SMED30022579

Overview
NameSMED30022579
Smed IDSMED30022579
Length (bp)2327
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022579 (SMED30022579) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022579 (SMED30022579) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022579 (SMED30022579) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022579 (SMED30022579) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022579

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30022579h1SMcG0000204 Contig4707newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30022579h1SMcG0000204 Contig4707newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30022579h1SMcG0006295 Contig4707newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30022579h1SMcG0006295 Contig4707newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30022579h1SMcG0006295 SmedASXL_010629SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022579h1SMcG0006295 SmedASXL_015715SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30022579h1SMcG0006295 dd_Smed_v4_14150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30022579h1SMcG0006295 dd_Smed_v4_14150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022579h1SMcG0006295 dd_Smed_v6_19912_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022579h1SMcG0006295 dd_Smed_v6_14150_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022579 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.019693:5701..9715 -8547
Homology
BLAST of SMED30022579 vs. TrEMBL
Match: A0A0R3TL61 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7954 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.228e-15
Identity = 88/362 (24.31%), Postives = 161/362 (44.48%), Query Frame = 1
Query:  247 RKKIQIPRIKLIE---PEITKDHKIQLRWYLNKEEETGFKSTLYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVPVLNNYCSLKSMDTETLKIIDFNFSPNIDK----------DFQVPIDFQKINITKSSHFPGNSYAQVSWLIPNVTFFNCYNISIFXXXXXXXXXX-XXXMILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYL----KSNKSEIVLKFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFRIPGHKFFHVKTSESIETPIGKNLKDGL 1278
            R+   +P +  +E   P++      ++ W L    +          F + Y+   +  CI  +     +D+T       +CSL+S D+  +++  +    NI              Q P  F  + I ++  F G+S+   S  I ++  F CY++ I   +V+    S  S + L  E  PS PP+ + V  +S  S+ I W +P    WNG++TG  VY+    +++K E+   + D+T   V+S + +   + ++++  NC G S KS P+    +SE   +N  S    N+  I+L  + W+I  L V ++++WL+L F  V  C  +            +T +    P+G    + L
Sbjct:  648 RQSTGVPGVIKLERMLPQVISSTSARVIWSLENPVDA---IPAVRGFSVRYKEAPLTACISARL----HDAT-------FCSLRSGDSIKMRLHTYQQKLNIASLKATQGVSLVPHQEPEMFVDVPINQAHDF-GSSW---STTITHLKPFRCYSLLIQPNTVYPRQSSNESALFLTQEDVPSSPPQIIGVKKMSNHSVEISWTVPPTDSWNGLLTGFVVYVLNAAQNDKRELKFSYGDTT--GVVSGLKTGEIYHLQMAAVNCRGSSSKSIPINF-SVSEGGIINESSPADGNNGGIHL--QPWVIGIL-VGALVIWLLLMFFGVLFCLRQ----------RTQTKQRYLPPVGGGFSEDL 975          
BLAST of SMED30022579 vs. TrEMBL
Match: A0A183AAP3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4028 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.314e-14
Identity = 74/342 (21.64%), Postives = 152/342 (44.44%), Query Frame = 1
Query:  238 RNKRKKIQIPRIKLIEPEITKDHKIQLRWYLNKEEETGFKSTLYTQFYLNYRSVSILKC---IVEKFNGNPYDSTVVPVLNNYCSLKSMDTETLKIIDFNFS--------PNIDKDFQVPIDFQKINITKSSHFP--GNSYAQVSWLIPNVTFFNCYNISIFXX------XXXXXXXXXXXMILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITG--SNVYLKSNKSEIVLKFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDS-LVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFR 1197
            R + K++QI  I+    ++  D ++ ++W +    ET         F +  + V +L+C   I+E+ + + +          YCSL   D+E L  + +            + D +  + I     N+ + +H    G  + Q +  + N+  F CY I I +              S  K +L  E  PS PP  V V+W+++   +I+W+ P    WNG++TG    +Y +  +   ++  + S  +  +  +    ++L++I+   C G    S+P+ L   +    +N+ + LV + ++ + L  + W + T+ + SI+ W ++  L  + C  K ++
Sbjct:  618 RERIKQLQIDHIQF---QVLTDSQLHIQWTVT---ETATLLNFINGFTVRAQEVGLLRCVGSILEQNSESIHHDRTFSSRQTYCSLHYRDSEGLAGMVYRLEGLQRLYTESSTDANHPIMISTDISNLPRPTHSNEIGAHFYQGT--LRNLRPFQCYEIRISAYIVHNSYGKLEGHSSAPKFVLTSERAPSAPPSAVSVAWVAKTRAHIRWNAPLVNSWNGLLTGYVVQIYGELTQEPQIINVSHSILSIDVDLLPRPEAYLVQIAAVTCSGVGVPSSPIRLVPTTYTTYVNASTDLVPKGNKTVELLAQPWFVGTM-IGSIVAWCIIIALVAFFCFRKRYK 950          
BLAST of SMED30022579 vs. TrEMBL
Match: A0A2H1CX77 (Immunoglobulin I-set domain protein OS=Fasciola hepatica OX=6192 GN=D915_000146 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 9.582e-13
Identity = 83/372 (22.31%), Postives = 157/372 (42.20%), Query Frame = 1
Query:  217 FKSGK*ARNKRKKIQIPRIKLIEPEITKDHKIQLRWYLNKEEETGFKSTLYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVPVLNNYCSLKSMDTETLKII--DFNFSPNIDKDFQVPIDFQKINITKSSHFP---------GNSYAQVSWLIPNVTFFNCYNISI--------FXXXXXXXXXXXXXMILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVLKFNDSTQNK--VISQVNSKLSWLIRISIKNCVGESGKSTPVVLH---------------------RISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSK---SFR 1197
            F S K      + ++I R+ L  P  +K  ++++ W +++        T YT +Y   R +++++C+          +    + ++YCSL+ +   T + +  +      + +     +   ++ +   ++FP         G+   + S LI ++  F CY +S+        F K+     V+++ M    E+ PS PPE V   W     + + W  P    WNG++ G  +YL    +     FN S   K  VI  +    ++LI+++   C G   +S P+ L                       ++E  Q+ S S   E+     L +K W I+T+ ++S+L+W  L  L +  CC +   SFR
Sbjct:  740 FVSDKELLQGMRNVEISRVHL-HPISSK--RMRVSWTVHERPHVIQAITGYTIYY---RKINLMQCVPSSLQTVDERAVSTELGDSYCSLRPVSDRTPRDLYQELQSMQRMRQQLATALTEPRLQMDVKANFPLDTSDTEPKGSVTYEGSGLIRDLDPFQCYEVSVKPHSTDSLFGKTEGRESVTHTAMTF--ESFPSLPPERVVAKWTGIHDLTLSWSQPPVSHWNGLLRGYTIYLYDELARDHQTFNVSASEKTTVIKGLTGSNAYLIQLAACTCKGVGLRSKPLRLDPGFHGQLGRGVGWGFDPNTGLPVTESAQIESTS---EDGTSGRLIQKPWFISTM-ISSLLLWFALIGL-ITFCCRRQPYSFR 1098          
BLAST of SMED30022579 vs. TrEMBL
Match: A0A0R3SPT7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7009 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.819e-12
Identity = 77/285 (27.02%), Postives = 133/285 (46.67%), Query Frame = 1
Query:  370 TQFYLNYRSVSILKCIVEKFNGNPYDSTVVPVLNNYCSLKSMDT--ETLKIIDFNFSPNIDKD--------FQVPIDFQKINITKSSHFPGNSYAQVSWLIPNVTFFNCYNISIFXXXXXXXXXX-XXXMILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYL----KSNKSEIVLKFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLC 1179
            T F + Y+ V + KCI        +DST       +CSL+S D+    L I     +    +D         Q P  F  + I ++  F G+S+   S  I ++  F CY++ +   +V+    +  S + L  E  PS PP+ + V  +S  S+ I W +P    WNG++TG  VY+    + +K E+   + D+T   V+S + +   + ++++  NC G S KS P+        +  +S      N+  I L  + W+I  +VV  +++WL++ F  V  C
Sbjct:  687 TGFSVRYKEVPLTKCISAYL----HDST-------FCSLRSGDSIKTRLNIYQQKLNTASLRDTQGVSLVPHQEPEMFADVPIDQAHDF-GSSW---STTITHLKPFRCYSLLVQPNTVYPRRSNNESSLFLTQEDAPSAPPQIIGVKKMSNHSVEISWTVPPTDSWNGLLTGFVVYVFNAAQDDKRELKFSYGDTT--GVVSGLKTGEIYHLQMTAVNCRGSSSKSIPINFSVSEGGIISDSSPSTDANNGYIQL--QPWIIG-IVVGVLVIWLLVMFFGVIFC 951          
BLAST of SMED30022579 vs. TrEMBL
Match: A0A504YZE7 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_01703 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.903e-12
Identity = 80/361 (22.16%), Postives = 153/361 (42.38%), Query Frame = 1
Query:  250 KKIQIPRIKLIEPEITKDHKIQLRWYLNKEEETGFKSTLYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVPVLNNYCSLKSMDTETLKII--DFNFSPNIDKDFQVPIDFQKINITKSSHFP---------GNSYAQVSWLIPNVTFFNCYNISI--------FXXXXXXXXXXXXXMILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVLKFNDSTQNK--VISQVNSKLSWLIRISIKNCVGESGKSTPVVLH---------------------RISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSK---SFR 1197
            + ++I R+ L  P  +K  ++++ W +++        T YT +Y   R +++++C+          +    + ++YCSL+     T + +  +      + +     +   ++ +   ++FP         G+   + S LI ++  F CY +S+        F K+     V+++ M    E+ PS PPE V   W     + + W  P    WNG++ G  +YL    +     FN S   K  VI  +    ++LI+++   C G   +S P+ L                       ++E  Q+ S S   E+     L +K W I+T+ ++S+L+W  L  L +  CC +   SFR
Sbjct:  751 RNVEISRVHL-HPISSK--RMRVSWTVHERPHVIQAITGYTIYY---RKINLMQCVPTSLQKVDERAVSTELGDSYCSLRPASDRTPRDLYQELQSMQKMRQQSTTALTEPRLQMDVKANFPLDTSDTEPKGSVTYEGSGLIRDLDPFQCYEVSVKPHSTDSLFGKTEGRESVTHTAMTF--ESFPSLPPERVVAKWTGIHDLTLSWSQPPVSHWNGLLRGYTIYLYDELARDHQTFNVSASEKTTVIKGLTGSNAYLIQLAAGTCKGVGLRSKPLRLDPGFHGQLGRGVGWGFDPNTGLPVTESAQIESTS---EDGTSGRLIQKPWFISTM-ISSLLLWFALIGL-ITFCCRRQPYSFR 1098          
BLAST of SMED30022579 vs. Planmine SMEST
Match: SMESG000001429.1 (SMESG000001429.1)

HSP 1 Score: 1107.43 bits (2863), Expect = 0.000e+0
Identity = 609/616 (98.86%), Postives = 611/616 (99.19%), Query Frame = 1
Query:  259 QIPRIKLIEPEITKDHKIQLRWYLNKEEETGFKSTLYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVPVLNNYCSLKSMDTETLKIIDFNFSPNIDKDFQVPIDFQKINITKSSHFPGNSYAQVSWLIPNVTFFNCYNISIFXXXXXXXXXXXXXMILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVLKFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFRIPGHKFFHVKTSESIETPIGKNLKDGLISXXXXXXXXXXXXXXXXXEKMFNINHLGLSPASSNLFCNPYASTQIFEPLSDNRIGDPTNDYVHSNRTEQEKMNLYYLSSPIFDSAAMSDIGHNSVNFFVPNNQEYPDQKNIQNPTNSNNNHLIPFSLYRTPDETTNSQSNLHFENKSSPRKEQFVELSVLKNNGMISNLLISTAPXXXXXXXXXXXXXXXXXXXXXXXXXXLTNEHVPRMKKPNAQPKPNKRRHDPGDFFDQSTEMTHLLSQHPENRSPFASKDSNHVYDIPYSDTVSIIDKDN 2106
            Q  +IKLIEPEITKDHKIQLRWYLNKEEETGFKS LYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVP LNNYCSLKSMDTETLKIIDFNFSPNIDKDFQVPIDFQKINITKSSHFPGNSYAQVSWLIPNVTFFNCYNISIFSKSVHNSVVSNSKMILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVLKFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFRIPGHKFFHVKTSESIETPIGKNLKDGLISNPNNDKDNTFNDNDNDNEKMFNINHLGLSPASSNLFCNPYASTQIFEPLSDNRIGDPTNDYVHSNRTEQEKMNLYYLSSPIFDSAAMSDIGHNSVNFFVPNNQEYPDQKNIQNPTNSNNNHLIPFSLYRTPDETTNSQSNLHFENKSSPRKEQFVELSVLKNNGMISNLLISTAPFSDQFTTSSKSKSTNNSSNSDSSHHQLTNEHVPRMKKPNAQPKP+KRRHDPGDFFDQSTEMTHLLSQHPENRSPF SKDSNHVYDIPYSDTVSIIDKDN
Sbjct:  645 QFTKIKLIEPEITKDHKIQLRWYLNKEEETGFKSILYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVPALNNYCSLKSMDTETLKIIDFNFSPNIDKDFQVPIDFQKINITKSSHFPGNSYAQVSWLIPNVTFFNCYNISIFSKSVHNSVVSNSKMILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVLKFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFRIPGHKFFHVKTSESIETPIGKNLKDGLISNPNNDKDNTFNDNDNDNEKMFNINHLGLSPASSNLFCNPYASTQIFEPLSDNRIGDPTNDYVHSNRTEQEKMNLYYLSSPIFDSAAMSDIGHNSVNFFVPNNQEYPDQKNIQNPTNSNNNHLIPFSLYRTPDETTNSQSNLHFENKSSPRKEQFVELSVLKNNGMISNLLISTAPFSDQFTTSSKSKSTNNSSNSDSSHHQLTNEHVPRMKKPNAQPKPSKRRHDPGDFFDQSTEMTHLLSQHPENRSPFTSKDSNHVYDIPYSDTVSIIDKDN 1260          
BLAST of SMED30022579 vs. Planmine SMEST
Match: SMESG000066973.1 (SMESG000066973.1)

HSP 1 Score: 89.3521 bits (220), Expect = 7.068e-18
Identity = 103/419 (24.58%), Postives = 180/419 (42.96%), Query Frame = 1
Query:  307 KIQLRWYLNKEEETGFKSTLYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVPVLNNYCSLKSMDTETLK--II--DF-NFSPN-----------IDKDFQVPIDFQKINITKSSHFPGNSYAQVSWLIPNVTFFNCYNISI---FXXXXXXXXXXXXXMILVPETRPSQPPENVQVSW-LSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVL---KFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFRIPGHKFFHVKTSESIETPIGKNL-----KDGLISXXXXXXXXXXXXXXXXXEKMFNINHLGLSPASSNLFCNPYASTQIFEPLSDNR-IGDPTNDYVHS 1476
            K++L W + + +  G    +   F + Y  V + +C+ +   G+            YCS +    + ++  I+  DF N SP            +D  F++P D     I KS             ++  +  F+CY  ++   +      S  S S+  L+ E  PSQPP+N++  W  +  ++ I + LP    WNG ++G  V++ +N S  +L   KFND+ +   I  ++ + S+ + +S+ NC GE  +S      RI           V   ++     ++ W I  +VV +++ W++L  L VYLCC +   I     F  K  E    P+ K+L     K  + S   N+   + ++       + N NH+     +S   C PYAS  I + + ++  IG  T  Y  S
Sbjct:  624 KVKLEWQIVRGDSKG--GIIIEGFKIRYTMVPLSRCLDDGNQGHMKR-------KRYCSFQGRSLDDIRNWILQSDFWNVSPASNVQSNLTSGVVDFKFRLPED---ATIVKS-------------IVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRS-----QRI----------YVPARTEPPPYEQQAWFIPVIVVGTLIFWILLCCLVVYLCCIRFQLITKSPKFKSKDCEINLEPLMKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGT-CTPYASASIVDSIDNSSDIGTFTKFYTGS 1001          
BLAST of SMED30022579 vs. Planmine SMEST
Match: SMESG000066973.1 (SMESG000066973.1)

HSP 1 Score: 88.9669 bits (219), Expect = 7.698e-18
Identity = 103/419 (24.58%), Postives = 180/419 (42.96%), Query Frame = 1
Query:  307 KIQLRWYLNKEEETGFKSTLYTQFYLNYRSVSILKCIVEKFNGNPYDSTVVPVLNNYCSLKSMDTETLK--II--DF-NFSPN-----------IDKDFQVPIDFQKINITKSSHFPGNSYAQVSWLIPNVTFFNCYNISI---FXXXXXXXXXXXXXMILVPETRPSQPPENVQVSW-LSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVL---KFNDSTQNKVISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFRIPGHKFFHVKTSESIETPIGKNL-----KDGLISXXXXXXXXXXXXXXXXXEKMFNINHLGLSPASSNLFCNPYASTQIFEPLSDNR-IGDPTNDYVHS 1476
            K++L W + + +  G    +   F + Y  V + +C+ +   G+            YCS +    + ++  I+  DF N SP            +D  F++P D     I KS             ++  +  F+CY  ++   +      S  S S+  L+ E  PSQPP+N++  W  +  ++ I + LP    WNG ++G  V++ +N S  +L   KFND+ +   I  ++ + S+ + +S+ NC GE  +S      RI           V   ++     ++ W I  +VV +++ W++L  L VYLCC +   I     F  K  E    P+ K+L     K  + S   N+   + ++       + N NH+     +S   C PYAS  I + + ++  IG  T  Y  S
Sbjct:  652 KVKLEWQIVRGDSKG--GIIIEGFKIRYTMVPLSRCLDDGNQGHMKR-------KRYCSFQGRSLDDIRNWILQSDFWNVSPASNVQSNLTSGVVDFKFRLPED---ATIVKS-------------IVTGLNPFSCYEFTVEAYYENPSVTSRDSQSQNTLLFEEIPSQPPQNIRPFWSKNRNTLIIHYILPPNHTWNGFLSGIYVHIFANDSRSLLGSMKFNDTFKKIEIPNLDDRKSYSLHLSVFNCRGEGVRS-----QRI----------YVPARTEPPPYEQQAWFIPVIVVGTLIFWILLCCLVVYLCCIRFQLITKSPKFKSKDCEINLEPLMKDLPNRINKSCVKSQEANNYYKSGSEALYSATSIINPNHMNTGSVTSGT-CTPYASASIVDSIDNSSDIGTFTKFYTGS 1029          
BLAST of SMED30022579 vs. Planmine SMEST
Match: SMESG000018027.1 (SMESG000018027.1)

HSP 1 Score: 53.1434 bits (126), Expect = 8.071e-7
Identity = 37/165 (22.42%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  727 ILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVLKFNDSTQNKV--ISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQK------INLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFR 1197
            IL  ++ P++ P ++   WLS  S+ I W     +  NGI+ G ++++  N +        S ++ V  +  +   + +++ I+   C GE  +S  ++L   S  + ++ + L     Q        ++ K+ W I+ +VV   L W M+    + +C S   R
Sbjct:   86 ILTYDSVPTKSPTDLTARWLSNTSVEISWKPAPMRHINGILKGYSLHIIGNDTNSTRSIEVSPKSTVVRVQDLLINMPYIVHIAASTCQGEGIRSAGLMLTASSSLITMSPNYLERRLGQNFAKPIIASVTKQPWFISIMVVGGCL-WFMICAFILVVCRSMYLR 249          
BLAST of SMED30022579 vs. Planmine SMEST
Match: SMESG000018027.1 (SMESG000018027.1)

HSP 1 Score: 53.1434 bits (126), Expect = 8.306e-7
Identity = 37/165 (22.42%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  727 ILVPETRPSQPPENVQVSWLSEESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVLKFNDSTQNKV--ISQVNSKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQK------INLFKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFR 1197
            IL  ++ P++ P ++   WLS  S+ I W     +  NGI+ G ++++  N +        S ++ V  +  +   + +++ I+   C GE  +S  ++L   S  + ++ + L     Q        ++ K+ W I+ +VV   L W M+    + +C S   R
Sbjct:   86 ILTYDSVPTKSPTDLTARWLSNTSVEISWKPAPMRHINGILKGYSLHIIGNDTNSTRSIEVSPKSTVVRVQDLLINMPYIVHIAASTCQGEGIRSAGLMLTASSSLITMSPNYLERRLGQNFAKPIIASVTKQPWFISIMVVGGCL-WFMICAFILVVCRSMYLR 249          
The following BLAST results are available for this feature:
BLAST of SMED30022579 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TL619.228e-1524.31Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A183AAP34.314e-1421.64Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A2H1CX779.582e-1322.31Immunoglobulin I-set domain protein OS=Fasciola he... [more]
A0A0R3SPT71.819e-1227.02Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A504YZE72.903e-1222.16Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
back to top
BLAST of SMED30022579 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022579 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001429.10.000e+098.86SMESG000001429.1[more]
SMESG000066973.17.068e-1824.58SMESG000066973.1[more]
SMESG000066973.17.698e-1824.58SMESG000066973.1[more]
SMESG000018027.18.071e-722.42SMESG000018027.1[more]
SMESG000018027.18.306e-722.42SMESG000018027.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022579 ID=SMED30022579|Name=SMED30022579|organism=Schmidtea mediterranea sexual|type=transcript|length=2327bp
TGGAATTTGGATAAAGGAGGTTGTGATAAAAAAGATTTTCATTTAAAGCT
AAGATATAATCTGAAAATTTCTGATGCAAATTCACAACTTTTTGCAAAAT
TAATGAAGAACGGTGACATGTATTACTAAAGAAATGAATGCATTATTTAC
AAGATATTTATTCTTTTGGCCAAACGTAGAAACTATTAAAGAATGTTTGG
AAAACTGTCAAGAATCTTCAAAAGCGGAAAATAAGCCAGGAACAAACGAA
AAAAAATCCAAATACCTCGAATCAAATTAATTGAACCAGAAATCACAAAA
GATCACAAAATCCAATTAAGATGGTATCTGAATAAAGAAGAAGAGACTGG
ATTCAAGTCGACCTTATACACTCAATTCTATTTGAACTACAGGTCGGTGT
CGATTCTCAAGTGTATTGTCGAGAAATTCAACGGAAATCCTTACGATTCC
ACAGTGGTTCCTGTACTCAATAATTATTGCAGCCTCAAATCCATGGACAC
CGAAACCTTGAAAATCATAGATTTTAATTTTTCACCGAACATTGACAAAG
ATTTTCAAGTGCCGATTGATTTTCAGAAGATCAACATCACGAAGTCTTCT
CATTTCCCCGGCAACAGTTATGCTCAAGTTTCCTGGTTAATTCCAAATGT
CACATTTTTCAATTGCTACAACATTTCCATTTTTTCCAAAAGCGTCCATA
ACTCAGTGGTCAGCAACTCCAAAATGATATTGGTGCCTGAAACAAGACCT
AGTCAACCACCGGAAAATGTCCAAGTGTCATGGTTGTCAGAGGAATCGAT
GAATATCAAATGGGACCTCCCAGATCGGCAATTCTGGAACGGAATTATTA
CTGGATCGAATGTCTACTTGAAGTCCAACAAATCGGAAATCGTGTTGAAA
TTCAATGATTCCACGCAGAACAAAGTCATATCGCAGGTGAATTCAAAACT
GAGCTGGCTAATACGGATCTCGATAAAGAATTGCGTCGGTGAAAGCGGAA
AGAGTACTCCAGTTGTGTTGCACCGGATATCAGAAGATCTACAATTAAAT
TCTGACAGTTTAGTCATTGAAAATAGCCAAAAAATTAATCTGTTTAAAAA
GACATGGATGATTGCAACGCTTGTTGTAACATCGATTTTGGTTTGGTTGA
TGTTGTCCTTTCTCACCGTTTATCTTTGTTGCAGTAAGTCTTTTCGAATT
CCCGGTCACAAGTTTTTCCATGTTAAAACGAGCGAATCAATTGAAACTCC
GATTGGTAAGAATTTAAAGGATGGCTTAATTTCAAATCCTAACAATGATA
AAGACAACACTTTCAATGACAATGATAATGACAACGAAAAAATGTTTAAT
ATCAACCATTTAGGTCTTTCTCCAGCATCTTCCAACTTATTTTGTAACCC
ATATGCATCAACACAGATCTTTGAACCTTTGTCAGACAATCGAATAGGTG
ATCCGACGAATGATTACGTTCATTCGAATCGAACTGAACAGGAAAAAATG
AATTTATATTATTTATCTTCTCCTATATTTGATTCGGCAGCGATGAGTGA
TATCGGTCACAATTCAGTAAATTTTTTTGTTCCTAACAATCAAGAATATC
CGGACCAGAAAAACATTCAGAATCCAACAAATAGCAATAATAACCATTTG
ATTCCATTTTCATTATATCGGACACCGGATGAAACCACCAATAGCCAATC
TAATTTGCATTTTGAAAATAAATCGTCTCCACGCAAAGAGCAATTTGTGG
AGTTGTCCGTTCTAAAAAATAATGGAATGATTAGTAATCTTCTAATAAGC
ACCGCTCCATTCTCTGATCAGTTCACAACTTCCTCTAAATCAAAAAGTAC
AAACAATAGTTCGAATTCTGATTCCAGTCATCACCAGCTGACAAATGAAC
ACGTTCCAAGAATGAAAAAGCCGAATGCCCAACCGAAACCCAACAAACGA
CGCCATGATCCTGGCGACTTTTTTGATCAGTCCACAGAAATGACTCACCT
CTTATCTCAACATCCAGAAAACAGATCCCCTTTTGCCAGCAAAGACTCAA
ATCACGTATATGATATTCCGTATTCCGACACTGTGTCCATAATTGATAAA
GACAACTGACAATGTTCTGTAAATGCTAAAAGCGGATTTAATTTTGTAAA
TATTTATTTGTTAATTTTTTTCCTTAAATCTAGGTTATTTGTGATACTGG
GAATCTCATTATTTGGAAAGCTTAGATTATTTATTAGAGATCGTTCTATC
TTTGTTAACAAGGAAGATTATTAATGTTTTTTTAATCGGAGAAAATCGTT
TTTGACATGATAATAGTGTAAAATATT
back to top

protein sequence of SMED30022579-orf-1

>SMED30022579-orf-1 ID=SMED30022579-orf-1|Name=SMED30022579-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=539bp
MDTETLKIIDFNFSPNIDKDFQVPIDFQKINITKSSHFPGNSYAQVSWLI
PNVTFFNCYNISIFSKSVHNSVVSNSKMILVPETRPSQPPENVQVSWLSE
ESMNIKWDLPDRQFWNGIITGSNVYLKSNKSEIVLKFNDSTQNKVISQVN
SKLSWLIRISIKNCVGESGKSTPVVLHRISEDLQLNSDSLVIENSQKINL
FKKTWMIATLVVTSILVWLMLSFLTVYLCCSKSFRIPGHKFFHVKTSESI
ETPIGKNLKDGLISNPNNDKDNTFNDNDNDNEKMFNINHLGLSPASSNLF
CNPYASTQIFEPLSDNRIGDPTNDYVHSNRTEQEKMNLYYLSSPIFDSAA
MSDIGHNSVNFFVPNNQEYPDQKNIQNPTNSNNNHLIPFSLYRTPDETTN
SQSNLHFENKSSPRKEQFVELSVLKNNGMISNLLISTAPFSDQFTTSSKS
KSTNNSSNSDSSHHQLTNEHVPRMKKPNAQPKPNKRRHDPGDFFDQSTEM
THLLSQHPENRSPFASKDSNHVYDIPYSDTVSIIDKDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR013783Ig-like_fold
IPR003961FN3_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007411axon guidance
GO:0035385Roundabout signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030424axon
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 73..182
e-value: 1.4E-11
score: 46.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 446..465
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 446..518
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 498..518
NoneNo IPR availableTMHMMTMhelixcoord: 205..227
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 89..182
score: 14.107
IPR003961Fibronectin type IIICDDcd00063FN3coord: 89..175
e-value: 0.00251934
score: 35.5499
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 81..175