
            +R  G   ++ ++LA++++A+I+KTSLGP GLDK+L+   GE+TI+NDGATIL  +E+++  AK+LV+L++ QD+E+GDGTT VV++A+ LL  A E I++ IHP  I +G+  A + A   L+   ++++   D+L ++ +  AAKTS+ SK++  D D FA MAVEA + V   D K         I +    G S+ +S LI+G  L+   +  QMP+ +       G K+A+L    +  K K   ++ ++  E+ ++++  E D  KE I+ + K GA+V++   G DD      ++    AVR     +L+ IA +T G +      +  ++      LG    + ++      D +++I+  K     +  +RG+N   VDE ER++HDS CVV+ +++   VV GGGA E  + + + + A      +Q A   FA+AL  IP  LA N+ LD    ++ L+     S+Q  +       G+D   +  ++ KE  + +P + K + +  AT+    IL+ID+++
Sbjct:   39 KRQHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKD---VDFDLIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDK------LGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLK-----SKQLKE--KISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVI 555          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 252.677 bits (644), Expect = 1.164e-76
Identity = 179/544 (32.90%), Postives = 293/544 (53.86%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCT-IASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGI-----DDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELIL----IKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDM 1697
            MS+ V SN A    +     VR+ N++A++++A+ ++TSLGP G+DKM+    GE+ ISNDG TILK + + HP A++LVE++  QD E GDGTTSVVI+   LL  AE  + + IHPT I   ++ A + +   L   +   V    +E +  AA TS+SSK++   S F A +AV++ +  K+SD +      +  I ++K  G ++ ++ +I G  L  T I S   P   + AKI L+ F +   K      ++V D  ++++I K E        +KI K   NV+L    I     +D+ + +  +   M V+  ++ +++ ++K  G   C  +A +   E F +  LG A D+ +E   D   I+    I+   AR   SV++RGAN+  +DE ERS+HD+ CV++ +++ + ++ GGGA E  +   L K A ++   +     EFA AL VIP  LA NA L+S ++V +LR+  H + +  D       G+ +     +N  E  I +P +    ++  A+E   +ILRIDD+
Sbjct:    1 MSAKVPSN-ATFKNKEKPQEVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILL-EMCHKVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVL--KISD-ENSKNVDLNDIRLVKKVGGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLG---CKPIADI---ELFTEDRLGSA-DLVEEIDSDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRS-KHENGELND-------GISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDI 524          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Yeast
Match: CCT2 (Subunit beta of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000001404])

HSP 1 Score: 243.047 bits (619), Expect = 5.101e-73
Identity = 179/549 (32.60%), Postives = 297/549 (54.10%), Query Frame = 3
Query:  117 NLAIGGERTT---GDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEV-TISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQ-KIHPTTIISGYRIACREACKYLQNNLTIDV--DK-LGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKL-GVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQAN---LGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPR 1727
            ++ I G++ T    +N R    + +  + ++VK++LGP G+DK+L         ++NDGATILK + +++PAAK+LV ++++QD+EVGDGTTSV +++AELL+ AE+ I Q KIHP TII GYR+A   A         +D   DK + +E +   AKT++SSK++  D D FA +A  A + +K S         ++ I ++K  G  + +S L  G+ L     + Q P+ I+ AKI + + +L   K+K+ G +  V    KL ++ K E +  K KI KI K G N  +    I D   + F +    ++       ++R+A  TGG +  +         FD+ +   LG  + + +  + +   +   GCKA  A +++LRGA D  +DE ERS+HD+  V+ +  +    V GGG  E  +   ++  A  I  ++ +A+  FA+AL  +P  LA NA  DS+E+V+KLR+  ++             GLDL N  +++ ++ GI E    K   +  A+EAA  +LR+D++++     +PR
Sbjct:    2 SVQIFGDQVTEERAENARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAAALDA-LTKAAVDNSHDKTMFREDLIHIAKTTLSSKILSQDKDHFAELATNAILRLKGSTN-------LEHIQIIKILGGKLSDSFLDEGFILAKKFGNNQ-PKRIENAKILIANTTLDTDKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTFINRQLIYDYPEQLFTDLGINSIEHADFEGVERLALVTGGEVVST---------FDEPSKCKLGECDVIEEIMLGEQPFLKFSGCKAGEACTIVLRGATDQTLDEAERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQNIDGKKSLAVEAFARALRQLPTILADNAGFDSSELVSKLRSSIYNG--------ISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEAAEVLLRVDNIIR----ARPR 520          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Nematostella
Match: EDO39756 (T-complex protein 1 subunit alpha [Source:UniProtKB/TrEMBL;Acc:A7S924])

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 344/488 (70.49%), Postives = 418/488 (85.66%), Query Frame = 3
Query:  258 EVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKK 1721
            +VT++NDGATILKLLEVEHPAAKIL ELA LQD+EVGDGTTSVVI+AAELLK A E +KQKIHPT+IISGYR+AC+EACKY+Q ++TI VD+LG++CI SAA T++SSKLIG   DFFANM V+A MAVK +  KG  +YPIKAINVLKAHG S KES+L+ GYALNCTIASQ MP+ +  AKIA LDF+LQKAK+ LGV V+V DPEKLE IRKRESDITKE+I+KIL +GANV+L+TGGIDD+C+KYFVE  AMAVRR KK DLKRIA++TG ++ +SLA ++GEE+FD + LG AE+V Q+RICDDELI+IKG KARS++S+ILRGAND+ +DEMERS+HD+ CVVKRVLESK++VPGGGA EAAL +YLE +A ++ SREQ+AIAEFA +LLVIPK L+VNAA DS ++VAKLRA H++SQ   + +H KW GLDL    V +NK+AG+FEP++ KIKSLKFATEAAITILRIDDM+KL  EKK
Sbjct:    1 DVTVTNDGATILKLLEVEHPAAKILCELADLQDQEVGDGTTSVVILAAELLKGANELVKQKIHPTSIISGYRLACKEACKYIQEHMTISVDELGRDCIVSAANTALSSKLIGQQGDFFANMIVDAVMAVKRTGNKGEAKYPIKAINVLKAHGGSAKESILVDGYALNCTIASQAMPKQVTNAKIACLDFTLQKAKMHLGVSVVVDDPEKLEAIRKRESDITKERIQKILASGANVVLSTGGIDDLCLKYFVECGAMAVRRVKKGDLKRIARSTGATMVLSLANLEGEESFDASMLGQAEEVCQQRICDDELIVIKGTKARSSSSIILRGANDYMLDEMERSMHDAICVVKRVLESKTLVPGGGAVEAALSIYLENFATSLGSREQLAIAEFANSLLVIPKILSVNAAKDSADLVAKLRAFHNTSQINAERSHLKWIGLDLVEGTVRDNKKAGVFEPAICKIKSLKFATEAAITILRIDDMIKLTPEKK 488          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Nematostella
Match: EDO48692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF0])

HSP 1 Score: 317.39 bits (812), Expect = 1.183e-100
Identity = 191/532 (35.90%), Postives = 306/532 (57.52%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLG----KECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCG 1742
            N+ A Q IA+ V+T+LGP G+DK++VD  G+ TISNDGATI+ LL++ HPAAK LV++A+ QD EVGDGTTSV ++  E LK  ++ +++ +HP  I+  YR A   A K ++  L + V K      ++ +   A T++SSKLI    +FFA M V+A M +           P+  I + K  G ++++SMLI G A   T +    +  P+T    KIALL+  L+    K   +V + + +  + I   E DI  +K++K++K+GA V+L+   I D+  +YF +       R  + DLKR  KA GG++  S+ +M  +       LG  +   ++++  +      GCK  +  ++I+RG  + +++E ERS+HD+  +V+R +++ +VV GGGA E  L  YL  Y+ TI+ +EQ+ I   AKA  +IP+QL  NA  D+T ++ KLR  H    Q        WYG+D+   ++++N EA ++EP++ KI ++  ATEA+  IL +D+ +     K P+  G G
Sbjct:   24 NIDACQFIADAVRTTLGPRGMDKLIVDGRGKATISNDGATIINLLDIVHPAAKTLVDIAKSQDAEVGDGTTSVTLLTGEFLKQVKQFVEEGVHPQIIVKSYRKAANLAIKRIK-ELAVHVKKNDAGEMRQLLERCAATALSSKLIATQKEFFAKMVVDAVMMLDE-------LLPLDMIGMKKVSGGALEDSMLIEGVAFKKTFSYAGFEMQPKTYNHCKIALLNVELELKAEKENAEVRLDNVKDYQSIVDAEWDILYDKLDKVVKSGAKVVLSKLPIGDVATQYFADRDMFCAGRVTEEDLKRTMKACGGAIQTSVNSMTDDV------LGRCDLFEEKQVGGERYNFFSGCKQSTTCTIIMRGGAEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIEMELSKYLRDYSRTIAGKEQLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQKHFQGGQ--------WYGVDINREDIADNFEACVWEPAVVKINAITAATEASCLILSVDETI-----KNPKSGGDG 528          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Nematostella
Match: EDO35415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL4])

HSP 1 Score: 265.003 bits (676), Expect = 1.155e-80
Identity = 162/526 (30.80%), Postives = 292/526 (55.51%), Query Frame = 3
Query:  135 ERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAIN---VLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQ-ERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV 1700
            +R +G  V+  NV A++TIA+I++T LGP  + KML+D +G + ++NDG  IL+ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E + +AE  ++Q++HPT II+ YR+A  +    L+  +++ VD   +E +    ++S+ +K I    D   N+A++A   V +  G    R  I   N   V K  G  +++S ++ G  +N  +   +M R I+  +I LLD +L+  K +    + ++       + + E +  K+  ++++    ++++T  GI D+   + ++A   A+RR +K D  RIA+A G ++      ++  E   + ++G    + +  +  D+    I  C    A +++LRGA+   ++E+ER++ D+  V + V+    +VPGGGACE AL   L + A  ++  +Q      AK L VIP+ L  N   ++   +  LRA H +        +  W G+D  +  + + +E G+++    K ++ K A E A+ +LRIDD+V
Sbjct:   11 KRESGRKVQLGNVQAAKTIADIIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQISVPVDIDNREEMLKIIRSSVGTKFINKWGDLACNIALDAVKTVALDRGD---RKEIDIKNYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEKGISDLAQHFLMKANITAIRRVRKTDNNRIARACGATI------VNRTEELKEEDIGTGAGLFEVNKFGDEYFTFITECNNPKACTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRAKHAAE------GNTSW-GIDGESGQIVDMQELGVWDTYAVKAQTFKTALETAMLLLRIDDIV 520          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Nematostella
Match: EDO34981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT1])

HSP 1 Score: 264.233 bits (674), Expect = 1.621e-80
Identity = 193/556 (34.71%), Postives = 305/556 (54.86%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKML--VDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQN---NLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLK-LGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGD 1745
            +S N  S L  G E    +  R  + + +  I ++VK++LGP G+DK+L      G + ++NDGATILK + +++PAAKILVEL+++QD+EVGDGTTSV ++ +ELLK AE+ +  KIHP TI++G+R + + A K L+    + + D +K  +E + + A+T++SSK++    D FA +AV+A + +K   G G     + AI ++K  G  M +S L  G+ L+  I   Q P+ I+ AKI + +  +   K+K  G +V V    K+ ++   E    KEK+E I+K   N  +    I +   + F +A  MA+       ++R+A  TGG +  +          D   LG  + + +  I +D+LI   GC    A +V++RGA    +DE ERS+HD+ CV+ + ++    V GGGA E  +   + + A     +E  A+  FA AL  +P  +A NA  DS ++VAKLRA H   +          YGL++ N  V + ++ GI E    K + L  A EAA  I+R+D++VK      PR+ G GD
Sbjct:    2 VSLNPVSILNQGAEEERAETARLSSFVGAIAIGDLVKSTLGPKGMDKILQSFGQNGNIQVTNDGATILKSIGIDNPAAKILVELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKALEAAAVDHSSDPEKF-REDLMNIARTTLSSKILVQHRDHFAKLAVDAVLRLK---GSG----DLNAIQIIKKLGGGMVDSFLDEGFLLDKKIGVNQ-PKKIENAKILIANTPMDADKIKVFGSRVRVDSTAKIADLEMAEKQKMKEKVEMIIKHDINCFINRQLIYNYPEQLFADAGVMAIEHADFEGVERLALVTGGEIVSTFGRP------DLVKLGTCKKIEEVMIGEDKLIHFSGCALNEACTVVIRGATQQILDEAERSLHDALCVLTQTVKETRTVNGGGASEVLMAHAVSQLAAKTPGKEAAAMESFATALRQLPTIIADNAGYDSADLVAKLRAAHTQGKN--------TYGLNMVNGTVGDMRDLGITESYQVKRQVLLSAAEAAEMIVRVDNIVK----AAPRQRG-GD 529          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Nematostella
Match: EDO49571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP0])

HSP 1 Score: 263.077 bits (671), Expect = 7.374e-80
Identity = 173/526 (32.89%), Postives = 294/526 (55.89%), Query Frame = 3
Query:  135 ERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQ---NNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERI--CDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDM 1697
            +R TG   ++ ++LA++ +A+I+KTSLGP G+DKM+V   GEVT++NDGATIL ++EV+H  AK++VEL++ QD E+GDGTT VV++A  LL+ AE+ +   IHP  I  GY +A + A +++    +N  +D D   KE +   A T++ SK++       A +AV+A ++V   + K       + I V    G  + +++L+ G  ++  ++  QMP+ +K AKIA+L    +  K K   ++ V   E  +++++ E +   E I+++  TGAN+ +   G DD      ++    AVR     +++ IA ATGG +    + +  E+      LG A  V +       D++++I+ C    A ++ +RG N   V E +RSIHD+ CVV+ ++    VV GGGA E +  + + K A  IS+ EQ A+  +A AL  IP  LA N+ L+  + VA +++    +++ P L      G+D  +  +++ K   + E  + K + +  AT+    IL+IDD+
Sbjct:   32 KRLTGLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPVDKDN--KESLIQTAMTTLGSKIVSRCHRPLAEIAVDAVLSVADLERKD---VDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEK------LGKAGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKISTIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKS-RQVAEKNPRL------GVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDI 539          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Medaka
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:101175451])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 367/534 (68.73%), Postives = 453/534 (84.83%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKK 1721
            L + G+R+TG++VR QNV+A+ +IANIVK+SLGP GLDKMLVDD+G+VTI+NDGATILK+LEVEHPAAK+L ELA LQD+EVGDGTTSVVI+AAELLK A+E +KQKIHPT++I+GYR+AC+EA +Y+  NLTI  D LG+EC+ +AAKTSMSSK+I +DSDFFANM V+A +AVK  D KG  +YPI ++NVLKAHG+S +ES L++GYALNCT+ SQ M + I  AKIA LDFSLQKAK+K+GVQV+++DPEKL++IR+RESDITKE+I+KIL  GANV+LTTGGIDDMC+KYFV++ AMAVRR  K DLKRIAKATG  +C SL+ ++GEE F+   LG AE+V QERICDDELIL+K  K RS+AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ SREQ+AIAEFA++LLVIPK LAVNAA DST++VAKLRA H+ +Q  P+  + KW GLDL N    +N++AG++EP+M K KSLKFATEAAITILRIDD++KL  E K
Sbjct:    8 LNVFGQRSTGESVRTQNVMAAASIANIVKSSLGPYGLDKMLVDDIGDVTITNDGATILKMLEVEHPAAKVLCELADLQDKEVGDGTTSVVILAAELLKSADELVKQKIHPTSVINGYRLACKEAVRYINENLTIGTDDLGRECLINAAKTSMSSKIIKVDSDFFANMVVDAALAVKFVDSKGVAKYPINSVNVLKAHGRSQEESFLVNGYALNCTVGSQGMVKRIVNAKIACLDFSLQKAKMKMGVQVIISDPEKLDQIRQRESDITKERIQKILAAGANVVLTTGGIDDMCLKYFVDSGAMAVRRVLKRDLKRIAKATGAIVCPSLSNLEGEETFETTMLGQAEEVVQERICDDELILVKNTKVRSSASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLNGKPRDNRQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPEPK 541          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Medaka
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:101175451])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 339/534 (63.48%), Postives = 424/534 (79.40%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKK 1721
            L + G+R+TG++VR QNV+A+ +IANIVK+SLGP GLDKMLVDD+G+VTI+NDGATILK+LEVEHPAAK+L ELA LQD+EVGDGTTSVVI+AAELLK A+E +KQKIHPT++I+GYR+AC+EA +Y+  NLTI  D LG+EC+ +AAKTSMSSK+I +DSDFFANM V+A +AVK  D KG  +YPI ++NVLKAHG+S +ES L++GYALNCT+ SQ M + I  AKIA LDFSLQKAK+K+GVQV+++DPEKL++IR+RESDITKE+I+KIL  GANV+LTTGGIDDMC+KYFV++ AMAVRR  K DLKRIAKATG  +C SL+ ++GEE F+   LG AE+V QERICDDELIL+K  K RS+AS+ILRGANDF  DEMERS+HD+ CVVKRVLESKSVVPGGGA EAAL +YLE YA ++ S    +  +    L   P     + A  +T    KLR+  ++      +      GLDL N    +N++AG++EP+M K KSLKFATEAAITILRIDD++KL  E K
Sbjct:    8 LNVFGQRSTGESVRTQNVMAAASIANIVKSSLGPYGLDKMLVDDIGDVTITNDGATILKMLEVEHPAAKVLCELADLQDKEVGDGTTSVVILAAELLKSADELVKQKIHPTSVINGYRLACKEAVRYINENLTIGTDDLGRECLINAAKTSMSSKIIKVDSDFFANMVVDAALAVKFVDSKGVAKYPINSVNVLKAHGRSQEESFLVNGYALNCTVGSQGMVKRIVNAKIACLDFSLQKAKMKMGVQVIISDPEKLDQIRQRESDITKERIQKILAAGANVVLTTGGIDDMCLKYFVDSGAMAVRRVLKRDLKRIAKATGAIVCPSLSNLEGEETFETTMLGQAEEVVQERICDDELILVKNTKVRSSASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMVSLLYSSPLQSLLVLFWTPLTWWPSFAPSTT----KLRSTRNARTSNGKI------GLDLLNGKPRDNRQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPEPK 531          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Medaka
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:101173660])

HSP 1 Score: 313.923 bits (803), Expect = 1.691e-98
Identity = 190/518 (36.68%), Postives = 298/518 (57.53%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQN---NLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            N+ A Q IA  V+T+LGP G+DK++VD  G+ TISNDGATILKLL+V HPAAK LV++A+ QD EVGDGTTSV ++AAE L+  +  +++ +HP TII  +R A   A   ++    ++  D  +  ++ +   A T+++SKLI    +FF+ M V+A M++            +K I + K  G ++++S L+ G A   T +    +  P+     KIALL+  L+    K   +V V   E+ + I   E +I  +K+EKI ++GA V+L+   I D+  +YF +       R ++ DLKR   A GGS+  S+       A  +  LG  E   + ++  +     KGC      ++ILRG  + + +E ERS+HD+  +V+R +++ S+V GGGA E  L  YL  Y+ TI  ++Q+ I  +AKAL +IP+QL  NA  D+T ++ KLRA H             WYG+D+ N ++++N  A ++EPS+ +I +L  A+EAA  IL +D+ +K
Sbjct:   52 NINACQVIAEAVRTTLGPRGMDKLMVDARGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLRQLKPFVEESLHPQTIIRAFRTATNLAVSKIKEIAVSVKKDDKQEQRQLLEKCAATALNSKLIAGQKEFFSKMVVDAVMSLDE-------LLSLKMIGIKKVQGGALEDSQLVSGVAFKKTFSYAGFEMQPKRYDNPKIALLNVELELKAEKDNAEVRVKSVEEYQAIVDAEWNILYDKLEKIYQSGAKVVLSKLPIGDVATQYFADRDLFCAGRVQEEDLKRTMMACGGSIQTSVG------ALTEDVLGLCEVFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFTEETERSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQGGM--------WYGVDINNEDIADNFAAFVWEPSIVRINALTAASEAACLILSVDETIK 548          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 271.937 bits (694), Expect = 6.027e-83
Identity = 178/530 (33.58%), Postives = 297/530 (56.04%), Query Frame = 3
Query:  135 ERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGI-----DDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICD--DELILIKGCKARS-AASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV 1700
            +R     +R  N+ A++ +A+ V+TSLGP G+DKM+ D+ G+VTI+NDGATILK ++V HP+AK+LVEL++ QD E GDGTTSVVIIA  LL+   + +++ IHPT I   ++ A  +  + L N ++  V+   +E + ++A TS+ SK++   S   A M+V+A M  +V D        +  I ++K  G ++ +  L+ G  L   +AS  + R ++ AKI L+ F L   K  +  Q++V+D  +++ + + E       ++++ K G NV+L    I      D+ + +  + K M V+  ++ +++ I K  G      +A +D    F    LG AE +++E   D   +L+ I GC +     S+++RG+N   +DE ERSIHD+ CV++ +++ ++++ GGGA E  L V L +Y+ T++  E   +  +  AL VIP  LA NA L+    V +LR  H            K  G+++    +SN  E  + +P +  I +L  ATE   +IL+IDD+V
Sbjct:   23 DRDKPAQIRFSNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVL-NGMSRPVELSDRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVM--RVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVLTQRVASTGVTR-VEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTK---PIAHID---HFTPEMLGTAE-LAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQGD--------KMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVV 533          
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Medaka
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:105355033])

HSP 1 Score: 261.151 bits (666), Expect = 8.472e-79
Identity = 173/537 (32.22%), Postives = 292/537 (54.38%), Query Frame = 3
Query:  135 ERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAI-NVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCG 1742
            +R +G  V+  N+ A++ IA++++T LGP  + KML+D  G + ++NDG  IL+ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L +AE  ++Q++HPT IIS YR A  +  + L+  ++  VD   +  +     +++++K +   SD    +A++A   V++ +  G     IK    V K  G  +++S ++ G  +N  +   +M R IK  +I LLD SL+  K +    + ++  E    I + E D  ++  E I++   ++I T  GI D+   Y V+A   A+RR +K D  RIA+A G  +      +  E+    A L        ++I D+    I  CK   A +++LRGA+   + E+ER++ D+  V + VL    ++PGGGA E A+   L + +  ++  EQ      A+AL VIP+ L  N    +  ++  LRA H          +  W G++  +  +++    GI+EP   K ++ K A E AI +LRIDD+V    +KK +  G G
Sbjct:   14 KRESGRKVQTGNISAAKMIADVIRTCLGPRAMMKMLLDPTGGIVMTNDGNAILREIQVQHPAAKTMIEISRTQDEEVGDGTTSVIILAGEMLSIAEHFLEQQMHPTVIISAYRQALEDMLEALK-EVSTPVDTSDRSMMLKIVNSAINTKALFRWSDLACTIALDAVRTVELEE-NGRKEIDIKNYAKVEKVPGGFIEDSCVLKGVMINKDVTHPKMRRMIKNPRIVLLDCSLEYKKGESQTDIEISKEEDFSRILQMEEDYIQQICEDIVRLKPDLIFTEKGISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGLGAGL-----FEVKKIGDEYFTFITECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPFLLPGGGAVEMAVSKRLTERSRALTGIEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQE------GNVGW-GINGESGCLTDMSTLGIWEPLAVKAQTYKTAVETAILLLRIDDIVS-GHKKKDKADGQG 535          
BLAST of T-complex protein 1 subunit alpha vs. Planmine SMEST
Match: SMESG000067696.1 (SMESG000067696.1)

HSP 1 Score: 1098.96 bits (2841), Expect = 0.000e+0
Identity = 551/551 (100.00%), Postives = 551/551 (100.00%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD 1748
            MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDITKEKIEKILKTGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD
Sbjct:    1 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDITKEKIEKILKTGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGDD 551          
BLAST of T-complex protein 1 subunit alpha vs. Planmine SMEST
Match: SMESG000050684.1 (SMESG000050684.1)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 409/543 (75.32%), Postives = 480/543 (88.40%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDG-EEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKK 1721
            M+SNV S+L+I G+RTTGDN+RRQNVLA+ T+ANI+K+SLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQD+EVGDGTTSVV+IAAELLK AEEQ+  KIHPT +ISGYRIACREACKY+ NNL ++VD LG ECI +AAKTSMSSKLIG+DS+FFA MAVEA MAVK  +G G F YPI +IN+LKAHGKSM+ES +++GYA+NCT++S QMPR I  AKIALLDF+LQK +LKLGVQ+LVTDP+KL+EIRKRESDITKE+IEKILK GANVILTTGGIDD+CMKYFVE+  MAVRRCKKVDLKRIAKATGGSL  +++T+D  EE++D + LG AE+V Q R+CDDE+I+IK  K RSAAS++LRGANDFYVDEMERS+HD+ CV+KRVLESKSVVPGGGACE AL V+LE +A TI S+EQIAIAE+A++LL IPKQLAVNA+LDSTE++++L+A HHSSQ     +  KW GLDL N  ++NNK AGIFEP+M KIKSLKFATEAAITILRIDD+VKL EEK+
Sbjct:    1 MASNVLSSLSIDGDRTTGDNIRRQNVLAAVTVANIIKSSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDDEVGDGTTSVVLIAAELLKNAEEQVSGKIHPTILISGYRIACREACKYIMNNLVLNVDDLGPECIINAAKTSMSSKLIGVDSNFFAKMAVEAAMAVKTPNGDGTFYYPINSINILKAHGKSMRESEIVNGYAINCTVSSLQMPRYINKAKIALLDFNLQKTRLKLGVQILVTDPDKLDEIRKRESDITKERIEKILKAGANVILTTGGIDDLCMKYFVESNTMAVRRCKKVDLKRIAKATGGSLLCTMSTLDKEEESYDPSMLGEAEEVFQRRVCDDEMIIIKNTKTRSAASILLRGANDFYVDEMERSMHDALCVIKRVLESKSVVPGGGACEVALSVFLEDFATTIGSKEQIAIAEYARSLLTIPKQLAVNASLDSTELLSQLQASHHSSQNEEGKSDLKWMGLDLQNCTIANNKAAGIFEPTMIKIKSLKFATEAAITILRIDDLVKLKEEKR 543          
BLAST of T-complex protein 1 subunit alpha vs. Planmine SMEST
Match: SMESG000079886.1 (SMESG000079886.1)

HSP 1 Score: 294.278 bits (752), Expect = 2.017e-91
Identity = 184/539 (34.14%), Postives = 304/539 (56.40%), Query Frame = 3
Query:  168 NVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKEC-----ITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIAS---QQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMV-----KLDEEKKPRK-PGCG 1742
            N+ A Q+IA  V+T+LGP G+DK+++D+  + TISNDGATILKLL+V HP A  +V++A  QD+EVGDGTTSV+++A+E LK A+  I++ +HP  I   Y+ A + A  YL N L++ +++ G E      +   A T++SSKL+    DFF+ + V+A  ++           P+  I + K  G S+++S LI G A   T +    +  P++    KI+LL+  L+    K   ++ V   E+ + I   E  I  +K+E I K+GA ++L+   I D+  +YF +       R  + DLKR   A GG +  ++  +       +  LG  +   + +I  +   +  GC      ++ILRG ++ +++E ERS+HD+  +V+R +++ +VV GGGA +  +  YL  Y+  I  R+Q+ I+  AK+  +IP+QL  NA  D+T ++ KLR  H   +         W G+D+ N +V++N EA ++EP++ K  ++  ATEAA  +L +D+ +     K  E+ +P K PG G
Sbjct:   26 NITAIQSIAEAVRTTLGPRGMDKLIIDEKSKATISNDGATILKLLDVIHPVAGTVVQIALSQDDEVGDGTTSVMLLASEFLKQAKPFIEEGVHPELIQKAYKKASKLALSYL-NELSVKIEE-GNEVERRSLLEKCASTALSSKLVATYKDFFSKLVVDAVSSLD-------HLLPLDMIGIKKVPGGSLQDSQLISGVAFKKTFSYAGFEMQPKSYVKPKISLLNIELELKSEKENAEIRVNSVEEYQRIVDAEWQILYDKLEAIYKSGAKIVLSKLPIGDVATQYFADRDMFCAGRVSEEDLKRTMAACGGGIQTTVKDI------TEDTLGKCDSFEEVQIGGERFNIFVGCPEAKTCTIILRGGSEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIDMEISRYLRDYSRKILGRDQLFISAMAKSFEIIPRQLCENAGFDATNILNKLRQKHSQGK--------IWCGVDILNEDVADNFEACVWEPALVKSNAITAATEAACMVLTLDETIRNAKSKTPEDNRPVKMPGRG 541          
BLAST of T-complex protein 1 subunit alpha vs. Planmine SMEST
Match: SMESG000016726.1 (SMESG000016726.1)

HSP 1 Score: 273.863 bits (699), Expect = 7.583e-84
Identity = 184/535 (34.39%), Postives = 300/535 (56.07%), Query Frame = 3
Query:  120 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGE-VTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNL--TIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLK-LGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFD---QANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 1703
            L+ G +    +  R  + + +  I ++VKT+LGP G+DK+L+    E +T++NDGATILK + V++PAAKILVE++++QD+EVGDGTTSVV++A+ELL+ AE+ I QK+HP T+ISG+R AC EA   L+ +   +       ++ + + A+T++SSK++    D FA +AV+A   +K   G G     ++ I ++K  G  + +S L  G+ L   +   Q P+ I+ AKI + +  +   K+K  G ++ V    K+ E+ + E    KEK+EKI K G NV +    I +   + F     MA+       ++R++  TGG +  +         FD   +  LGY + + +  I +D L+   G     A +++LRGA    +DE ERS+HD+ CV+++ ++ +  + GGGA E  +   + K A     +E IAI  F++AL  +P  +A N   DS+++VA+LRA H              YGLD+ N  + +  + GI E    K + L  A EAA  I+R+D+++K
Sbjct:   10 LSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK---GSGN----LETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIAST---------FDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDH--------NYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIK 519          
BLAST of T-complex protein 1 subunit alpha vs. Planmine SMEST
Match: SMESG000066978.1 (SMESG000066978.1)

HSP 1 Score: 264.618 bits (675), Expect = 3.168e-80
Identity = 175/551 (31.76%), Postives = 294/551 (53.36%), Query Frame = 3
Query:   96 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKA-INVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDXXXXXXXXXXXXGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGD 1745
            MSS     L     R  G  V+ QN+ A++ +A++++T LGP  + KML+   G + ++NDG  IL+ + VE PAAK ++E+A+ QDEEVGDGTTSV+I+A ELL  A   ++QKIHPT IIS YR A  ++ +Y++ +  + VD   ++ +    K+ + +K I   SD    +A++A   V  +D  G     IK  + + K  G ++++S+++ G   N  I   +M R I+  +I LLD S++  K +    + + +   +    + E +  ++    I++   ++++T  G+ D+   YFV+A    +RR +K D  R+A+  G S+  ++     E+    A L        + I D+    I  CK   A S++LRG++   ++E+ER++ D+  V + V+   ++VPGGGA E A+  +L   A  I    Q A    A AL VIP+ LA N       ++ +LRA H       D A+    G+D     + + K+ G+++P   + + LK A E ++ +LRIDD++      K +K G GD
Sbjct:    1 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHVDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKV-TTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGL-----FEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAM-----DPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILS---GTKKQKIGGGD 537          
The following BLAST results are available for this feature:
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCP10.000e+068.88t-complex 1 [Source:HGNC Symbol;Acc:HGNC:11655][more]
TCP10.000e+070.66t-complex 1 [Source:HGNC Symbol;Acc:HGNC:11655][more]
TCP10.000e+068.11t-complex 1 [Source:HGNC Symbol;Acc:HGNC:11655][more]
TCP11.818e-15169.66t-complex 1 [Source:HGNC Symbol;Acc:HGNC:11655][more]
CCT74.841e-9736.99chaperonin containing TCP1 subunit 7 [Source:HGNC ... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct-10.000e+066.24T-complex protein 1 subunit alpha [Source:UniProt... [more]
cct-71.072e-8533.46T-complex protein 1 subunit eta [Source:UniProtKB... [more]
cct-71.072e-8533.46T-complex protein 1 subunit eta [Source:UniProtKB... [more]
cct-21.253e-7735.05T-complex protein 1 subunit beta [Source:UniProtK... [more]
cct-21.253e-7735.05T-complex protein 1 subunit beta [Source:UniProtK... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT10.000e+069.24gene:FBgn0003676 transcript:FBtr0084290[more]
CCT10.000e+069.24gene:FBgn0003676 transcript:FBtr0084291[more]
CCT73.672e-9436.09gene:FBgn0037632 transcript:FBtr0081918[more]
CCT26.902e-8333.81gene:FBgn0030086 transcript:FBtr0071289[more]
CCT35.228e-7831.55gene:FBgn0015019 transcript:FBtr0302371[more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcp10.000e+068.98t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
tcp10.000e+069.05t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
cct73.368e-10238.03chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
cct48.258e-8032.51chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct58.285e-7832.29chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCP10.000e+070.39t-complex 1 [Source:NCBI gene;Acc:100487607][more]
TCP10.000e+070.52t-complex 1 [Source:NCBI gene;Acc:100487607][more]
TCP10.000e+070.58t-complex 1 [Source:NCBI gene;Acc:100487607][more]
TCP10.000e+072.13t-complex 1 [Source:NCBI gene;Acc:100487607][more]
TCP10.000e+071.81t-complex 1 [Source:NCBI gene;Acc:100487607][more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tcp10.000e+068.46t-complex protein 1 [Source:MGI Symbol;Acc:MGI:985... [more]
Tcp10.000e+068.56t-complex protein 1 [Source:MGI Symbol;Acc:MGI:985... [more]
Cct71.174e-9937.34chaperonin containing Tcp1, subunit 7 (eta) [Sourc... [more]
Cct33.701e-8432.54chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct72.417e-8033.84chaperonin containing Tcp1, subunit 7 (eta) [Sourc... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q94757|TCPA_SCHMA0.000e+072.01T-complex protein 1 subunit alpha OS=Schistosoma m... [more]
sp|Q9XT06|TCPA_MONDO0.000e+070.13T-complex protein 1 subunit alpha OS=Monodelphis d... [more]
sp|Q9W790|TCPA_PALPA0.000e+069.41T-complex protein 1 subunit alpha OS=Paleosuchus p... [more]
sp|P17987|TCPA_HUMAN0.000e+068.88T-complex protein 1 subunit alpha OS=Homo sapiens ... [more]
sp|P18279|TCPA_CRIGR0.000e+069.76T-complex protein 1 subunit alpha OS=Cricetulus gr... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3Q3P60.000e+075.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0R3VSH90.000e+073.81Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
K7X0V30.000e+074.44T-complex protein 1 subunit alpha OS=Spirometra er... [more]
U6IXW60.000e+073.26T-complex protein 1 subunit alpha OS=Echinococcus ... [more]
A0A068YEM20.000e+073.44T complex protein 1 subunit alpha OS=Echinococcus ... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcp10.000e+069.56t-complex 1 [Source:NCBI gene;Acc:103041096][more]
tcp10.000e+067.77t-complex 1 [Source:NCBI gene;Acc:103041096][more]
cct75.581e-10338.15chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct28.578e-8135.74chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct35.760e-7932.12chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct76.836e-8137.25chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
cct42.829e-8031.67chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct51.024e-7331.78chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
ENSPMAT00000002042.11.335e-5632.28pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 ge... [more]
ENSPMAT00000002094.11.635e-3841.31pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TCP10.000e+059.41Alpha subunit of chaperonin-containing T-complex; ... [more]
CCT78.579e-9035.40Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT53.196e-7732.27Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT41.164e-7632.90Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT25.101e-7332.60Subunit beta of the cytosolic chaperonin Cct ring ... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO397560.000e+070.49T-complex protein 1 subunit alpha [Source:UniProt... [more]
EDO486921.183e-10035.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354151.155e-8030.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349811.621e-8034.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495717.374e-8032.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcp10.000e+068.73t-complex 1 [Source:NCBI gene;Acc:101175451][more]
tcp10.000e+063.48t-complex 1 [Source:NCBI gene;Acc:101175451][more]
cct71.691e-9836.68chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct46.027e-8333.58chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct38.472e-7932.22chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067696.10.000e+0100.00SMESG000067696.1[more]
SMESG000050684.10.000e+075.32SMESG000050684.1[more]
SMESG000079886.12.017e-9134.14SMESG000079886.1[more]
SMESG000016726.17.583e-8434.39SMESG000016726.1[more]
SMESG000066978.13.168e-8031.76SMESG000066978.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022614 ID=SMED30022614|Name=T-complex protein 1 subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1962bp
CTTTGTTTAAATTACCTATAGATTTAATTACCATTAAACTGTGTTTCGGG
TTTCTAGAATATATCTGGTTAATTTAATTTGAATAACACTTCAAAATGTC
ATCCAATGTTACTAGCAACCTGGCTATTGGTGGAGAAAGAACTACCGGTG
ATAATGTAAGGAGGCAAAATGTTTTGGCTTCTCAGACAATTGCAAACATT
GTTAAAACAAGTTTAGGCCCAGTTGGATTAGATAAAATGCTTGTAGATGA
TGTTGGTGAAGTCACAATTAGTAATGATGGAGCTACTATTCTCAAATTAT
TAGAAGTAGAACATCCAGCGGCAAAAATTTTAGTAGAATTAGCGCAATTA
CAGGATGAAGAAGTTGGGGATGGAACTACATCTGTAGTTATTATTGCAGC
TGAATTGCTAAAATTAGCTGAGGAACAAATTAAACAAAAGATCCACCCTA
CTACAATTATTAGTGGATATAGAATCGCATGCCGTGAAGCTTGTAAATAT
TTACAAAATAATTTAACTATTGATGTTGATAAGTTGGGTAAGGAATGTAT
TACTAGTGCAGCTAAGACTTCTATGTCATCTAAATTAATTGGAATTGATA
GTGACTTTTTTGCAAATATGGCTGTAGAGGCTACAATGGCTGTGAAAGTT
TCTGATGGAAAGGGTGGTTTCAGATATCCCATCAAAGCTATTAATGTGCT
AAAAGCTCATGGAAAATCTATGAAAGAAAGTATGTTAATTCATGGATATG
CATTGAATTGTACAATAGCTTCCCAACAAATGCCAAGAACTATTAAAGGA
GCTAAAATTGCACTGTTAGATTTTAGTTTACAGAAAGCAAAATTAAAGTT
AGGGGTTCAAGTTTTAGTTACTGACCCAGAGAAATTAGAAGAAATTAGAA
AGCGCGAATCCGATATCACTAAAGAAAAAATTGAGAAAATTTTAAAAACC
GGAGCAAATGTTATTTTGACAACTGGTGGTATTGATGATATGTGCATGAA
GTATTTCGTTGAAGCTAAAGCAATGGCGGTTCGACGATGTAAGAAAGTTG
ATTTAAAAAGAATCGCTAAAGCGACTGGTGGTTCATTGTGTGTGAGTTTA
GCTACAATGGATGGTGAGGAGGCGTTTGATCAAGCAAATCTTGGTTATGC
AGAAGATGTTAGTCAAGAGAGAATCTGTGACGATGAATTAATTTTGATTA
AAGGTTGTAAAGCAAGATCGGCGGCTAGTGTCATTTTAAGAGGAGCAAAT
GATTTCTATGTTGACGAAATGGAGCGTTCAATTCATGATTCTTTCTGTGT
AGTTAAAAGGGTTCTTGAGAGTAAATCTGTTGTTCCAGGAGGTGGAGCTT
GTGAAGCTGCATTACACGTGTATCTTGAAAAATATGCTATGACAATCAGT
TCAAGAGAGCAAATTGCAATTGCTGAATTCGCTAAAGCTTTATTAGTTAT
TCCAAAGCAGTTGGCAGTTAATGCTGCTTTGGATTCTACAGAAATGGTAG
CTAAATTGCGTGCATTACACCATTCTAGCCAACAATTTCCCGATTTAGCT
CATTTCAAATGGTATGGACTGGATTTAACTAACTTTAATGTGTCAAATAA
CAAAGAAGCTGGCATTTTCGAACCTTCTATGTCAAAAATTAAATCATTGA
AATTTGCAACTGAGGCTGCCATCACAATTCTAAGAATTGATGATATGGTG
AAATTAGACGAAGAAAAGAAACCACGAAAACCAGGATGTGGTGATGATTA
ATTTCGATGTTTTTATAAAAAATAAAGCCGGATTAGTCCTATTATATTTT
TTCTCTTTATTAAATTATGAAAGTCAGATCAAGATATTTTCAAAAACTAT
TTTGTGTAAAAGTATAATATTTTTAATTAAATATGGTGGAATGTTTGGTA
AATTTTAATTAAGATAATTTTTTGTAAACAATTTTTAACAGTACAATGTT
GTAAAGCTGATT
back to top

protein sequence of SMED30022614-orf-1

>SMED30022614-orf-1 ID=SMED30022614-orf-1|Name=SMED30022614-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=552bp
MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLV
DDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVII
AAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKE
CITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAIN
VLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKL
KLGVQVLVTDPEKLEEIRKRESDITKEKIEKILKTGANVILTTGGIDDMC
MKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLG
YAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSF
CVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALL
VIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVS
NNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGD
D*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000110pharynx progenitor cell
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR012715Chap_CCT_alpha
IPR017998Chaperone_TCP-1
IPR027409GroEL-like_apical_dom_sf
IPR027410TCP-1-like_intermed_sf
IPR002423Cpn60/TCP-1
IPR027413GROEL-like_equatorial_sf
IPR002194Chaperonin_TCP-1_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017998Chaperone tailless complex polypeptide 1 (TCP-1)PRINTSPR00304TCOMPLEXTCP1coord: 34..50
score: 45.41
coord: 56..74
score: 43.96
coord: 86..105
score: 47.27
coord: 378..400
score: 25.95
coord: 412..424
score: 43.51
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 216..373
e-value: 2.0E-180
score: 602.8
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 211..383
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 25..534
e-value: 2.0E-180
score: 602.8
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 14..536
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 144..409
e-value: 2.0E-180
score: 602.8
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 148..410
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 32..536
e-value: 1.2E-155
score: 518.9
IPR012715T-complex protein 1, alpha subunitTIGRFAMTIGR02340TIGR02340coord: 10..542
e-value: 9.5E-276
score: 913.6
IPR012715T-complex protein 1, alpha subunitCDDcd03335TCP1_alphacoord: 13..538
e-value: 0.0
score: 982.929
NoneNo IPR availablePANTHERPTHR11353CHAPERONINcoord: 8..540
NoneNo IPR availablePANTHERPTHR11353:SF84T-COMPLEX PROTEIN 1 SUBUNIT ALPHAcoord: 8..540
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00751TCP1_2coord: 58..74
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00995TCP1_3coord: 86..94
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00750TCP1_1coord: 37..49