runt-1

Overview
Namerunt-1 (AEF16013.1)
Smed IDSMED30022580
Length (bp)1307
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of runt-1 (SMED30022580) t-SNE clustered cells

Violin plots show distribution of expression levels for runt-1 (SMED30022580) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of runt-1 (SMED30022580) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for runt-1 (SMED30022580) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022580

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022580SMESG000014779.1 SmedASXL_019812SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30022580SMESG000014779.1 SmedASXL_019812SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022580SMESG000014779.1 SmedASXL_019812SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30022580SMESG000014779.1 dd_Smed_v6_16222_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022580SMESG000014779.1 Contig54774newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30022580SMESG000014779.1 Contig54774uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of runt-1 vs. Ensembl Human
Match: RUNX2 (RUNX family transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:10472])

HSP 1 Score: 113.62 bits (283), Expect = 5.241e-28
Identity = 60/127 (47.24%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPRN  +
Sbjct:   98 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRNPRQ 218          
BLAST of runt-1 vs. Ensembl Human
Match: RUNX1 (RUNX family transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:10471])

HSP 1 Score: 112.079 bits (279), Expect = 1.125e-27
Identity = 58/129 (44.96%), Postives = 74/129 (57.36%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNF 885
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPR   +  
Sbjct:   76 ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKL 198          
BLAST of runt-1 vs. Ensembl Human
Match: RUNX1 (RUNX family transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:10471])

HSP 1 Score: 111.694 bits (278), Expect = 1.278e-27
Identity = 58/129 (44.96%), Postives = 74/129 (57.36%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNF 885
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPR   +  
Sbjct:   61 ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKL 183          
BLAST of runt-1 vs. Ensembl Human
Match: RUNX1 (RUNX family transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:10471])

HSP 1 Score: 114.005 bits (284), Expect = 2.094e-27
Identity = 59/127 (46.46%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPRN  +
Sbjct:   61 ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRNTRQ 181          
BLAST of runt-1 vs. Ensembl Human
Match: RUNX2 (RUNX family transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:10472])

HSP 1 Score: 112.079 bits (279), Expect = 4.281e-27
Identity = 60/136 (44.12%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNI 906
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR   +    +K ++
Sbjct:   98 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSL 227          
BLAST of runt-1 vs. Ensembl Celegans
Match: rnt-1 (RNT-1; RuNT related; Transcription factor RUN [Source:UniProtKB/TrEMBL;Acc:G5EFQ5])

HSP 1 Score: 93.2041 bits (230), Expect = 5.658e-21
Identity = 50/119 (42.02%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  511 TSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR 867
            +S P +  T LP+HWRSNKS    F V++      + P+ D   V + A N       +RN ++K+    A+FNDLRF+ RSGRG+ F + I I   P ++A   N IKVTVDGPR+ R
Sbjct:   25 SSSPNILYTALPKHWRSNKSFQEPFYVVL------LTPVPDNTEVSIWAGNDEKPCEEVRNEKAKVHRQVAKFNDLRFVGRSGRGRKFHLTIVIHSAPMMVATVKNVIKVTVDGPRDAR 137          
BLAST of runt-1 vs. Ensembl Celegans
Match: rnt-1 (RNT-1; RuNT related; Transcription factor RUN [Source:UniProtKB/TrEMBL;Acc:G5EFQ5])

HSP 1 Score: 93.2041 bits (230), Expect = 5.658e-21
Identity = 50/119 (42.02%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  511 TSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR 867
            +S P +  T LP+HWRSNKS    F V++      + P+ D   V + A N       +RN ++K+    A+FNDLRF+ RSGRG+ F + I I   P ++A   N IKVTVDGPR+ R
Sbjct:   25 SSSPNILYTALPKHWRSNKSFQEPFYVVL------LTPVPDNTEVSIWAGNDEKPCEEVRNEKAKVHRQVAKFNDLRFVGRSGRGRKFHLTIVIHSAPMMVATVKNVIKVTVDGPRDAR 137          
BLAST of runt-1 vs. Ensembl Fly
Match: lz (gene:FBgn0002576 transcript:FBtr0112814)

HSP 1 Score: 127.487 bits (319), Expect = 2.537e-31
Identity = 61/125 (48.80%), Postives = 81/125 (64.80%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNK 873
            ++V TS+P   C+ LP HWRSNK+LP  F+V+       +  +GDG  V + A N     A LRNF +++ N  A+FNDLRF+ RSGRGK F + I +  +P  +A Y  AIKVTVDGPREPR+K
Sbjct:  286 ELVRTSNPYFLCSALPAHWRSNKTLPMAFKVVA------LAEVGDGTYVTIRAGNDENCCAELRNFTTQMKNDVAKFNDLRFVGRSGRGKSFTLTITVATSPPQVATYAKAIKVTVDGPREPRSK 404          
BLAST of runt-1 vs. Ensembl Fly
Match: lz (gene:FBgn0002576 transcript:FBtr0071320)

HSP 1 Score: 127.102 bits (318), Expect = 3.654e-31
Identity = 61/125 (48.80%), Postives = 81/125 (64.80%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNK 873
            ++V TS+P   C+ LP HWRSNK+LP  F+V+       +  +GDG  V + A N     A LRNF +++ N  A+FNDLRF+ RSGRGK F + I +  +P  +A Y  AIKVTVDGPREPR+K
Sbjct:  286 ELVRTSNPYFLCSALPAHWRSNKTLPMAFKVVA------LAEVGDGTYVTIRAGNDENCCAELRNFTTQMKNDVAKFNDLRFVGRSGRGKSFTLTITVATSPPQVATYAKAIKVTVDGPREPRSK 404          
BLAST of runt-1 vs. Ensembl Fly
Match: RunxA (gene:FBgn0083981 transcript:FBtr0308028)

HSP 1 Score: 125.561 bits (314), Expect = 8.510e-31
Identity = 68/162 (41.98%), Postives = 94/162 (58.02%), Query Frame = 1
Query:  415 IMNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNK---HKNFYF 891
            ++N+ +   ++D    +   + L+    +++ TS PL  CT LP HWRSNK+LP  F+V+       +  I DG  V + A N     A LRN  + + N  A+FNDLRF+ RSGRGK F + I +  NP  IA Y  AIKVTVDGPREPR+K    + F+F
Sbjct:   70 LLNEAYTKMTSDILAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVV------SLGDIMDGTMVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRSKTRQQQQFHF 225          
BLAST of runt-1 vs. Ensembl Fly
Match: RunxA (gene:FBgn0083981 transcript:FBtr0331159)

HSP 1 Score: 124.79 bits (312), Expect = 1.722e-30
Identity = 66/153 (43.14%), Postives = 90/153 (58.82%), Query Frame = 1
Query:  415 IMNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNK 873
            ++N+ +   ++D    +   + L+    +++ TS PL  CT LP HWRSNK+LP  F+V+       +  I DG  V + A N     A LRN  + + N  A+FNDLRF+ RSGRGK F + I +  NP  IA Y  AIKVTVDGPREPR+K
Sbjct:   70 LLNEAYTKMTSDILAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVV------SLGDIMDGTMVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRSK 216          
BLAST of runt-1 vs. Ensembl Fly
Match: RunxA (gene:FBgn0083981 transcript:FBtr0331160)

HSP 1 Score: 124.79 bits (312), Expect = 2.006e-30
Identity = 66/153 (43.14%), Postives = 90/153 (58.82%), Query Frame = 1
Query:  415 IMNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNK 873
            ++N+ +   ++D    +   + L+    +++ TS PL  CT LP HWRSNK+LP  F+V+       +  I DG  V + A N     A LRN  + + N  A+FNDLRF+ RSGRGK F + I +  NP  IA Y  AIKVTVDGPREPR+K
Sbjct:   70 LLNEAYTKMTSDILAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVV------SLGDIMDGTMVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRSK 216          
BLAST of runt-1 vs. Ensembl Zebrafish
Match: runx2a (RUNX family transcription factor 2a [Source:ZFIN;Acc:ZDB-GENE-040629-3])

HSP 1 Score: 112.464 bits (280), Expect = 3.341e-28
Identity = 60/127 (47.24%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPRN  +
Sbjct:   59 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRNPRQ 179          
BLAST of runt-1 vs. Ensembl Zebrafish
Match: runx3 (RUNX family transcription factor 3 [Source:ZFIN;Acc:ZDB-GENE-000605-2])

HSP 1 Score: 114.005 bits (284), Expect = 2.489e-27
Identity = 80/231 (34.63%), Postives = 115/231 (49.78%), Query Frame = 1
Query:  457 KSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR-------NKHKNF--------YFTKNNIKIPNFIPKSEP-DSHFCYSGS---PGL----TDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSL 1080
            +S+   + L+    ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +   P  +A Y  AIKVTVDGPREPR       + HK F         F + ++++      + P  +H+  S +   PGL     DPP+  +    D    +  D F+Q+++    PSL
Sbjct:   44 ESRSVVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTGPPQVATYHRAIKVTVDGPREPRRHRVKPDDPHKQFSDRLSDIERFQRASLRMNPGNGTTRPHQTHYSPSSTTQIPGLWPDQIDPPTLKTCKVEDDLRWTSTDLFQQRTSF---PSL 265          
BLAST of runt-1 vs. Ensembl Zebrafish
Match: runx3 (RUNX family transcription factor 3 [Source:ZFIN;Acc:ZDB-GENE-000605-2])

HSP 1 Score: 114.005 bits (284), Expect = 2.489e-27
Identity = 80/231 (34.63%), Postives = 115/231 (49.78%), Query Frame = 1
Query:  457 KSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR-------NKHKNF--------YFTKNNIKIPNFIPKSEP-DSHFCYSGS---PGL----TDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSL 1080
            +S+   + L+    ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +   P  +A Y  AIKVTVDGPREPR       + HK F         F + ++++      + P  +H+  S +   PGL     DPP+  +    D    +  D F+Q+++    PSL
Sbjct:   44 ESRSVVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTGPPQVATYHRAIKVTVDGPREPRRHRVKPDDPHKQFSDRLSDIERFQRASLRMNPGNGTTRPHQTHYSPSSTTQIPGLWPDQIDPPTLKTCKVEDDLRWTSTDLFQQRTSF---PSL 265          
BLAST of runt-1 vs. Ensembl Zebrafish
Match: runx3 (RUNX family transcription factor 3 [Source:ZFIN;Acc:ZDB-GENE-000605-2])

HSP 1 Score: 114.005 bits (284), Expect = 3.092e-27
Identity = 80/231 (34.63%), Postives = 115/231 (49.78%), Query Frame = 1
Query:  457 KSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR-------NKHKNF--------YFTKNNIKIPNFIPKSEP-DSHFCYSGS---PGL----TDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSL 1080
            +S+   + L+    ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +   P  +A Y  AIKVTVDGPREPR       + HK F         F + ++++      + P  +H+  S +   PGL     DPP+  +    D    +  D F+Q+++    PSL
Sbjct:   58 ESRSVVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTGPPQVATYHRAIKVTVDGPREPRRHRVKPDDPHKQFSDRLSDIERFQRASLRMNPGNGTTRPHQTHYSPSSTTQIPGLWPDQIDPPTLKTCKVEDDLRWTSTDLFQQRTSF---PSL 279          
BLAST of runt-1 vs. Ensembl Zebrafish
Match: runx3 (RUNX family transcription factor 3 [Source:ZFIN;Acc:ZDB-GENE-000605-2])

HSP 1 Score: 114.005 bits (284), Expect = 3.092e-27
Identity = 80/231 (34.63%), Postives = 115/231 (49.78%), Query Frame = 1
Query:  457 KSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR-------NKHKNF--------YFTKNNIKIPNFIPKSEP-DSHFCYSGS---PGL----TDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSL 1080
            +S+   + L+    ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +   P  +A Y  AIKVTVDGPREPR       + HK F         F + ++++      + P  +H+  S +   PGL     DPP+  +    D    +  D F+Q+++    PSL
Sbjct:   58 ESRSVVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTGPPQVATYHRAIKVTVDGPREPRRHRVKPDDPHKQFSDRLSDIERFQRASLRMNPGNGTTRPHQTHYSPSSTTQIPGLWPDQIDPPTLKTCKVEDDLRWTSTDLFQQRTSF---PSL 279          
BLAST of runt-1 vs. Ensembl Xenopus
Match: taf4 (TATA-box binding protein associated factor 4 [Source:Xenbase;Acc:XB-GENE-488490])

HSP 1 Score: 113.62 bits (283), Expect = 3.075e-27
Identity = 59/127 (46.46%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR+  +
Sbjct:   72 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE------VSDGSVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRHPRQ 192          
BLAST of runt-1 vs. Ensembl Xenopus
Match: taf4 (TATA-box binding protein associated factor 4 [Source:Xenbase;Acc:XB-GENE-488490])

HSP 1 Score: 114.005 bits (284), Expect = 4.727e-27
Identity = 60/136 (44.12%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNI 906
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR   +    +K ++
Sbjct:   72 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE------VSDGSVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSL 201          
BLAST of runt-1 vs. Ensembl Xenopus
Match: taf4 (TATA-box binding protein associated factor 4 [Source:Xenbase;Acc:XB-GENE-488490])

HSP 1 Score: 114.005 bits (284), Expect = 4.866e-27
Identity = 60/136 (44.12%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNI 906
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR   +    +K ++
Sbjct:   86 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE------VSDGSVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSL 215          
BLAST of runt-1 vs. Ensembl Xenopus
Match: znf385d (zinc finger protein 385D [Source:Xenbase;Acc:XB-GENE-1216182])

HSP 1 Score: 112.849 bits (281), Expect = 6.961e-27
Identity = 58/127 (45.67%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPR+  +
Sbjct:   61 ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRHTRQ 181          
BLAST of runt-1 vs. Ensembl Xenopus
Match: znf385d (zinc finger protein 385D [Source:Xenbase;Acc:XB-GENE-1216182])

HSP 1 Score: 112.849 bits (281), Expect = 1.518e-26
Identity = 59/128 (46.09%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKN 882
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPR +H+ 
Sbjct:   75 ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR-RHRQ 195          
BLAST of runt-1 vs. Ensembl Mouse
Match: Runx2 (runt related transcription factor 2 [Source:MGI Symbol;Acc:MGI:99829])

HSP 1 Score: 114.39 bits (285), Expect = 5.316e-29
Identity = 60/127 (47.24%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPRN  +
Sbjct:   16 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRNPRQ 136          
BLAST of runt-1 vs. Ensembl Mouse
Match: Runx2 (runt related transcription factor 2 [Source:MGI Symbol;Acc:MGI:99829])

HSP 1 Score: 113.235 bits (282), Expect = 4.381e-28
Identity = 60/127 (47.24%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPRN  +
Sbjct:  105 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRNPRQ 225          
BLAST of runt-1 vs. Ensembl Mouse
Match: Runx1 (runt related transcription factor 1 [Source:MGI Symbol;Acc:MGI:99852])

HSP 1 Score: 114.39 bits (285), Expect = 1.127e-27
Identity = 59/127 (46.46%), Postives = 75/127 (59.06%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPRN  +
Sbjct:   61 ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRNARQ 181          
BLAST of runt-1 vs. Ensembl Mouse
Match: Runx3 (runt related transcription factor 3 [Source:MGI Symbol;Acc:MGI:102672])

HSP 1 Score: 113.235 bits (282), Expect = 5.041e-27
Identity = 60/128 (46.88%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKN 882
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR +H+ 
Sbjct:   80 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR-RHRQ 200          
BLAST of runt-1 vs. Ensembl Mouse
Match: Runx3 (runt related transcription factor 3 [Source:MGI Symbol;Acc:MGI:102672])

HSP 1 Score: 112.849 bits (281), Expect = 5.276e-27
Identity = 60/128 (46.88%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKN 882
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR +H+ 
Sbjct:   66 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR-RHRQ 186          
BLAST of runt-1 vs. UniProt/SwissProt
Match: sp|Q9W349|LOZEN_DROME (Protein lozenge OS=Drosophila melanogaster OX=7227 GN=lz PE=2 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 3.663e-30
Identity = 61/125 (48.80%), Postives = 81/125 (64.80%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNK 873
            ++V TS+P   C+ LP HWRSNK+LP  F+V+       +  +GDG  V + A N     A LRNF +++ N  A+FNDLRF+ RSGRGK F + I +  +P  +A Y  AIKVTVDGPREPR+K
Sbjct:  286 ELVRTSNPYFLCSALPAHWRSNKTLPMAFKVVA------LAEVGDGTYVTIRAGNDENCCAELRNFTTQMKNDVAKFNDLRFVGRSGRGKSFTLTITVATSPPQVATYAKAIKVTVDGPREPRSK 404          
BLAST of runt-1 vs. UniProt/SwissProt
Match: sp|P22814|RUNT_DROME (Segmentation protein Runt OS=Drosophila melanogaster OX=7227 GN=run PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 2.505e-26
Identity = 59/130 (45.38%), Postives = 74/130 (56.92%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFY 888
            ++  T  P + C+ LP HWRSNKSLP  F+V+          + DG  V +   N       LRN  + + N  A+FNDLRF+ RSGRGK F + I I   P  IA Y+ AIKVTVDGPREPR+K    Y
Sbjct:  117 ELAQTGSPSILCSALPNHWRSNKSLPGAFKVIALDD------VPDGTLVSIKCGNDENYCGELRNCTTTMKNQVAKFNDLRFVGRSGRGKSFTLTITIATYPVQIASYSKAIKVTVDGPREPRSKQSYGY 240          
BLAST of runt-1 vs. UniProt/SwissProt
Match: sp|Q64131|RUNX3_MOUSE (Runt-related transcription factor 3 OS=Mus musculus OX=10090 GN=Runx3 PE=1 SV=3)

HSP 1 Score: 112.849 bits (281), Expect = 3.690e-26
Identity = 60/128 (46.88%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKN 882
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR +H+ 
Sbjct:   66 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR-RHRQ 186          
BLAST of runt-1 vs. UniProt/SwissProt
Match: sp|Q13761|RUNX3_HUMAN (Runt-related transcription factor 3 OS=Homo sapiens OX=9606 GN=RUNX3 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 4.377e-26
Identity = 60/128 (46.88%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKN 882
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR +H+ 
Sbjct:   65 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR-RHRQ 185          
BLAST of runt-1 vs. UniProt/SwissProt
Match: sp|Q13950|RUNX2_HUMAN (Runt-related transcription factor 2 OS=Homo sapiens OX=9606 GN=RUNX2 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 8.431e-26
Identity = 60/136 (44.12%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNI 906
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR   +    +K ++
Sbjct:  112 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSL 241          
BLAST of runt-1 vs. TrEMBL
Match: G1C1Q3 (Runt-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 290/290 (100.00%), Postives = 290/290 (100.00%), Query Frame = 1
Query:  418 MNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNIKIPNFIPKSEPDSHFCYSGSPGLTDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSLLYPYGTPNGCHFSLPQTKQDNFSMLQFMLMATTLRIGLPLAEIYNSQSHQRSPVKEIKDFDKTKIWRPF 1287
            MNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNIKIPNFIPKSEPDSHFCYSGSPGLTDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSLLYPYGTPNGCHFSLPQTKQDNFSMLQFMLMATTLRIGLPLAEIYNSQSHQRSPVKEIKDFDKTKIWRPF
Sbjct:    1 MNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNIKIPNFIPKSEPDSHFCYSGSPGLTDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSLLYPYGTPNGCHFSLPQTKQDNFSMLQFMLMATTLRIGLPLAEIYNSQSHQRSPVKEIKDFDKTKIWRPF 290          
BLAST of runt-1 vs. TrEMBL
Match: A0A1L7H9V6 (Transcriptional regulatory protein Runt-1 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 2.542e-124
Identity = 191/320 (59.69%), Postives = 239/320 (74.69%), Query Frame = 1
Query:  334 VFLIG*FSSLREIKFSGKSSD*LCRTAIMNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNIKIPNFIPKSEPDSHFCYSGSPGLTDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSLL--YPYGTPNGCHFSLPQTKQDNFSMLQFMLMATTLRIGLPLAEIYNSQSHQRSPVKEIKDFDKTKIWRPF 1287
             FLIG FSSLREIKF+           +MNQR N F+ +FTKSKYKF S S + +K++PTSHPLVFC+KLPQHWRSNKSLP+LFQV+  Q+NN +LP+ DGHRVWLSASN SMN+A+LRN ESKL+NGEARFNDLRFISRSGRGKYFD+YIHIE +P I+AVY+NAIKVTVDGPREPRNKHKN Y +K+++K+P FI  ++ +S  CY  SP + D  + W+ +K +T N S+ ++FE K N   SP++L  + +  P     +LP  K DN S LQ M+MA+T R+G PL +I N  SHQ  P+KE K  +K KIWRPF
Sbjct:   10 CFLIGQFSSLREIKFTQNRPFNCFHITLMNQRLN-FTNEFTKSKYKFTS-SPNNDKVMPTSHPLVFCSKLPQHWRSNKSLPSLFQVIFCQNNNGLLPVDDGHRVWLSASNQSMNNAILRNNESKLINGEARFNDLRFISRSGRGKYFDLYIHIEASPNIVAVYSNAIKVTVDGPREPRNKHKNLYLSKDSLKVPQFIRPTDSESGLCYPRSPDIDDHSNIWNISKIET-NFSDINTFENKFNCHFSPTMLSNFQHCWP----LNLPLQKPDNLSFLQLMIMASTFRMGFPLTDINNHLSHQNYPIKETKPVNKNKIWRPF 322          
BLAST of runt-1 vs. TrEMBL
Match: A0A0R3TQC1 (Runt domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9730 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 2.242e-37
Identity = 73/142 (51.41%), Postives = 97/142 (68.31%), Query Frame = 1
Query:  478 SLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNN 903
            +L  S+  +V T  P + C++LP+HWRSNKSLP  F+V+       ++P+ DG RV LSA N     A L+N  + + N EARFNDLRF+ RSGRGK F+V I++E NP +I  Y++AIKVTVDGPR PRNK+  +YF K N
Sbjct:   15 ALDESSGDLVVTGSPHLLCSRLPKHWRSNKSLPTPFRVV------SLVPVPDGTRVLLSAGNEERPFAELKNAIAVMQNQEARFNDLRFLGRSGRGKSFNVTINVETNPPLIGTYSHAIKVTVDGPRVPRNKYGKYYFNKLN 150          
BLAST of runt-1 vs. TrEMBL
Match: A0A0R3S906 (Runt domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS688 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 9.397e-33
Identity = 69/133 (51.88%), Postives = 92/133 (69.17%), Query Frame = 1
Query:  478 SLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKH 876
            +L  S+  +V T  P + C++LP+HWRSNKSLP  F+V+       ++P+ DG RV LSA N     A L+N  + + N EARFNDLRF+ RSGRGK F+V I++E NP +I  Y++AIKVTVDGPR PRNK+
Sbjct:   15 ALDESSGDLVITGSPHLLCSRLPKHWRSNKSLPTPFRVV------SLIPVPDGTRVLLSAGNEERPFAELKNAIAVMQNQEARFNDLRFLGRSGRGKSFNVTINVETNPPLIGTYSHAIKVTVDGPRVPRNKY 141          
BLAST of runt-1 vs. TrEMBL
Match: A0A183SL26 (Runt domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS4924 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.011e-31
Identity = 68/148 (45.95%), Postives = 92/148 (62.16%), Query Frame = 1
Query:  436 GFSTDFTKSKYKFN-SLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKH 876
            G  +D   ++Y    +L      ++ T  P + C+ LP+HWRSNKSLP  F+V+       ++P+ DG RV L+A N     A L+N  + + N EARFNDLRF+ RSGRGK F+V I +E NP  +  Y+ AIKVTVDGPR PRNK+
Sbjct:   48 GHMSDILLAEYTLRRALHEHAGDLMVTGSPHILCSTLPKHWRSNKSLPTPFRVV------SLIPVPDGTRVVLTAGNEERPFAELKNAVAIMQNQEARFNDLRFLGRSGRGKSFNVTITVESNPPQVGTYSRAIKVTVDGPRVPRNKY 189          
BLAST of runt-1 vs. Ensembl Cavefish
Match: ENSAMXT00000000899.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:25133550:25206568:-1 gene:ENSAMXG00000000881.2 transcript:ENSAMXT00000000899.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 3.582e-27
Identity = 60/128 (46.88%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKN 882
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR +H+ 
Sbjct:   77 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPR-RHRQ 197          
BLAST of runt-1 vs. Ensembl Cavefish
Match: runx1 (runt-related transcription factor 1 [Source:NCBI gene;Acc:103025657])

HSP 1 Score: 112.849 bits (281), Expect = 3.742e-27
Identity = 62/134 (46.27%), Postives = 78/134 (58.21%), Query Frame = 1
Query:  481 LSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKN 882
            LS    ++V T  P   C+ LP HWR NK+LP  F+V+          I DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPR +H+ 
Sbjct:   47 LSDHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------IPDGTLVTVMAGNDENYSAELRNATAAIKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPREPR-RHRQ 173          
BLAST of runt-1 vs. Ensembl Cavefish
Match: runx1 (runt-related transcription factor 1 [Source:NCBI gene;Acc:103025657])

HSP 1 Score: 112.464 bits (280), Expect = 4.156e-27
Identity = 61/133 (45.86%), Postives = 77/133 (57.89%), Query Frame = 1
Query:  481 LSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            LS    ++V T  P   C+ LP HWR NK+LP  F+V+          I DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPR+  +
Sbjct:   55 LSDHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------IPDGTLVTVMAGNDENYSAELRNATAAIKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPREPRHSRQ 181          
BLAST of runt-1 vs. Ensembl Cavefish
Match: runx1 (runt-related transcription factor 1 [Source:NCBI gene;Acc:103025657])

HSP 1 Score: 113.235 bits (282), Expect = 4.730e-27
Identity = 61/133 (45.86%), Postives = 77/133 (57.89%), Query Frame = 1
Query:  481 LSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            LS    ++V T  P   C+ LP HWR NK+LP  F+V+          I DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPR+  +
Sbjct:  119 LSDHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------IPDGTLVTVMAGNDENYSAELRNATAAIKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPREPRHSRQ 245          
BLAST of runt-1 vs. Ensembl Cavefish
Match: runx1 (runt-related transcription factor 1 [Source:NCBI gene;Acc:103025657])

HSP 1 Score: 113.235 bits (282), Expect = 5.351e-27
Identity = 61/133 (45.86%), Postives = 77/133 (57.89%), Query Frame = 1
Query:  481 LSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            LS    ++V T  P   C+ LP HWR NK+LP  F+V+          I DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIK+TVDGPREPR+  +
Sbjct:  134 LSDHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGD------IPDGTLVTVMAGNDENYSAELRNATAAIKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPREPRHSRQ 260          
BLAST of runt-1 vs. Ensembl Nematostella
Match: EDO33538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRX2])

HSP 1 Score: 113.235 bits (282), Expect = 5.056e-30
Identity = 59/125 (47.20%), Postives = 76/125 (60.80%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNK 873
            ++V T  P   C+ LP HWR NK+LP  F+V+          I DG  V ++A N    +A LRN  + + N  ARFNDLRF+ RSGRGK F + I ++  P  +A Y  AIKVTVDGPREPR+K
Sbjct:   28 ELVKTDSPNFVCSVLPSHWRCNKTLPVAFKVVSLGD------IPDGVIVSIAAGNDENFAAELRNATAVMKNQVARFNDLRFVGRSGRGKTFSLTITVKTEPPQVATYCRAIKVTVDGPREPRSK 146          
BLAST of runt-1 vs. Ensembl Medaka
Match: runx2 (RUNX family transcription factor 2 [Source:NCBI gene;Acc:100049495])

HSP 1 Score: 112.464 bits (280), Expect = 6.491e-27
Identity = 60/129 (46.51%), Postives = 73/129 (56.59%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNF 885
            ++V T  P   C+ LP HWR NK+LP  F+V+          I DG  V + A N    SA LRN    + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR   +  
Sbjct:   38 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------IPDGTVVTVMAGNDENYSAELRNASGVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKL 160          
BLAST of runt-1 vs. Ensembl Medaka
Match: runx2 (RUNX family transcription factor 2 [Source:NCBI gene;Acc:100049495])

HSP 1 Score: 112.464 bits (280), Expect = 9.484e-27
Identity = 61/128 (47.66%), Postives = 75/128 (58.59%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKN 882
            ++V T  P   C+ LP HWR NK+LP  F+V+          I DG  V + A N    SA LRN    + N  ARFNDLRF+ RSGRGK F + I +  NP  +A Y  AIKVTVDGPREPR +H+ 
Sbjct:   78 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------IPDGTVVTVMAGNDENYSAELRNASGVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPR-RHRQ 198          
BLAST of runt-1 vs. Ensembl Medaka
Match: ENSORLT00000023234.2 (runt-related transcription factor 2-like [Source:NCBI gene;Acc:101167336])

HSP 1 Score: 109.768 bits (273), Expect = 1.325e-26
Identity = 58/126 (46.03%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  502 IVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            +V T  P   C+ LPQHWR NK+LP  F V+   ++     + DG  V + A N    SA LRN  + +  G A FNDLRFI RSGRGK F + I++  +P  IA    AIKVTVDGPR PR + +
Sbjct:   52 LVETDSPNFLCSSLPQHWRCNKTLPGAFTVVALGND-----VPDGVVVIVMAGNDDNCSAELRNATATMKQGSAHFNDLRFIGRSGRGKSFSLSINVLTSPPQIATLHRAIKVTVDGPRLPRRQRQ 172          
BLAST of runt-1 vs. Ensembl Medaka
Match: runx3 (runt-related transcription factor 3 [Source:NCBI gene;Acc:101160370])

HSP 1 Score: 110.923 bits (276), Expect = 1.555e-26
Identity = 60/133 (45.11%), Postives = 77/133 (57.89%), Query Frame = 1
Query:  481 LSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHK 879
            L+    ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +   P  +A Y  AIKVTVDGPREPR +H+
Sbjct:   51 LADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTGPPQVATYHRAIKVTVDGPREPR-RHR 176          
BLAST of runt-1 vs. Ensembl Medaka
Match: runx3 (runt-related transcription factor 3 [Source:NCBI gene;Acc:101160370])

HSP 1 Score: 110.538 bits (275), Expect = 1.625e-26
Identity = 58/123 (47.15%), Postives = 72/123 (58.54%), Query Frame = 1
Query:  499 KIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR 867
            ++V T  P   C+ LP HWR NK+LP  F+V+          + DG  V + A N    SA LRN  + + N  ARFNDLRF+ RSGRGK F + I +   P  +A Y  AIKVTVDGPREPR
Sbjct:   71 ELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGD------VPDGTLVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTGPPQVATYHRAIKVTVDGPREPR 187          
BLAST of runt-1 vs. Planmine SMEST
Match: SMESG000014779.1 (SMESG000014779.1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 290/290 (100.00%), Postives = 290/290 (100.00%), Query Frame = 1
Query:  418 MNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNIKIPNFIPKSEPDSHFCYSGSPGLTDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSLLYPYGTPNGCHFSLPQTKQDNFSMLQFMLMATTLRIGLPLAEIYNSQSHQRSPVKEIKDFDKTKIWRPF 1287
            MNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNIKIPNFIPKSEPDSHFCYSGSPGLTDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSLLYPYGTPNGCHFSLPQTKQDNFSMLQFMLMATTLRIGLPLAEIYNSQSHQRSPVKEIKDFDKTKIWRPF
Sbjct:    1 MNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPRNKHKNFYFTKNNIKIPNFIPKSEPDSHFCYSGSPGLTDPPSYWSSTKTDTKNLSENDSFEQKSNLIISPSLLYPYGTPNGCHFSLPQTKQDNFSMLQFMLMATTLRIGLPLAEIYNSQSHQRSPVKEIKDFDKTKIWRPF 290          
BLAST of runt-1 vs. Planmine SMEST
Match: SMESG000049171.1 (SMESG000049171.1)

HSP 1 Score: 114.39 bits (285), Expect = 3.040e-29
Identity = 59/122 (48.36%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  502 IVPTSHPLVFCTKLPQHWRSNKSLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNGEARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR 867
            ++P  +P + CT+LP HWR NK+L   F+V        +LP+ DG +V LSA N     A LR   S++ N  A F DLRF+ +SGRGK F++ I +E  P  ++VY NAIKVTVDGPREPR
Sbjct:   24 VIP-GNPNLLCTQLPSHWRINKALVKTFKVF------SLLPVADGTQVILSAGNNENVCAELRGNHSQMKNQSAIFQDLRFLGKSGRGKRFNITITMESYPPQVSVYANAIKVTVDGPREPR 138          
The following BLAST results are available for this feature:
BLAST of runt-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RUNX25.241e-2847.24RUNX family transcription factor 2 [Source:HGNC Sy... [more]
RUNX11.125e-2744.96RUNX family transcription factor 1 [Source:HGNC Sy... [more]
RUNX11.278e-2744.96RUNX family transcription factor 1 [Source:HGNC Sy... [more]
RUNX12.094e-2746.46RUNX family transcription factor 1 [Source:HGNC Sy... [more]
RUNX24.281e-2744.12RUNX family transcription factor 2 [Source:HGNC Sy... [more]
back to top
BLAST of runt-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnt-15.658e-2142.02RNT-1; RuNT related; Transcription factor RUN [So... [more]
rnt-15.658e-2142.02RNT-1; RuNT related; Transcription factor RUN [So... [more]
back to top
BLAST of runt-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lz2.537e-3148.80gene:FBgn0002576 transcript:FBtr0112814[more]
lz3.654e-3148.80gene:FBgn0002576 transcript:FBtr0071320[more]
RunxA8.510e-3141.98gene:FBgn0083981 transcript:FBtr0308028[more]
RunxA1.722e-3043.14gene:FBgn0083981 transcript:FBtr0331159[more]
RunxA2.006e-3043.14gene:FBgn0083981 transcript:FBtr0331160[more]
back to top
BLAST of runt-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
runx2a3.341e-2847.24RUNX family transcription factor 2a [Source:ZFIN;A... [more]
runx32.489e-2734.63RUNX family transcription factor 3 [Source:ZFIN;Ac... [more]
runx32.489e-2734.63RUNX family transcription factor 3 [Source:ZFIN;Ac... [more]
runx33.092e-2734.63RUNX family transcription factor 3 [Source:ZFIN;Ac... [more]
runx33.092e-2734.63RUNX family transcription factor 3 [Source:ZFIN;Ac... [more]
back to top
BLAST of runt-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf43.075e-2746.46TATA-box binding protein associated factor 4 [Sour... [more]
taf44.727e-2744.12TATA-box binding protein associated factor 4 [Sour... [more]
taf44.866e-2744.12TATA-box binding protein associated factor 4 [Sour... [more]
znf385d6.961e-2745.67zinc finger protein 385D [Source:Xenbase;Acc:XB-GE... [more]
znf385d1.518e-2646.09zinc finger protein 385D [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of runt-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Runx25.316e-2947.24runt related transcription factor 2 [Source:MGI Sy... [more]
Runx24.381e-2847.24runt related transcription factor 2 [Source:MGI Sy... [more]
Runx11.127e-2746.46runt related transcription factor 1 [Source:MGI Sy... [more]
Runx35.041e-2746.88runt related transcription factor 3 [Source:MGI Sy... [more]
Runx35.276e-2746.88runt related transcription factor 3 [Source:MGI Sy... [more]
back to top
BLAST of runt-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W349|LOZEN_DROME3.663e-3048.80Protein lozenge OS=Drosophila melanogaster OX=7227... [more]
sp|P22814|RUNT_DROME2.505e-2645.38Segmentation protein Runt OS=Drosophila melanogast... [more]
sp|Q64131|RUNX3_MOUSE3.690e-2646.88Runt-related transcription factor 3 OS=Mus musculu... [more]
sp|Q13761|RUNX3_HUMAN4.377e-2646.88Runt-related transcription factor 3 OS=Homo sapien... [more]
sp|Q13950|RUNX2_HUMAN8.431e-2644.12Runt-related transcription factor 2 OS=Homo sapien... [more]
back to top
BLAST of runt-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G1C1Q30.000e+0100.00Runt-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A1L7H9V62.542e-12459.69Transcriptional regulatory protein Runt-1 OS=Duges... [more]
A0A0R3TQC12.242e-3751.41Runt domain-containing protein OS=Rodentolepis nan... [more]
A0A0R3S9069.397e-3351.88Runt domain-containing protein OS=Hymenolepis dimi... [more]
A0A183SL261.011e-3145.95Runt domain-containing protein OS=Schistocephalus ... [more]
back to top
BLAST of runt-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000000899.23.582e-2746.88pep primary_assembly:Astyanax_mexicanus-2.0:9:2513... [more]
runx13.742e-2746.27runt-related transcription factor 1 [Source:NCBI g... [more]
runx14.156e-2745.86runt-related transcription factor 1 [Source:NCBI g... [more]
runx14.730e-2745.86runt-related transcription factor 1 [Source:NCBI g... [more]
runx15.351e-2745.86runt-related transcription factor 1 [Source:NCBI g... [more]
back to top
BLAST of runt-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of runt-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of runt-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335385.056e-3047.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of runt-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
runx26.491e-2746.51RUNX family transcription factor 2 [Source:NCBI ge... [more]
runx29.484e-2747.66RUNX family transcription factor 2 [Source:NCBI ge... [more]
ENSORLT00000023234.21.325e-2646.03runt-related transcription factor 2-like [Source:N... [more]
runx31.555e-2645.11runt-related transcription factor 3 [Source:NCBI g... [more]
runx31.625e-2647.15runt-related transcription factor 3 [Source:NCBI g... [more]
back to top
BLAST of runt-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000014779.10.000e+0100.00SMESG000014779.1[more]
SMESG000049171.13.040e-2948.36SMESG000049171.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022580
GenBankAEF16013.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022580 ID=SMED30022580|Name=runt-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1307bp
CAGATTAATCACCCTGCCAATAGTGGGTGGCGGGCACTAACATTAACACA
TTACCTACCAGGACGCCTACTCAATTGATGTGCCAGTGCTACTCACTGTG
TGTGAGCACTGATGTAGAAAAAGCGACACACGTCATTGACTCGCCACGCC
TTTTACTGCGTGTCGTAAACGATTATATCATCGAAATTATCGGTGTGCTA
TTGCTTTTATCAATTGATCCGCATTGTCTTTACCACGGCGCAGATGATTT
TCCATTATTGAAAGTTTCACTCAAAAAAACAGCCGACCAATAAAAATCGA
GTCTGATGCAAATTCAACAGAAATTCAACCTGTGTTTTTTTAATTGGCTA
ATTTTCTTCACTGCGGGAGATAAAGTTTAGTGGAAAATCCAGCGATTAAT
TGTGTCGAACAGCAATCATGAATCAACGGTTCAACGGTTTCAGCACTGAT
TTCACCAAATCCAAGTACAAATTTAATAGTTTGTCGGTTTCAACGGAAAA
GATCGTTCCGACTTCCCATCCGTTGGTATTCTGCACGAAGCTACCTCAGC
ATTGGAGATCCAACAAATCTTTGCCGGCATTGTTTCAAGTGATGGTCTAT
CAAAGCAACAATCGAGTTCTTCCTATCGGAGACGGACATCGGGTTTGGTT
GTCGGCGAGTAATCCGTCGATGAATAGCGCGGTGTTGAGAAATTTCGAAT
CGAAACTCGTCAACGGTGAAGCAAGATTCAATGACTTGAGATTCATCAGT
CGCAGTGGAAGAGGAAAATATTTCGATGTTTATATCCACATTGAGTGCAA
CCCGAAAATCATCGCCGTTTACACAAACGCTATCAAGGTTACAGTCGACG
GTCCTAGAGAGCCCAGAAACAAACACAAAAACTTTTACTTCACAAAGAAC
AACATAAAAATTCCCAACTTCATTCCAAAATCGGAACCCGACTCGCATTT
CTGTTACAGCGGCTCTCCTGGGCTCACTGATCCTCCGAGCTATTGGAGTT
CAACAAAAACCGATACGAAAAATCTTTCAGAAAATGATTCATTTGAACAG
AAATCAAACTTGATAATCTCTCCGTCTCTTCTTTATCCATATGGGACACC
CAACGGTTGCCATTTCAGTTTACCTCAGACCAAGCAGGACAATTTTTCAA
TGCTACAATTCATGCTGATGGCAACGACACTTCGAATCGGGCTTCCTTTG
GCAGAGATCTACAACTCGCAATCCCATCAAAGGAGCCCCGTAAAAGAAAT
CAAAGATTTTGATAAGACCAAGATTTGGAGACCTTTTTAAATATATTTGA
GATGGTT
back to top

protein sequence of SMED30022580-orf-1

>SMED30022580-orf-1 ID=SMED30022580-orf-1|Name=SMED30022580-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MNQRFNGFSTDFTKSKYKFNSLSVSTEKIVPTSHPLVFCTKLPQHWRSNK
SLPALFQVMVYQSNNRVLPIGDGHRVWLSASNPSMNSAVLRNFESKLVNG
EARFNDLRFISRSGRGKYFDVYIHIECNPKIIAVYTNAIKVTVDGPREPR
NKHKNFYFTKNNIKIPNFIPKSEPDSHFCYSGSPGLTDPPSYWSSTKTDT
KNLSENDSFEQKSNLIISPSLLYPYGTPNGCHFSLPQTKQDNFSMLQFML
MATTLRIGLPLAEIYNSQSHQRSPVKEIKDFDKTKIWRPF*
back to top
Aliases
The feature 'runt-1' has the following synonyms
Synonym
runt-like-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000040AML1_Runt
IPR013524Runt_dom
IPR012346p53/RUNT-type_TF_DNA-bd_sf
IPR008967p53-like_TF_DNA-bd
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000040Acute myeloid leukemia 1 protein (AML1)/RuntPRINTSPR00967ONCOGENEAML1coord: 127..149
score: 67.59
coord: 35..56
score: 54.55
IPR000040Acute myeloid leukemia 1 protein (AML1)/RuntPANTHERPTHR11950RUNT RELATEDcoord: 26..155
IPR013524Runt domainPFAMPF00853Runtcoord: 25..152
e-value: 1.2E-39
score: 134.8
IPR013524Runt domainPROSITEPS51062RUNTcoord: 17..151
score: 35.841
IPR012346p53/RUNT-type transcription factor, DNA-binding domain superfamilyGENE3DG3DSA:2.60.40.720coord: 15..157
e-value: 9.1E-52
score: 176.0
NoneNo IPR availablePANTHERPTHR11950:SF31PROTEIN LOZENGE-RELATEDcoord: 26..155
IPR008967p53-like transcription factor, DNA-bindingSUPERFAMILYSSF49417p53-like transcription factorscoord: 27..150