Ester hydrolase C11orf54-like protein

Overview
NameEster hydrolase C11orf54-like protein
Smed IDSMED30022612
Length (bp)1009
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ester hydrolase C11orf54-like protein (SMED30022612) t-SNE clustered cells

Violin plots show distribution of expression levels for Ester hydrolase C11orf54-like protein (SMED30022612) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ester hydrolase C11orf54-like protein (SMED30022612) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ester hydrolase C11orf54-like protein (SMED30022612) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022612

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30022612h1SMcG0012119 dd_Smed_v4_1733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022612h1SMcG0012119 dd_Smed_v4_1733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022612h1SMcG0012119 dd_Smed_v4_1733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022612h1SMcG0012119 dd_Smed_v4_1733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022612h1SMcG0012119 dd_Smed_v4_1733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022612h1SMcG0012119 dd_Smed_v4_1733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022612h1SMcG0012119 dd_Smed_v4_1733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022612h1SMcG0012119 dd_Smed_v4_1733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig459uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig459newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0004422 Contig3857uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0004422 Contig3857newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0008671 Contig3858uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0008671 Contig3858newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig27055uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig27055newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig3857uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig3857newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig25840uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig25840newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig3858uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig3858newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig40852uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0012119 Contig40852newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0019407 Contig3858uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022612h1SMcG0019407 Contig3858newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30022612h1SMcG0012119 dd_Smed_v6_1733_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30022612h1SMcG0012119 dd_Smed_v6_1733_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30022612h1SMcG0012119 dd_Smed_v6_1733_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30022612h1SMcG0012119 dd_Smed_v6_1733_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022612h1SMcG0012119 dd_Smed_v6_1733_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30022612h1SMcG0012119 dd_Smed_v6_1733_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30022612h1SMcG0012119 dd_Smed_v6_1733_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Human
Match: C11orf54 (chromosome 11 open reading frame 54 [Source:HGNC Symbol;Acc:HGNC:30204])

HSP 1 Score: 206.453 bits (524), Expect = 6.799e-64
Identity = 114/302 (37.75%), Postives = 174/302 (57.62%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNAN-----ISFPAKSTKF--GIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL +   + ++P  FI GAGAGPF   G N E +   + E ++K   N S  A  +N A+       +  K   F   ++      +G+ GK++++ A++R    + +  +R++L+KHYG+  +P+G+GG  + Q G+VK H+MP +FS CPL++D +V  WLHF+ + AP V +   VS DP    LRLEH H FS+   E GH+H D TP+IV+Y  YF+  E L R
Sbjct:    6 FSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAH-VNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGN--KPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDP-GFDLRLEHTHFFSR-HGEGGHYHYDTTPDIVEYLGYFLPAEFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Human
Match: C11orf54 (chromosome 11 open reading frame 54 [Source:HGNC Symbol;Acc:HGNC:30204])

HSP 1 Score: 206.453 bits (524), Expect = 6.799e-64
Identity = 114/302 (37.75%), Postives = 174/302 (57.62%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNAN-----ISFPAKSTKF--GIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL +   + ++P  FI GAGAGPF   G N E +   + E ++K   N S  A  +N A+       +  K   F   ++      +G+ GK++++ A++R    + +  +R++L+KHYG+  +P+G+GG  + Q G+VK H+MP +FS CPL++D +V  WLHF+ + AP V +   VS DP    LRLEH H FS+   E GH+H D TP+IV+Y  YF+  E L R
Sbjct:    6 FSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAH-VNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGN--KPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDP-GFDLRLEHTHFFSR-HGEGGHYHYDTTPDIVEYLGYFLPAEFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Human
Match: C11orf54 (chromosome 11 open reading frame 54 [Source:HGNC Symbol;Acc:HGNC:30204])

HSP 1 Score: 206.453 bits (524), Expect = 6.799e-64
Identity = 114/302 (37.75%), Postives = 174/302 (57.62%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNAN-----ISFPAKSTKF--GIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL +   + ++P  FI GAGAGPF   G N E +   + E ++K   N S  A  +N A+       +  K   F   ++      +G+ GK++++ A++R    + +  +R++L+KHYG+  +P+G+GG  + Q G+VK H+MP +FS CPL++D +V  WLHF+ + AP V +   VS DP    LRLEH H FS+   E GH+H D TP+IV+Y  YF+  E L R
Sbjct:    6 FSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAH-VNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGN--KPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDP-GFDLRLEHTHFFSR-HGEGGHYHYDTTPDIVEYLGYFLPAEFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Human
Match: C11orf54 (chromosome 11 open reading frame 54 [Source:HGNC Symbol;Acc:HGNC:30204])

HSP 1 Score: 195.667 bits (496), Expect = 5.543e-60
Identity = 109/284 (38.38%), Postives = 165/284 (58.10%), Query Frame = 1
Query:  112 LLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNAN-----ISFPAKSTKF--GIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL +   + ++P  FI GAGAGPF   G N E +   + E ++K   N S  A  +N A+       +  K   F   ++      +G+ GK++++ A++R    + +  +R++L+KHYG+  +P+G+GG  + Q G+VK H+MP +FS CPL++D +V  WLHF+ + AP V +   VS DP    LRLEH H FS+   E GH+H D TP+IV+Y  YF+  E L R
Sbjct:    5 LKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAH-VNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGN--KPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDP-GFDLRLEHTHFFSR-HGEGGHYHYDTTPDIVEYLGYFLPAEFLYR 283          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Human
Match: C11orf54 (chromosome 11 open reading frame 54 [Source:HGNC Symbol;Acc:HGNC:30204])

HSP 1 Score: 177.563 bits (449), Expect = 2.507e-53
Identity = 101/294 (34.35%), Postives = 152/294 (51.70%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKIINNANISFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL +   + ++P  FI GAGAGP F+T                                                    G   +++++ A++R    + +  +R++L+KHYG+  +P+G+GG  + Q G+VK H+MP +FS CPL++D +V  WLHF+ + AP V +   VS DP    LRLEH H FS+   E GH+H D TP+IV+Y  YF+  E L R
Sbjct:    6 FSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAGP-FQT---------------------------------------------------LGFNSEVIEVKAKRRTGPLNFVTCMRETLEKHYGN--KPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDP-GFDLRLEHTHFFSR-HGEGGHYHYDTTPDIVEYLGYFLPAEFLYR 243          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Celegans
Match: C24B5.4 (pep chromosome:WBcel235:V:9195821:9197326:-1 gene:WBGene00016046.1 transcript:C24B5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C24B5.4)

HSP 1 Score: 190.66 bits (483), Expect = 3.114e-58
Identity = 105/294 (35.71%), Postives = 168/294 (57.14%), Query Frame = 1
Query:   67 HTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKIINNANISFPAK---STKFGIIGQF-LCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            H PS E+LK  F   LL  FE +  ++V CPDLS+ PF+  + G   N  + +VGG GNL P  +++ +FD+ +    C  P   + G GAGP+   G NCE++AD    + K  +  + +A+I +N++  +  +     KF ++    L    ++  ++   A  RK + ++ + IRD L++H+G  K+ V L G  + Q G+ ++HVMPDF  CP + +++V+ WL++F + AP +    M S+DP +  LRLEH H +S D  +AGH+H DVTPE V Y  +F    K+ R
Sbjct:   15 HVPSLEELKMVFQTSLLSNFENVEVNIVDCPDLSKPPFNQKSSGFGHNLRIAEVGGPGNLYPGFHIDHQFDIPKIGKVCEHPEAAVFGPGAGPWPIVGQNCEMVADV---NLKTGEVGTRIAEINSNSDKRYVQRIIDEPKFSLMANLALSDADKSSTVVHFKASVRKGEKNLTNCIRDGLQEHFG--KKIVSLAGQFIIQTGKARLHVMPDFPGCPFENNAEVDKWLNYFEMSAPLICATVMHSYDPGH-NLRLEHTHCYS-DHGDAGHYHYDVTPETVSYEGWFAPASKIYR 301          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Fly
Match: CG9119 (gene:FBgn0035189 transcript:FBtr0072635)

HSP 1 Score: 177.563 bits (449), Expect = 6.817e-53
Identity = 103/296 (34.80%), Postives = 156/296 (52.70%), Query Frame = 1
Query:   64 LHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNG-FICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKIINNANI----SFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            L+ P   +L++     L   F  ++  V  CPDL  + F L   GL G P +++ GG   LLP    +  +++ E     + P   F  GAGAGP+   G NCE I +    +     N S  A +            P    +  ++      +G+ G++LKITA+QR  + + I+ IR  L+ HYG   + VGLGG+ L + G    HVM DFSK P+++D +V +WL F+ +PA   AVG +V+ +  +L LRL+HFH FS   N  GH+H D TP+IV+Y  Y  + E+++R
Sbjct:   18 LYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFLLPLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGIFNLSVNEKDELTNGSYTATVRGEQEECVLEKIPHTEPRCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGLENHYGD--KVVGLGGIFLIKKGAAHQHVMRDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEH-DLDLRLQHFHSFSFS-NWGGHYHYDTTPDIVEYEAYLNVAERVVR 309          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Fly
Match: CG32335 (gene:FBgn0063667 transcript:FBtr0273416)

HSP 1 Score: 170.244 bits (430), Expect = 3.522e-50
Identity = 101/297 (34.01%), Postives = 152/297 (51.18%), Query Frame = 1
Query:   64 LHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNG-FICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKIINNANI-----SFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            LH P   +LK      L + F  +   V  CPDL    F L  +GL G   +++ GG   L P    +  ++L E     +     F  G GAGP+     NCE I +    +       S  A  +  AN        P   ++  +I      +G+ G++L+I+A+QR    + ++ IR  L++HYG   Q VGLGG+ + + G V  HVM DFSK P+ T  ++++WL F+ +PA   AVG +V+ D + L LRL+HFH FS   N  GH+H D TP+IV+Y  Y  + E+++R
Sbjct:   18 LHVPPLSELKRVIQGALDENFRTVDVSVEACPDLRDSQFGLVERGLGGKATLLEAGGPPYLRPLVQRDKLYNLKEITRRTQGAGKIFAVGPGAGPWPIRHSNCEGIFNFSLNEEDELTQGSYTA-TVRGANEDCVLERIPETESRAALILNLFLSEGKPGQVLRISAKQRTGGENFVECIRKGLERHYGD--QVVGLGGMFVVRRGCVHQHVMRDFSKTPIHTQEQIQNWLKFYEMPAQLNAVGTLVTKD-MGLDLRLQHFHSFSFA-NWGGHYHYDTTPDIVEYEAYLNVAERVIR 309          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Zebrafish
Match: C5H11orf54 (zgc:85789 [Source:NCBI gene;Acc:322350])

HSP 1 Score: 196.052 bits (497), Expect = 4.962e-60
Identity = 108/301 (35.88%), Postives = 162/301 (53.82%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNANISFPAKST------KFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            + LH P+ E+L       L   F  +   V  CPDL+Q+PF    +GLCG P + DVGG+ NL+P   L+  +++     +  +P  FI GAGA  F   GIN E++     E + +   N S  + I          K +       FG++     C+G+ GK++++ A +R  + S++  +R ++ +HYG  ++ V LGG  + Q G+ KIH+MP +FS CPL+TD  V +WL  F V AP +    M+S DP  L LR+EH HGFS    E GH++ D TP  V+Y  YF+  E + R
Sbjct:   10 FQLHVPNLEELCQVLESGLNKNFSDVKVSVTDCPDLTQQPFGFPVKGLCGKPRITDVGGVPNLIPLVKLDKVYNMNSVSKEVELPGAFILGAGAISFKTAGINGELMPLVLTEAEGRSAVNASYFSSINPEDGKCLQEKYSDRFDDCDFGLLANLYACEGKPGKVIEVKACRRTGEDSLVSCMRKTMAEHYG--EKSVALGGTFIIQKGKAKIHIMPREFSVCPLNTDEDVNNWLRHFEVSAPLIFQTVMISRDP-GLDLRVEHTHGFSH-HGEGGHYYTDTTPNTVEYLGYFLPAETVYR 306          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Xenopus
Match: c11orf54 (chromosome 11 open reading frame 54 [Source:NCBI gene;Acc:549100])

HSP 1 Score: 196.438 bits (498), Expect = 4.672e-60
Identity = 111/300 (37.00%), Postives = 159/300 (53.00%), Query Frame = 1
Query:   61 NLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFK-NKSMLAKIINNANISFPAK------STKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
              H PS E++ S     LL  F  +   V  CPDLS+EPF    +GLCG   + DVGG+  L+P P L+  +++        +P  +I GAGA      G+N E+I   + E+  I   NKS +A +          K         FG++     C+G+ GK+++++ ++R    + +  +R SLK HYG  ++ VGLGG  L + G+ K+HVMP ++S CPL+TD  V  WL F+ + AP +     VSHDP    LRLEH H FS    E GH+H D TP+ V+Y  YF   E L R
Sbjct:   10 TFHVPSLEEICSVLKSGLLKNFADVSVIVTECPDLSKEPFEFPVKGLCGKSRIADVGGVPYLVPKPRLDKVYNVNAVAKKIGLPGAYILGAGATSHKSLGMNAELIFSVQAENESIQAVNKSYVASVNPGDGSCLLEKYRDRNNDNDFGLLSNLYACEGKPGKVIEVSVKRRIGQDNFVSCMRKSLKTHYG--EKAVGLGGTFLLKEGKAKLHVMPREYSACPLNTDEDVNGWLKFYEMKAPLICQSVFVSHDP-GYDLRLEHTHCFSH-HGEGGHYHYDTTPDTVEYLGYFHPAELLYR 305          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Mouse
Match: 4931406C07Rik (RIKEN cDNA 4931406C07 gene [Source:MGI Symbol;Acc:MGI:1918234])

HSP 1 Score: 202.216 bits (513), Expect = 2.269e-62
Identity = 114/305 (37.38%), Postives = 168/305 (55.08%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCE---IIADAKYED------YKIFKNKSMLAKIINNANISFPAKSTKFG--IIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL E     ++P  FI GAGAGPF   G N E   I+  A   +      Y   KN +  A ++      +  K   FG  ++      +G+ GK++++ A++R  + + +  +R +L++HYG   +PVG+GG  + Q G+VK H+MP +FS CPL++D  V  WLHF+ + AP V +   VS DP  L LRLEH H FS    E GH+H D TP+ V+Y  YF   + L R
Sbjct:    6 FSFHMPSLEELAEVLQKGLTDNFADVQVSVVDCPDLTKEPFTFPVRGICGQTRIAEVGGVPYLLPLVNKKKVYDLNEIAKVIKLPGAFILGAGAGPFQTLGFNSEFMPIVQTASEHNQPVNGSYFAHKNPADGACLLEK----YSQKYHDFGCALLANLFASEGQPGKVIEVQAKRRTGELNFVSCMRQTLEEHYGD--KPVGMGGTFIVQKGKVKAHIMPAEFSSCPLNSDEAVNKWLHFYEMKAPLVCLPVFVSKDP-GLDLRLEHTHFFSH-HGEGGHYHYDTTPDTVEYLGYFSPAQFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Mouse
Match: 4931406C07Rik (RIKEN cDNA 4931406C07 gene [Source:MGI Symbol;Acc:MGI:1918234])

HSP 1 Score: 202.216 bits (513), Expect = 2.269e-62
Identity = 114/305 (37.38%), Postives = 168/305 (55.08%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCE---IIADAKYED------YKIFKNKSMLAKIINNANISFPAKSTKFG--IIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL E     ++P  FI GAGAGPF   G N E   I+  A   +      Y   KN +  A ++      +  K   FG  ++      +G+ GK++++ A++R  + + +  +R +L++HYG   +PVG+GG  + Q G+VK H+MP +FS CPL++D  V  WLHF+ + AP V +   VS DP  L LRLEH H FS    E GH+H D TP+ V+Y  YF   + L R
Sbjct:    6 FSFHMPSLEELAEVLQKGLTDNFADVQVSVVDCPDLTKEPFTFPVRGICGQTRIAEVGGVPYLLPLVNKKKVYDLNEIAKVIKLPGAFILGAGAGPFQTLGFNSEFMPIVQTASEHNQPVNGSYFAHKNPADGACLLEK----YSQKYHDFGCALLANLFASEGQPGKVIEVQAKRRTGELNFVSCMRQTLEEHYGD--KPVGMGGTFIVQKGKVKAHIMPAEFSSCPLNSDEAVNKWLHFYEMKAPLVCLPVFVSKDP-GLDLRLEHTHFFSH-HGEGGHYHYDTTPDTVEYLGYFSPAQFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Mouse
Match: 4931406C07Rik (RIKEN cDNA 4931406C07 gene [Source:MGI Symbol;Acc:MGI:1918234])

HSP 1 Score: 202.216 bits (513), Expect = 2.269e-62
Identity = 114/305 (37.38%), Postives = 168/305 (55.08%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCE---IIADAKYED------YKIFKNKSMLAKIINNANISFPAKSTKFG--IIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL E     ++P  FI GAGAGPF   G N E   I+  A   +      Y   KN +  A ++      +  K   FG  ++      +G+ GK++++ A++R  + + +  +R +L++HYG   +PVG+GG  + Q G+VK H+MP +FS CPL++D  V  WLHF+ + AP V +   VS DP  L LRLEH H FS    E GH+H D TP+ V+Y  YF   + L R
Sbjct:    6 FSFHMPSLEELAEVLQKGLTDNFADVQVSVVDCPDLTKEPFTFPVRGICGQTRIAEVGGVPYLLPLVNKKKVYDLNEIAKVIKLPGAFILGAGAGPFQTLGFNSEFMPIVQTASEHNQPVNGSYFAHKNPADGACLLEK----YSQKYHDFGCALLANLFASEGQPGKVIEVQAKRRTGELNFVSCMRQTLEEHYGD--KPVGMGGTFIVQKGKVKAHIMPAEFSSCPLNSDEAVNKWLHFYEMKAPLVCLPVFVSKDP-GLDLRLEHTHFFSH-HGEGGHYHYDTTPDTVEYLGYFSPAQFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Mouse
Match: 4931406C07Rik (RIKEN cDNA 4931406C07 gene [Source:MGI Symbol;Acc:MGI:1918234])

HSP 1 Score: 169.088 bits (427), Expect = 6.467e-50
Identity = 98/261 (37.55%), Postives = 144/261 (55.17%), Query Frame = 1
Query:  190 AQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCE---IIADAKYED------YKIFKNKSMLAKIINNANISFPAKSTKFG--IIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            A+G+CG   + +VGG+  LLP  N    +DL E     ++P  FI GAGAGPF   G N E   I+  A   +      Y   KN +  A ++      +  K   FG  ++      +G+ GK++++ A++R  + + +  +R +L++HYG   +PVG+GG  + Q G+VK H+MP +FS CPL++D  V  WLHF+ + AP V +   VS DP  L LRLEH H FS    E GH+H D TP+ V+Y  YF   + L R
Sbjct:   17 AEGICGQTRIAEVGGVPYLLPLVNKKKVYDLNEIAKVIKLPGAFILGAGAGPFQTLGFNSEFMPIVQTASEHNQPVNGSYFAHKNPADGACLLEK----YSQKYHDFGCALLANLFASEGQPGKVIEVQAKRRTGELNFVSCMRQTLEEHYGD--KPVGMGGTFIVQKGKVKAHIMPAEFSSCPLNSDEAVNKWLHFYEMKAPLVCLPVFVSKDP-GLDLRLEHTHFFSH-HGEGGHYHYDTTPDTVEYLGYFSPAQFLYR 269          
BLAST of Ester hydrolase C11orf54-like protein vs. UniProt/SwissProt
Match: sp|Q2HJH3|CK054_BOVIN (Ester hydrolase C11orf54 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.032e-63
Identity = 115/302 (38.08%), Postives = 171/302 (56.62%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNAN-----ISFPAKSTKFG--IIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            Y+ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL +   D ++P  F+ GAGAGPF   G N E +   + E +++   N S  A+ +N A+       +  K   FG  ++      +G+ GK++++  ++R    + +  +R +L+KHYG   +PVG+GG  + Q G+VK H+MP +FS CPL++D  V  WLHF+ + AP V +   VS DP    LRLEH H FS    E GH+H D TP+IV+Y  YF+  E L R
Sbjct:    6 YSFHVPSLEELVGVLQKGLTDNFAEVQVSVVDCPDLTKEPFTFPIKGICGKTRIAEVGGVPYLLPLVNEKKVYDLNKIAKDIQLPGAFVLGAGAGPFQTLGFNSEFMLLVQTESEHRPPVNGSYFAR-VNPADGGCLLEKYSEKYHDFGCALLANLFASEGQPGKVIEVKVKRRTGKLNFVTCMRQTLEKHYGD--KPVGMGGAFIIQKGKVKTHIMPAEFSSCPLNSDEDVNKWLHFYEMKAPLVCLPVFVSRDP-GFDLRLEHTHCFSH-HGEGGHYHYDTTPDIVEYLGYFLPAEFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. UniProt/SwissProt
Match: sp|Q9H0W9|CK054_HUMAN (Ester hydrolase C11orf54 OS=Homo sapiens OX=9606 GN=C11orf54 PE=1 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 3.265e-63
Identity = 114/302 (37.75%), Postives = 174/302 (57.62%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNAN-----ISFPAKSTKF--GIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL +   + ++P  FI GAGAGPF   G N E +   + E ++K   N S  A  +N A+       +  K   F   ++      +G+ GK++++ A++R    + +  +R++L+KHYG+  +P+G+GG  + Q G+VK H+MP +FS CPL++D +V  WLHF+ + AP V +   VS DP    LRLEH H FS+   E GH+H D TP+IV+Y  YF+  E L R
Sbjct:    6 FSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAH-VNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGN--KPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDP-GFDLRLEHTHFFSR-HGEGGHYHYDTTPDIVEYLGYFLPAEFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. UniProt/SwissProt
Match: sp|Q91V76|CK054_MOUSE (Ester hydrolase C11orf54 homolog OS=Mus musculus OX=10090 PE=1 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.587e-61
Identity = 114/305 (37.38%), Postives = 168/305 (55.08%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCE---IIADAKYED------YKIFKNKSMLAKIINNANISFPAKSTKFG--IIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL E     ++P  FI GAGAGPF   G N E   I+  A   +      Y   KN +  A ++      +  K   FG  ++      +G+ GK++++ A++R  + + +  +R +L++HYG   +PVG+GG  + Q G+VK H+MP +FS CPL++D  V  WLHF+ + AP V +   VS DP  L LRLEH H FS    E GH+H D TP+ V+Y  YF   + L R
Sbjct:    6 FSFHMPSLEELAEVLQKGLTDNFADVQVSVVDCPDLTKEPFTFPVRGICGQTRIAEVGGVPYLLPLVNKKKVYDLNEIAKVIKLPGAFILGAGAGPFQTLGFNSEFMPIVQTASEHNQPVNGSYFAHKNPADGACLLEK----YSQKYHDFGCALLANLFASEGQPGKVIEVQAKRRTGELNFVSCMRQTLEEHYGD--KPVGMGGTFIVQKGKVKAHIMPAEFSSCPLNSDEAVNKWLHFYEMKAPLVCLPVFVSKDP-GLDLRLEHTHFFSH-HGEGGHYHYDTTPDTVEYLGYFSPAQFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. UniProt/SwissProt
Match: sp|Q5U2Q3|CK054_RAT (Ester hydrolase C11orf54 homolog OS=Rattus norvegicus OX=10116 PE=1 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.159e-61
Identity = 115/303 (37.95%), Postives = 168/303 (55.45%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEI--IADAKYEDYKIFKNKSMLAKIINNAN-----ISFPAKSTKFG--IIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++ H PS E+L     + L D F  +   VV CPDL++EPF+   +G+CG   + +VGG+  LLP  N    +DL E   + ++P  FI GAGAGPF   G N E   I     E ++   N S  A+  N A+       +  K   FG  ++      +G+ GK++++ A++R  + + +  +R +L+KHYG   +PVG+GG  L Q G+VK H+MP +FS C L++D  V  WL+F+ + AP V +   VS DP  L LRLEH H FS    E GH+H D TP+ V+Y  YF   + L R
Sbjct:    6 FSFHVPSLEELAEVLQKGLKDNFAHVQVSVVDCPDLTKEPFTFPVKGICGQTRIAEVGGVPYLLPLVNKKKVYDLNEIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPIVQTASEHHQPV-NGSYFAR-ANPADGKCLLEKYSQKYPDFGCALLANLFASEGQPGKVIEVQAKKRTGEHNFVSCMRQTLEKHYGD--KPVGMGGTFLVQKGKVKAHIMPAEFSSCSLNSDEAVNQWLNFYEMKAPLVCLPVFVSKDP-GLDLRLEHTHFFSH-HGEGGHYHYDTTPDTVEYLGYFSPAQFLYR 302          
BLAST of Ester hydrolase C11orf54-like protein vs. UniProt/SwissProt
Match: sp|Q28GJ2|CK054_XENTR (Ester hydrolase C11orf54 homolog OS=Xenopus tropicalis OX=8364 GN=TEgg069a24.1 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.973e-59
Identity = 111/300 (37.00%), Postives = 160/300 (53.33%), Query Frame = 1
Query:   61 NLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFK-NKSMLAKIINNANISFPAK------STKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            + H PS E++ S     LL  F  +   V  CPDLS+EPF    +GLCG   + DVGG+  L+P P L+  +++        +P  +I GAGA      G+N E+I   + E+  I   NKS +A +          K         FG++     C+G+ GK+++++ ++R    + +  +R SLK HYG  ++ VGLGG  L + G+ K+HVMP ++S CPL+TD  V  WL F+ + AP +     VSHDP    LRLEH H FS    E GH+H D TP+ V+Y  YF   E L R
Sbjct:    5 SFHVPSLEEICSVLKSGLLKNFADVSVIVTECPDLSKEPFEFPVKGLCGKSRIADVGGVPYLVPKPRLDKVYNVNAVAKKIGLPGAYILGAGATSHKSLGMNAELIFSVQAENESIQAVNKSYVASVNPGDGSCLLEKYRDRNNDNDFGLLSNLYACEGKPGKVIEVSVKRRIGQDNFVSCMRKSLKTHYG--EKAVGLGGTFLLKEGKAKLHVMPREYSACPLNTDEDVNGWLKFYEMKAPLICQSVFVSHDP-GYDLRLEHTHCFSH-HGEGGHYHYDTTPDTVEYLGYFHPAELLYR 300          
BLAST of Ester hydrolase C11orf54-like protein vs. TrEMBL
Match: A0A4Z2D0M0 (Ester hydrolase C11orf54 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005880 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 1.007e-75
Identity = 121/299 (40.47%), Postives = 178/299 (59.53%), Query Frame = 1
Query:   46 MNKFYNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKII--NNANISFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            M++F  LH PSY ++ +     L D FE + C +  CPDLS  PF L+ +GLCG   + DVG    LLP P  +  +DL +      I  G + GAGAGPFF TG N E++ +   E+ K+ KN S+L      NN  +   A +TKF ++GQ   C+G++G ++++    R +DG +   IR++L K YG     VGLGGVI+ + G+   HV+P+FS+ P+D++ K+ +W+  F + +P ++VG +VSHDP +LGLRLEHFH F++D    GH H D     V Y  YF + E L+R
Sbjct:    1 MSEFV-LHKPSYHEVSAALESHLKDCFESVKCSITDCPDLSDTPFCLTLKGLCGKGTICDVGSFDYLLPVPKTDRHYDLLDVFKSAGITVGAVIGAGAGPFFLTGSNSEMVINISSENGKVSKNSSLLGSYDKENNKPLITKADNTKFALLGQMYMCEGKSGPVIELCVSGRIRDGKLDAMIREALHKKYGHLSSSVGLGGVIIQEKGKSLYHVLPEFSQEPIDSNEKLRNWIKMFEMESPVISVGIVVSHDPHHLGLRLEHFHCFNQDHTNCGHCHFDTHGPSVSYRAYFALAEHLVR 298          
BLAST of Ester hydrolase C11orf54-like protein vs. TrEMBL
Match: Q5BYZ9 (SJCHGC06040 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 244.202 bits (622), Expect = 1.252e-75
Identity = 119/293 (40.61%), Postives = 174/293 (59.39%), Query Frame = 1
Query:   64 LHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKII--NNANISFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            LH PSY ++ +     L D FE + C +  CPDLS  PF L+ +GLCG   + DVG    LLP P  +  +DL +      I  G + GAGAGPFF TG N E++ +   E+ K+ KN S+L      NN  +   A +TKF ++GQ   C+G++G ++++    R +DG +   IR++L K YG     VGLGGVI+ + G+   HV+P+FS+ P+D++ K+ +W+  F + +P ++VG +VSHDP +LGLRLEHFH F++D    GH H D     V Y  YF + E L+R
Sbjct:    5 LHKPSYHEVSAALESHLKDCFESVKCSITDCPDLSDTPFCLTLKGLCGKGTICDVGSFDYLLPVPKTDRHYDLLDVFKSAGITVGAVIGAGAGPFFLTGSNSEMVINISSENGKVSKNSSLLGSYDKENNKPLITKADNTKFALLGQMYMCEGKSGPVIELCVSGRIRDGKLDAMIREALHKKYGHLSSSVGLGGVIIQEKGKSLYHVLPEFSQEPIDSNEKLRNWIKMFEMESPVISVGIVVSHDPHHLGLRLEHFHCFNQDHTNCGHCHFDTHGPSVSYRAYFALAEHLVR 297          
BLAST of Ester hydrolase C11orf54-like protein vs. TrEMBL
Match: A0A087T5J9 (Ester hydrolase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_12710 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.199e-73
Identity = 120/301 (39.87%), Postives = 180/301 (59.80%), Query Frame = 1
Query:   46 MNKF--YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKIINNANISFP--AKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            MNK   +NLH P+  ++       L + F  I  DVV CPDL  +P+ L+A+G+CGNP + DVGG+  L+P    +  ++L E      +PN  I GAGAGP    G NCE++ + K+ + +   N + +AKI  + N        S +F ++G     +G++GK++K+TA+ R    + +  +R +L +HY  + QPVG+GGV   Q G+ K+H+MPD+SK PL TD  V +WL F+N PAP + +   +SHDP  L LR+EH H FS D +  GH+H+D TP+IVKY  YF + + + R
Sbjct:    1 MNKIVKHNLHKPNLNEVAKVLQAGLSNTFSHISVDVVDCPDLKGKPYMLAAEGICGNPCLADVGGVPYLIPVARADKVYNLREIAKQIELPNALIIGAGAGPRHHVGTNCEMMPNIKFNENEF--NNTHIAKIGKDGNCELVHLKDSEEFCLLGNLFASEGKSGKVIKVTAQHRMTSENFVSVMRKTLAEHY--KDQPVGIGGVFNIQVGKAKLHIMPDYSKTPLKTDEDVNNWLKFYNQPAPLICLSTFISHDP-GLDLRVEHTHCFS-DHDVGGHYHEDTTPDIVKYEGYFNVADFIYR 295          
BLAST of Ester hydrolase C11orf54-like protein vs. TrEMBL
Match: A0A4D5RM59 (DUF1907 domain-containing protein (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.203e-70
Identity = 121/301 (40.20%), Postives = 180/301 (59.80%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKIINN-----ANISFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLRKNA 945
            ++LH PS E++     + L   FE +  DVV CPDL Q+PF L+++G+CG P + D+GG+  L+P    +  +DL + +    +P+GF  GAGAGP+   GINCE++ + K       +NKS  AKI  +      N+S P    +F ++G FL  +G+ GK++K++A++R    + +  +R+ LK  YG+E  PVG+GG  L   G+ K+H+MP FS  PL TD+ +  WL FF + AP V +   VSHDP    LR+EH H FS D  + GH+H D TP+ V+Y  YF + E L R +A
Sbjct:    8 HSLHRPSLEEVAKALSDGLRSNFEHVQVDVVDCPDLRQKPFMLASEGICGQPRLTDIGGVPYLVPIAQTDKIYDLEKVMKQTDVPDGFAIGAGAGPYHTVGINCEMMLNMKCGQNP--ENKSHYAKIGEDGSCVLGNLSGPC--CEFCLMGNFLISEGKQGKVIKVSAKKRTGQENFVTAMRNGLKAKYGTE--PVGMGGAFLLAQGKAKLHIMPKFSTAPLLTDAAMNQWLKFFEMSAPLVCLSTFVSHDP-GWDLRIEHTHCFS-DHKQGGHYHYDTTPDEVEYLGYFNVAEWLYRIDA 300          
BLAST of Ester hydrolase C11orf54-like protein vs. TrEMBL
Match: A0A2T7PI26 (DUF1907 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08512 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 4.110e-70
Identity = 125/299 (41.81%), Postives = 179/299 (59.87%), Query Frame = 1
Query:   55 FYNLHTPSYEKLKSEFMEDLLDA-FEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKY--EDYKIFKNKSMLAKIINNANISFPAK--STKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            +Y++H    +   S F+E  L+  FE +   VV CPDL+Q+PF+LSA+GLCG+P + DVGG   LLP P  +  ++  E      +P  FI GAGAGP+   G+N E+    +   E  +     S + K+    N+    K  ST F ++G FLCC+G+ GK+++I A +R  D + +   R +L++ YG   QPV LGGV + + G+  +HVMPDF   PL +D +V++WL F+ + AP V VGE+VSHDP  L LR+EHFH FS +  E GH+H D TPE V Y  YF I + + R
Sbjct:  113 WYSVHNGHPQCSHSTFLESGLEKNFESVLVSVVDCPDLTQKPFNLSAKGLCGSPRLADVGGPPYLLPLPQKDKLYNQAEIARQVELPGAFILGAGAGPWQVVGVNSELACTVQVAAEGNEPISINSHVTKVNPQNNLWVLEKLNSTDFNLMGNFLCCEGKPGKVIEIKARKRTGDENFMSATRQALQQQYG--PQPVALGGVFVIEKGKANLHVMPDFPCAPLSSDEEVDEWLKFYEMNAPLVCVGELVSHDP-GLDLRVEHFHCFS-EHGEGGHYHYDTTPEEVSYLAYFNIADSIYR 407          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Cavefish
Match: zgc:85789 (chromosome 3 C11orf54 homolog [Source:NCBI gene;Acc:103045412])

HSP 1 Score: 196.052 bits (497), Expect = 5.102e-60
Identity = 111/301 (36.88%), Postives = 164/301 (54.49%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNANISFPAKSTK------FGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            Y +H PS E+L     + L + FE     V  CPDLSQ PF    +GLCG P + DVGG+  L+P  + +  +++     +  +P  FI GAGA  F   G+N E++     E + K   N S  + I          K ++      FG++     C+G+ GK+++I A +RK + S++  +R ++++HYG   + V LGG  + Q G+ KIH+MP +FS CPL+T+  V +WL  F V AP +    MVS DP  L LRLEH HGFS    E GH++ D TP  V+Y  YF+  + + R
Sbjct:   10 YQIHVPSLEELSEVLEKGLRNNFEDAKVCVAECPDLSQAPFQFPVKGLCGKPRITDVGGVPYLIPLVHKDKVYNMNTVSKELELPGAFILGAGAVSFKTVGMNGELMPLVLTESEDKPAVNGSYFSSINPVDGKCLQEKYSERFSDCDFGLLANLFACEGKPGKVIEIRASRRKGEESLVSCMRKTMEEHYGD--KTVALGGTFIIQKGKAKIHIMPQEFSSCPLNTNEDVNNWLKHFEVSAPLICQSVMVSRDP-GLDLRLEHTHGFSH-HGEGGHYYIDTTPNTVEYLGYFLPADFIYR 306          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Cavefish
Match: zgc:85789 (chromosome 3 C11orf54 homolog [Source:NCBI gene;Acc:103045412])

HSP 1 Score: 177.563 bits (449), Expect = 3.287e-53
Identity = 100/269 (37.17%), Postives = 147/269 (54.65%), Query Frame = 1
Query:   58 YNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNANISFPAKSTK------FGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFS 840
            Y +H PS E+L     + L + FE     V  CPDLSQ PF    +GLCG P + DVGG+  L+P  + +  +++     +  +P  FI GAGA  F   G+N E++     E + K   N S  + I          K ++      FG++     C+G+ GK+++I A +RK + S++  +R ++++HYG   + V LGG  + Q G+ KIH+MP +FS CPL+T+  V +WL  F V AP +    MVS DP  L LRLEH HGFS
Sbjct:   10 YQIHVPSLEELSEVLEKGLRNNFEDAKVCVAECPDLSQAPFQFPVKGLCGKPRITDVGGVPYLIPLVHKDKVYNMNTVSKELELPGAFILGAGAVSFKTVGMNGELMPLVLTESEDKPAVNGSYFSSINPVDGKCLQEKYSERFSDCDFGLLANLFACEGKPGKVIEIRASRRKGEESLVSCMRKTMEEHYGD--KTVALGGTFIIQKGKAKIHIMPQEFSSCPLNTNEDVNNWLKHFEVSAPLICQSVMVSRDP-GLDLRLEHTHGFS 275          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Cavefish
Match: zgc:85789 (chromosome 3 C11orf54 homolog [Source:NCBI gene;Acc:103045412])

HSP 1 Score: 164.851 bits (416), Expect = 2.450e-48
Identity = 93/257 (36.19%), Postives = 143/257 (55.64%), Query Frame = 1
Query:  190 AQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYE-DYKIFKNKSMLAKIINNANISFPAKSTK------FGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
            ++GLCG P + DVGG+  L+P  + +  +++     +  +P  FI GAGA  F   G+N E++     E + K   N S  + I          K ++      FG++     C+G+ GK+++I A +RK + S++  +R ++++HYG   + V LGG  + Q G+ KIH+MP +FS CPL+T+  V +WL  F V AP +    MVS DP  L LRLEH HGFS    E GH++ D TP  V+Y  YF+  + + R
Sbjct:   21 SEGLCGKPRITDVGGVPYLIPLVHKDKVYNMNTVSKELELPGAFILGAGAVSFKTVGMNGELMPLVLTESEDKPAVNGSYFSSINPVDGKCLQEKYSERFSDCDFGLLANLFACEGKPGKVIEIRASRRKGEESLVSCMRKTMEEHYGD--KTVALGGTFIIQKGKAKIHIMPQEFSSCPLNTNEDVNNWLKHFEVSAPLICQSVMVSRDP-GLDLRLEHTHGFSH-HGEGGHYYIDTTPNTVEYLGYFLPADFIYR 273          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Nematostella
Match: EDO39425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA42])

HSP 1 Score: 183.726 bits (465), Expect = 4.420e-56
Identity = 98/282 (34.75%), Postives = 155/282 (54.96%), Query Frame = 1
Query:  100 FMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIAD---AKYEDYKIFKNKSMLAKIINNANISFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
              + L   F      VV CPD  Q P++  A G   N ++VDVGG   LLP P LN  +D+ +  +   +P G++ GAGAG     G+NCE+IA+          + ++K       + + +        F ++   L  +G+ GK+LK+ A +R  D + +  +R +L  +YG+  + VG+GG  +   G+   H+MP+FSK PL++  +V +WL F+++ AP V +G + S+DP  L LR+EHFHG++ +  E GH+H D TP  V+Y  YF   E+L R
Sbjct:    3 LQDGLTKNFSHATVTVVECPDFRQPPWNFPATG--KNLLIVDVGGPAYLLPLPQLNKIYDMNDVAAKADLPGGYVIGAGAGSHTSVGVNCEMIANVCTGTETSNPVIQSKITKVNPEDGSCVFQDYDVCDFSLLANCLITEGKPGKVLKVEASKRTGDENFVTCMRLALGSYYGN--RAVGIGGTFMIAKGKANFHIMPEFSKTPLNSPEEVNNWLKFYDMSAPLVCLGVLESYDP-GLDLRVEHFHGYN-NHGEGGHYHYDTTPNEVEYVGYFTPAERLYR 278          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Medaka
Match: zgc:85789 (chromosome 14 C11orf54 homolog [Source:NCBI gene;Acc:101164335])

HSP 1 Score: 185.267 bits (469), Expect = 2.351e-55
Identity = 104/300 (34.67%), Postives = 156/300 (52.00%), Query Frame = 1
Query:   61 NLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKIINNAN-------ISFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
             LH P  E+L+      L   F  +   V  CPDLS+EPF    +GLCG+P + DVGG+  L+P    + ++D+        +P  F+ GAGA P    G+N E++     E        S     IN A+        S       FG++G    C+G+ GK++++ A++R    S++  +R +L+ HY    + + LGG  + + G+ KIH+MP +FS CPL+T+  V  WL  F V AP +    +VS DP  L LR+EH H FS    E GH++ D TP+ V+Y  YF+  E + R
Sbjct:   51 QLHAPDLEELRGVLQAGLESNFAEVRVSVAECPDLSKEPFQFPVKGLCGSPRITDVGGVPYLVPLVQKDKEYDMNTISKKVELPGAFLLGAGAAPCRIIGMNAELMPLVLTEAEGRPAVNSSYFSSINPADGQCLLEKYSQKFSDCNFGLLGNLYACEGKPGKVIEVQAKKRTGSHSLVTALRKTLEAHY--PDKSLALGGTFIIKKGKAKIHIMPREFSACPLNTNDDVNKWLKHFEVNAPLICQSVLVSRDP-GLDLRVEHTHCFSH-HGEGGHYYIDTTPDSVEYLGYFLPAEFVYR 346          
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Medaka
Match: zgc:85789 (chromosome 14 C11orf54 homolog [Source:NCBI gene;Acc:101164335])

HSP 1 Score: 149.828 bits (377), Expect = 5.301e-43
Identity = 92/294 (31.29%), Postives = 137/294 (46.60%), Query Frame = 1
Query:   61 NLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLN-AKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEIIADAKYEDYKIFKNKSMLAKIINNANISFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMP-DFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLR 936
             LH P  E+L+      L   F  +   V  CPDLS+EPF    +GLCG+P + DVGG+  L+P    +  ++D+        +P  F+ GAGA P       C II                                             G   +++++ A++R    S++  +R +L+ HY  +   + LGG  + + G+ KIH+MP +FS CPL+T+  V  WL  F V AP +    +VS DP  L LR+EH H FS    E GH++ D TP+ V+Y  YF+  E + R
Sbjct:    8 QLHAPDLEELRGVLQAGLESNFAEVRVSVAECPDLSKEPFQFPVKGLCGSPRITDVGGVPYLVPLVQKDKVEYDMNTISKKVELPGAFLLGAGAAP-------CRII---------------------------------------------GMNAEVIEVQAKKRTGSHSLVTALRKTLEAHYPDKS--LALGGTFIIKKGKAKIHIMPREFSACPLNTNDDVNKWLKHFEVNAPLICQSVLVSRDP-GLDLRVEHTHCFSH-HGEGGHYYIDTTPDSVEYLGYFLPAEFVYR 245          
BLAST of Ester hydrolase C11orf54-like protein vs. Planmine SMEST
Match: SMESG000007855.1 (SMESG000007855.1)

HSP 1 Score: 362.073 bits (928), Expect = 1.917e-127
Identity = 174/175 (99.43%), Postives = 175/175 (100.00%), Query Frame = 1
Query:  424 MLAKIINNANISFPAKSTKFGIIGQFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLRKNAC 948
            MLAKIINNANISFPAKSTKFGIIGQFLCCKGETGK+LKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLRKNAC
Sbjct:    1 MLAKIINNANISFPAKSTKFGIIGQFLCCKGETGKVLKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGVILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHDPLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLRKNAC 175          
BLAST of Ester hydrolase C11orf54-like protein vs. Planmine SMEST
Match: SMESG000027576.1 (SMESG000027576.1)

HSP 1 Score: 224.172 bits (570), Expect = 5.132e-74
Identity = 108/110 (98.18%), Postives = 109/110 (99.09%), Query Frame = 1
Query:   46 MNKFYNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEI 375
            MNKFYNLHTPSYEKLKSEFMEDL DAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCE+
Sbjct:    1 MNKFYNLHTPSYEKLKSEFMEDLHDAFEVIHCDVVICPDLSQEPFSLSAQGLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGPFFETGINCEV 110          
The following BLAST results are available for this feature:
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C11orf546.799e-6437.75chromosome 11 open reading frame 54 [Source:HGNC S... [more]
C11orf546.799e-6437.75chromosome 11 open reading frame 54 [Source:HGNC S... [more]
C11orf546.799e-6437.75chromosome 11 open reading frame 54 [Source:HGNC S... [more]
C11orf545.543e-6038.38chromosome 11 open reading frame 54 [Source:HGNC S... [more]
C11orf542.507e-5334.35chromosome 11 open reading frame 54 [Source:HGNC S... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C24B5.43.114e-5835.71pep chromosome:WBcel235:V:9195821:9197326:-1 gene:... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG91196.817e-5334.80gene:FBgn0035189 transcript:FBtr0072635[more]
CG323353.522e-5034.01gene:FBgn0063667 transcript:FBtr0273416[more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C5H11orf544.962e-6035.88zgc:85789 [Source:NCBI gene;Acc:322350][more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
c11orf544.672e-6037.00chromosome 11 open reading frame 54 [Source:NCBI g... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
4931406C07Rik2.269e-6237.38RIKEN cDNA 4931406C07 gene [Source:MGI Symbol;Acc:... [more]
4931406C07Rik2.269e-6237.38RIKEN cDNA 4931406C07 gene [Source:MGI Symbol;Acc:... [more]
4931406C07Rik2.269e-6237.38RIKEN cDNA 4931406C07 gene [Source:MGI Symbol;Acc:... [more]
4931406C07Rik6.467e-5037.55RIKEN cDNA 4931406C07 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HJH3|CK054_BOVIN1.032e-6338.08Ester hydrolase C11orf54 homolog OS=Bos taurus OX=... [more]
sp|Q9H0W9|CK054_HUMAN3.265e-6337.75Ester hydrolase C11orf54 OS=Homo sapiens OX=9606 G... [more]
sp|Q91V76|CK054_MOUSE1.587e-6137.38Ester hydrolase C11orf54 homolog OS=Mus musculus O... [more]
sp|Q5U2Q3|CK054_RAT3.159e-6137.95Ester hydrolase C11orf54 homolog OS=Rattus norvegi... [more]
sp|Q28GJ2|CK054_XENTR1.973e-5937.00Ester hydrolase C11orf54 homolog OS=Xenopus tropic... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D0M01.007e-7540.47Ester hydrolase C11orf54 isoform 2 OS=Schistosoma ... [more]
Q5BYZ91.252e-7540.61SJCHGC06040 protein (Fragment) OS=Schistosoma japo... [more]
A0A087T5J91.199e-7339.87Ester hydrolase (Fragment) OS=Stegodyphus mimosaru... [more]
A0A4D5RM591.203e-7040.20DUF1907 domain-containing protein (Fragment) OS=Ix... [more]
A0A2T7PI264.110e-7041.81DUF1907 domain-containing protein OS=Pomacea canal... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:857895.102e-6036.88chromosome 3 C11orf54 homolog [Source:NCBI gene;Ac... [more]
zgc:857893.287e-5337.17chromosome 3 C11orf54 homolog [Source:NCBI gene;Ac... [more]
zgc:857892.450e-4836.19chromosome 3 C11orf54 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO394254.420e-5634.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:857892.351e-5534.67chromosome 14 C11orf54 homolog [Source:NCBI gene;A... [more]
zgc:857895.301e-4331.29chromosome 14 C11orf54 homolog [Source:NCBI gene;A... [more]
back to top
BLAST of Ester hydrolase C11orf54-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000007855.11.917e-12799.43SMESG000007855.1[more]
SMESG000027576.15.132e-7498.18SMESG000027576.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022612 ID=SMED30022612|Name=Ester hydrolase C11orf54-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1009bp
CCCTATTATATTTTTGAAATTTTAATTATTGGATTATTTTTATAAATGAA
TAAATTTTACAATTTGCATACTCCAAGTTATGAGAAATTAAAATCAGAAT
TTATGGAGGATCTACTTGATGCATTTGAGGTGATTCATTGTGATGTTGTC
ATTTGCCCTGATTTATCACAAGAGCCATTTTCACTATCTGCACAAGGTTT
ATGTGGAAATCCGATTGTCGTGGACGTTGGGGGAATCGGGAACTTATTAC
CAACTCCAAATTTAAATGCGAAGTTCGATTTAACAGAAGCAATTTCAGAT
TGTCGAATTCCTAATGGTTTTATTTGTGGTGCTGGGGCCGGCCCATTTTT
TGAGACTGGTATTAACTGTGAAATTATTGCTGATGCAAAGTATGAAGACT
ATAAAATTTTCAAAAACAAATCTATGTTGGCTAAAATAATTAACAATGCG
AATATTTCTTTTCCAGCCAAATCCACTAAATTTGGAATAATTGGTCAATT
TTTATGCTGCAAGGGAGAAACTGGAAAAATTTTGAAAATTACAGCCGAGC
AAAGAAAGAAAGATGGATCAATTATTGATTTCATTCGTGATTCACTAAAA
AAACATTATGGCTCTGAGAAGCAACCAGTTGGATTGGGCGGAGTTATTCT
GACTCAATGTGGAGAAGTAAAAATCCACGTCATGCCGGATTTTAGCAAAT
GCCCTCTGGACACTGATTCAAAAGTAGAAGATTGGTTACATTTCTTTAAC
GTGCCAGCTCCATTTGTTGCTGTTGGAGAAATGGTATCCCACGATCCATT
GAACCTTGGGCTTCGTTTAGAACATTTTCATGGATTTTCTAAAGATCGAA
ATGAGGCCGGACATTTCCATCAAGACGTAACTCCAGAAATAGTTAAATAT
ACTTGTTACTTTGTTATTGGTGAAAAGTTGTTGCGGAAAAACGCATGCTG
AAAATTTTTAAAATTCATTCTTAATTAATGTTAGGTAATAAATATTTTAT
GTAATCAAG
back to top

protein sequence of SMED30022612-orf-1

>SMED30022612-orf-1 ID=SMED30022612-orf-1|Name=SMED30022612-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=302bp
MNKFYNLHTPSYEKLKSEFMEDLLDAFEVIHCDVVICPDLSQEPFSLSAQ
GLCGNPIVVDVGGIGNLLPTPNLNAKFDLTEAISDCRIPNGFICGAGAGP
FFETGINCEIIADAKYEDYKIFKNKSMLAKIINNANISFPAKSTKFGIIG
QFLCCKGETGKILKITAEQRKKDGSIIDFIRDSLKKHYGSEKQPVGLGGV
ILTQCGEVKIHVMPDFSKCPLDTDSKVEDWLHFFNVPAPFVAVGEMVSHD
PLNLGLRLEHFHGFSKDRNEAGHFHQDVTPEIVKYTCYFVIGEKLLRKNA
C*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000478pharynx musculature
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR015021DUF1907
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0016604nuclear body
GO:0070062extracellular exosome
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0016787hydrolase activity
GO:0016788hydrolase activity, acting on ester bonds
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015021Domain of unknown function DUF1907SMARTSM01168DUF1907_2coord: 1..189
e-value: 5.5E-40
score: 148.8
IPR015021Domain of unknown function DUF1907PFAMPF08925DUF1907coord: 11..188
e-value: 1.9E-59
score: 201.4
IPR015021Domain of unknown function DUF1907PANTHERPTHR13204PTD012 PROTEINcoord: 14..188
IPR015021Domain of unknown function DUF1907SMARTSM01168DUF1907_2coord: 2..90
e-value: 8.7E-4
score: -128.6
IPR015021Domain of unknown function DUF1907PFAMPF08925DUF1907coord: 3..90
e-value: 7.5E-28
score: 97.8
IPR015021Domain of unknown function DUF1907PANTHERPTHR13204PTD012 PROTEINcoord: 3..90
NoneNo IPR availableCDDcd17298DUF1907coord: 2..188
e-value: 2.30097E-82
score: 243.936
NoneNo IPR availableSUPERFAMILYSSF117856AF0104/ALDC/Ptd012-likecoord: 12..188
NoneNo IPR availableCDDcd17298DUF1907coord: 8..90
e-value: 8.66449E-37
score: 122.984
NoneNo IPR availableSUPERFAMILYSSF117856AF0104/ALDC/Ptd012-likecoord: 3..90