SMED30022596

Overview
NameSMED30022596
Smed IDSMED30022596
Length (bp)864
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022596 (SMED30022596) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022596 (SMED30022596) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022596 (SMED30022596) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022596 (SMED30022596) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022596

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gamma neoblastSMED30022596SMESG000071344.1 SMED30022596smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022596SMESG000071344.1 dd_Smed_v4_245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022596SMESG000071344.1 dd_Smed_v4_245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022596SMESG000071344.1 dd_Smed_v4_245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022596SMESG000071344.1 OX_Smed_1.0.22071ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30022596SMESG000071344.1 dd_Smed_v6_245_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022596SMESG000071344.1 dd_Smed_v4_245_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022596 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.024774:7524..9046 +4256
v31.008312:776..2298 +4238
Homology
BLAST of SMED30022596 vs. TrEMBL
Match: A0A4T0RR79 (DNA-directed RNA polymerase subunit OS=Wallemia mellicola OX=1708541 GN=E3Q13_03857 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 6.250e-10
Identity = 32/80 (40.00%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHE 398
            Y+P  P YSP  P+Y+P  P YSP    Y P  P Y P     S  S  Y+P  P YS A P YSP  P+ ++ V+ + +
Sbjct: 2301 YSPTSPRYSPASPAYSPTSPTYSPASPAYSPASPAYSPASPAYSPASPAYSPASPAYSPASPAYSPTSPSGANGVNGEQK 2380          

HSP 2 Score: 66.6254 bits (161), Expect = 2.060e-8
Identity = 43/131 (32.82%), Postives = 53/131 (40.46%), Query Frame = 3
Query:  180 YSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHEAFYPPTVEAGMISCPVGQPGIMCSENEPGIPYPSAPPIIMDYPSY--PSSCYTPGTPN 566
            YSP  PSY+P  P YSP    Y P  P Y P        S +Y+P  P YS   P YSP  P YS A        Y PT      + P   P             P++P      P+Y   S  Y+P +P+
Sbjct: 2252 YSPASPSYSPTSPRYSPASPAYSPSSPKYSP-------TSPKYSPTSPQYSPTSPQYSPTSPRYSPA-----SPAYSPTSPTYSPASPAYSPASPAYSPASPAYSPASPAYSPASPAYSPASPAYSPTSPS 2370          
BLAST of SMED30022596 vs. TrEMBL
Match: A0A4V4MJ28 (DNA-directed RNA polymerase subunit OS=Wallemia mellicola OX=1708541 GN=E3Q17_03792 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 6.250e-10
Identity = 32/80 (40.00%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHE 398
            Y+P  P YSP  P+Y+P  P YSP    Y P  P Y P     S  S  Y+P  P YS A P YSP  P+ ++ V+ + +
Sbjct: 2301 YSPTSPRYSPASPAYSPTSPTYSPASPAYSPASPAYSPASPAYSPASPAYSPASPAYSPASPAYSPTSPSGANGVNGEQK 2380          

HSP 2 Score: 66.6254 bits (161), Expect = 2.060e-8
Identity = 43/131 (32.82%), Postives = 53/131 (40.46%), Query Frame = 3
Query:  180 YSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHEAFYPPTVEAGMISCPVGQPGIMCSENEPGIPYPSAPPIIMDYPSY--PSSCYTPGTPN 566
            YSP  PSY+P  P YSP    Y P  P Y P        S +Y+P  P YS   P YSP  P YS A        Y PT      + P   P             P++P      P+Y   S  Y+P +P+
Sbjct: 2252 YSPASPSYSPTSPRYSPASPAYSPSSPKYSP-------TSPKYSPTSPQYSPTSPQYSPTSPRYSPA-----SPAYSPTSPTYSPASPAYSPASPAYSPASPAYSPASPAYSPASPAYSPASPAYSPTSPS 2370          
BLAST of SMED30022596 vs. TrEMBL
Match: A0A4C1VZ83 (DNA-directed RNA polymerase II subunit RPB1 OS=Eumeta variegata OX=151549 GN=RPII PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 6.214e-8
Identity = 38/105 (36.19%), Postives = 57/105 (54.29%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHEAFYPPTVEAGMISCPVGQPGIMCSE 473
            YT  VP+Y+  +PSY  GVP+Y+ G+ +Y  G+P Y  GV + +     YT GVP+Y+  VP+Y+  VP+Y+  V    E    P ++       V QP +  S 
Sbjct:   92 YTEDVPSYTDCVPSYIEGVPSYTEGVPSYTEGVPSYTEGVPSYTEGVPAYTEGVPSYTEGVPSYTEGVPSYTEGVPAYTEGVSCPILKVCRPILKVSQPILKVSR 196          

HSP 2 Score: 61.6178 bits (148), Expect = 2.724e-7
Identity = 38/97 (39.18%), Postives = 56/97 (57.73%), Query Frame = 3
Query:  156 YYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHEAFYPPTVEAGMISCPV 446
            +YT GV +Y+  +PSYT  VP+Y  G+ +Y  G+P Y  GV + +     YT GVP Y+  VP+Y+  VP+Y+  V +  E    P    G +SCP+
Sbjct:   84 FYTEGVLSYTEDVPSYTDCVPSYIEGVPSYTEGVPSYTEGVPSYTEGVPSYTEGVPAYTEGVPSYTEGVPSYTEGVPSYTEGV--PAYTEG-VSCPI 177          
BLAST of SMED30022596 vs. TrEMBL
Match: A0A3B6HRY9 (Uncharacterized protein OS=Triticum aestivum OX=4565 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.540e-7
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query:  150 QNYYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYS 374
            ++YYTP  P+YSP  P Y+P  P+Y+P   +Y P  P Y P   + +  S  YTP  P+Y+ A P+Y+P  P+Y+
Sbjct:   57 KDYYTPSSPDYSPASPDYSPASPDYTPASPDYTPASPDYSPASPDYTPASPDYTPASPDYTPASPDYTPESPDYT 131          
BLAST of SMED30022596 vs. TrEMBL
Match: A0A446QN69 (Uncharacterized protein OS=Triticum turgidum subsp. durum OX=4567 GN=TRITD_4Av1G020950 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.073e-6
Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 3
Query:  150 QNYYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPN 368
            ++YYTP  P+YSP  P Y+P  P+Y+P   +Y P  P Y P   + + +S  YTP  P+Y+ + P+Y+PA P+
Sbjct:   57 KDYYTPSSPDYSPASPDYSPASPDYTPASPDYTPASPDYTPESPDYTPSSPDYTPASPDYNPSSPDYTPASPS 129          
BLAST of SMED30022596 vs. Ensembl Cavefish
Match: ENSAMXT00000034786.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:19107313:19110294:-1 gene:ENSAMXG00000031037.1 transcript:ENSAMXT00000034786.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 6.260e-7
Identity = 20/79 (25.32%), Postives = 33/79 (41.77%), Query Frame = 3
Query:  153 NYYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            +   PG+    PG+    PG+    PG+S  RPG+    PG+       S+  PG+      +    P +  ++   HN
Sbjct:  860 SKLRPGLSKLRPGLSKLRPGLSKLRPGLSKLRPGLSKLRPGLSKLRPGLSKLRPGLSKLRPGLSKLRPTLTQHTQIQHN 938          
BLAST of SMED30022596 vs. Ensembl Nematostella
Match: EDO49591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFE3])

HSP 1 Score: 71.633 bits (174), Expect = 8.572e-16
Identity = 28/77 (36.36%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            ++PG   +SPG+ +++ GV  +SPG+  + PG+  + PGV+ CS     ++PGV  +SS V  +SP    +SH V  
Sbjct:   16 WSPGKETWSPGVETWSSGVKTWSPGVETWSPGVETWSPGVETCSPGEETWSPGVETWSSGVKTWSPGEETWSHGVET 92          

HSP 2 Score: 55.4546 bits (132), Expect = 5.807e-10
Identity = 24/72 (33.33%), Postives = 41/72 (56.94%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYS 374
            ++PGV  +SPG+ + +PG   +SPG+  +  G+  + PG +  S     ++PGV  +S  V  +SP V  +S
Sbjct:   44 WSPGVETWSPGVETCSPGEETWSPGVETWSSGVKTWSPGEETWSHGVETWSPGVETWSPGVDTWSPGVDTWS 115          

HSP 3 Score: 49.6766 bits (117), Expect = 6.120e-8
Identity = 23/67 (34.33%), Postives = 37/67 (55.22%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPA 359
            ++PGV   SPG  +++PGV  +S G+  + PG   +  GV+  S     ++PGV  +S  V  +SP 
Sbjct:   51 WSPGVETCSPGEETWSPGVETWSSGVKTWSPGEETWSHGVETWSPGVETWSPGVDTWSPGVDTWSPG 117          
BLAST of SMED30022596 vs. Ensembl Nematostella
Match: EDO36252 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ84])

HSP 1 Score: 51.9878 bits (123), Expect = 2.761e-8
Identity = 22/77 (28.57%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP V  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:    6 YTPLIDTYTPLIDTYTPLVDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDT 82          

HSP 2 Score: 51.9878 bits (123), Expect = 2.761e-8
Identity = 22/77 (28.57%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP V  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   20 YTPLVDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDT 96          

HSP 3 Score: 51.6026 bits (122), Expect = 3.412e-8
Identity = 22/77 (28.57%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  YS  +  
Sbjct:   90 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDIYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYSPLIDT 166          

HSP 4 Score: 51.6026 bits (122), Expect = 3.793e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   27 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDT 103          

HSP 5 Score: 51.6026 bits (122), Expect = 3.793e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   34 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDT 110          

HSP 6 Score: 51.6026 bits (122), Expect = 3.793e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   41 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDT 117          

HSP 7 Score: 51.2174 bits (121), Expect = 4.382e-8
Identity = 21/72 (29.17%), Postives = 37/72 (51.39%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYS 374
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+
Sbjct:   48 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYT 119          

HSP 8 Score: 51.2174 bits (121), Expect = 5.110e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   13 YTPLIDTYTPLVDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDT 89          

HSP 9 Score: 51.2174 bits (121), Expect = 5.735e-8
Identity = 22/72 (30.56%), Postives = 37/72 (51.39%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYS 374
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  YSP +  Y+
Sbjct:   97 YTPLIDTYTPLIDTYTPLIDTYTPLIDIYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYSPLIDTYT 168          

HSP 10 Score: 50.8322 bits (120), Expect = 6.017e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   76 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDIYTPLIDTYTPLIDTYTPLIDTYTPLIDT 152          

HSP 11 Score: 50.447 bits (119), Expect = 9.006e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   55 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDIYTPLIDT 131          

HSP 12 Score: 50.447 bits (119), Expect = 9.006e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   62 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDIYTPLIDTYTPLIDT 138          

HSP 13 Score: 50.447 bits (119), Expect = 9.006e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   69 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDIYTPLIDTYTPLIDTYTPLIDT 145          

HSP 14 Score: 50.447 bits (119), Expect = 9.006e-8
Identity = 21/77 (27.27%), Postives = 38/77 (49.35%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:   83 YTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDIYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDT 159          

HSP 15 Score: 48.521 bits (114), Expect = 4.049e-7
Identity = 21/68 (30.88%), Postives = 35/68 (51.47%), Query Frame = 3
Query:  159 YTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAV 362
            YTP +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  YS  +  Y+P +
Sbjct:  104 YTPLIDTYTPLIDTYTPLIDIYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYSPLIDTYTPLI 171          

HSP 16 Score: 47.7506 bits (112), Expect = 7.751e-7
Identity = 19/75 (25.33%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  165 PGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHN 389
            P +  Y+P + +YTP +  Y+P +  Y P +  Y P +   +     YTP +  Y+  +  Y+P +  Y+  +  
Sbjct:    1 PLIDTYTPLIDTYTPLIDTYTPLVDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDT 75          
BLAST of SMED30022596 vs. Ensembl Nematostella
Match: EDO36251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ83])

HSP 1 Score: 48.9062 bits (115), Expect = 9.819e-8
Identity = 18/64 (28.12%), Postives = 33/64 (51.56%), Query Frame = 3
Query:  183 SPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYS 374
            +P + +YTP +  Y+P +  Y P +  Y P +  C+     YTP +  Y+  +  Y+P +  Y+
Sbjct:    1 TPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTCTPLIDTYTPLIDTYTPLIDTYTPLIDTYT 64          

HSP 2 Score: 45.0542 bits (105), Expect = 2.275e-6
Identity = 19/77 (24.68%), Postives = 36/77 (46.75%), Query Frame = 3
Query:  162 TPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQ 392
            TP +  Y+P + +YTP +  Y+P +  Y P +    P +   +     YTP +  Y+  +  Y+P    Y+  +  +
Sbjct:    1 TPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLIDTCTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLKDTYTPLIDTE 77          

HSP 3 Score: 43.8986 bits (102), Expect = 4.967e-6
Identity = 19/80 (23.75%), Postives = 37/80 (46.25%), Query Frame = 3
Query:  153 NYYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQ 392
            + YTP +  Y+P + +YTP +  Y+P +    P +  Y P +   +     YTP +  Y+     Y+P +   +  +  +
Sbjct:    5 DTYTPLIDTYTPLIDTYTPLIDTYTPLIDTCTPLIDTYTPLIDTYTPLIDTYTPLIDTYTPLKDTYTPLIDTETPLIDTE 84          
BLAST of SMED30022596 vs. Ensembl Nematostella
Match: EDO40529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S720])

HSP 1 Score: 46.595 bits (109), Expect = 1.212e-6
Identity = 22/76 (28.95%), Postives = 31/76 (40.79%), Query Frame = 3
Query:  156 YYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAV 383
               P VP   P +P   P VP   P +    P +P  +P V     +  +  P VP    +VP   P+VP    +V
Sbjct:   27 RLIPSVPRLIPSVPRLIPSVPRLIPSVPRLIPSVPRMIPSVHRLIPSVPRLIPSVPRLIPSVPRLIPSVPRLIPSV 102          

HSP 2 Score: 45.4394 bits (106), Expect = 2.457e-6
Identity = 22/76 (28.95%), Postives = 31/76 (40.79%), Query Frame = 3
Query:  156 YYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAV 383
               P VP   P +P   P VP   P +    P +P  +P V     +  +  P VP    +VP   P+VP    +V
Sbjct:   41 RLIPSVPRLIPSVPRLIPSVPRMIPSVHRLIPSVPRLIPSVPRLIPSVPRLIPSVPRLIPSVPRLIPSVPRLIPSV 116          

HSP 3 Score: 45.4394 bits (106), Expect = 2.655e-6
Identity = 22/76 (28.95%), Postives = 31/76 (40.79%), Query Frame = 3
Query:  156 YYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAV 383
               P VP   P +P   P VP   P +    P +P  +P V     +  +  P VP    +VP   P+VP    +V
Sbjct:   20 RLIPSVPRLIPSVPRLIPSVPRLIPSVPRLIPSVPRLIPSVPRMIPSVHRLIPSVPRLIPSVPRLIPSVPRLIPSV 95          
BLAST of SMED30022596 vs. Ensembl Medaka
Match: znf346 (zinc finger protein 346 [Source:NCBI gene;Acc:101166820])

HSP 1 Score: 48.1358 bits (113), Expect = 6.079e-6
Identity = 24/74 (32.43%), Postives = 32/74 (43.24%), Query Frame = 3
Query:  153 NYYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYS 374
            + YTP    Y+P    YTP     +P    Y P    Y P   + ++   QY P    YS AV  Y+PA   Y+
Sbjct:  299 DEYTPADDEYTPADDEYTPADDKCTPADDEYTPADDKYTPADDHNTTADDQYKPAGDQYSFAVDRYTPADDRYT 372          
BLAST of SMED30022596 vs. Planmine SMEST
Match: SMESG000071344.1 (SMESG000071344.1)

HSP 1 Score: 278.485 bits (711), Expect = 1.515e-95
Identity = 147/149 (98.66%), Postives = 147/149 (98.66%), Query Frame = 3
Query:  132 MNRGYQQNYYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQNCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHEAFYPPTVEAGMISCPVGQPGIMCSENEPGIPYPSAPPIIMDYPSYPSSCYTPGTPNNYPY 578
            MNRGYQQNYYTPGVPNYSPGMP YTPGVPNYSPGMSNYRPGMPGYLPGVQNC SNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHEAFYPPTVEAGMISCPVGQPGIMCSENEPGIPYPSAPPIIMDYPSYPSSCYTPGTPNNYPY
Sbjct:    1 MNRGYQQNYYTPGVPNYSPGMPGYTPGVPNYSPGMSNYRPGMPGYLPGVQNCPSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHEAFYPPTVEAGMISCPVGQPGIMCSENEPGIPYPSAPPIIMDYPSYPSSCYTPGTPNNYPY 149          
The following BLAST results are available for this feature:
BLAST of SMED30022596 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4T0RR796.250e-1040.00DNA-directed RNA polymerase subunit OS=Wallemia me... [more]
A0A4V4MJ286.250e-1040.00DNA-directed RNA polymerase subunit OS=Wallemia me... [more]
A0A4C1VZ836.214e-836.19DNA-directed RNA polymerase II subunit RPB1 OS=Eum... [more]
A0A3B6HRY92.540e-741.33Uncharacterized protein OS=Triticum aestivum OX=45... [more]
A0A446QN692.073e-641.10Uncharacterized protein OS=Triticum turgidum subsp... [more]
back to top
BLAST of SMED30022596 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000034786.16.260e-725.32pep primary_assembly:Astyanax_mexicanus-2.0:1:1910... [more]
back to top
BLAST of SMED30022596 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022596 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO495918.572e-1636.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362522.761e-828.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362519.819e-828.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405291.212e-628.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30022596 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf3466.079e-632.43zinc finger protein 346 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of SMED30022596 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000071344.11.515e-9598.66SMESG000071344.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022596 ID=SMED30022596|Name=SMED30022596|organism=Schmidtea mediterranea sexual|type=transcript|length=864bp
CTAATTTTAATCATATTATCTGTAAAATCATATGAATAAAAATTTAATGA
TTCAATTTTGTATCAAAGGTCGGATACCAAATTTGGAATAAATTGTTAAG
ATTGTTCACAATTGAATTTTAATCAAACAAAATGAATCGCGGATATCAGC
AGAATTATTACACTCCAGGAGTGCCCAATTATTCGCCGGGTATGCCCAGT
TACACACCAGGAGTCCCTAATTACTCACCAGGCATGTCTAATTATAGACC
AGGAATGCCTGGTTATTTGCCGGGAGTACAAAATTGTTCATCAAATTCGT
CTCAATATACACCTGGTGTTCCAAATTATTCATCCGCCGTACCTAACTAT
TCACCGGCCGTACCTAATTATTCACACGCAGTCCATAATCAACATGAAGC
ATTCTATCCACCAACAGTTGAAGCAGGAATGATTTCTTGTCCAGTTGGAC
AACCTGGGATAATGTGTTCTGAAAATGAACCAGGAATTCCGTATCCAAGT
GCTCCTCCAATAATTATGGATTATCCTTCTTACCCATCAAGTTGCTACAC
TCCGGGAACTCCTAATAATTATCCATATTAAAAAACTTAATTTCCAAATG
ATTTTAAAAATTTCTAGTGAACATTCTACTAATTGTTTTTTATGCAATCA
GTATTTACGAATGAATAATTAGTTTAATATACAATTATTTAATATTAATA
CACAGTAAAACTGTAGTAAACTACAGGTCATCTGAATGTTAGGTTAGCCC
CTCTGAAATGTTATTTTATTTTAATCATTAGTTTAATTTGATTCATTCAT
AATTCCTTAATTTTAAATTCTTGGAAAATATTATGTGAACTATTTATTAA
ATGCGTCAAAAGGA
back to top

protein sequence of SMED30022596-orf-1

>SMED30022596-orf-1 ID=SMED30022596-orf-1|Name=SMED30022596-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
MNRGYQQNYYTPGVPNYSPGMPSYTPGVPNYSPGMSNYRPGMPGYLPGVQ
NCSSNSSQYTPGVPNYSSAVPNYSPAVPNYSHAVHNQHEAFYPPTVEAGM
ISCPVGQPGIMCSENEPGIPYPSAPPIIMDYPSYPSSCYTPGTPNNYPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: cellular component
TermDefinition
GO:0005665DNA-directed RNA polymerase II, core complex
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter