GB1/RHD3-type G domain-containing protein

Overview
NameGB1/RHD3-type G domain-containing protein
Smed IDSMED30022577
Length (bp)1786
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GB1/RHD3-type G domain-containing protein (SMED30022577) t-SNE clustered cells

Violin plots show distribution of expression levels for GB1/RHD3-type G domain-containing protein (SMED30022577) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Human
Match: ATL2 (atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:24047])

HSP 1 Score: 261.536 bits (667), Expect = 7.632e-79
Identity = 145/514 (28.21%), Postives = 267/514 (51.95%), Query Frame = 1
Query:  127 IQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPF-LTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPV 1659
            +Q+V   L+H +   F  + ++LE++L    I   ++ V+S+ G  RKGKSFLL+ +LRY ++K + +W+   ++PL GF+W  G    T GI +WNE F + + +  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW++P E  YGL GG Q+++  ++                V ++      N+     +++  N FS+L CFLLPHPGLKV+ N +FDGR++DI+  F   ++ L+  +L+P+NL  K+I+G  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   +  Y  SM+++   ++ Y+    L+ +H+ L ++   +  + +     +      + L+  +      +   N+ KN+  +  TP +L  V+   Y++  L   I +  ++++  ++   AL     W    +  E   I  + DQ+ + L   V KP+
Sbjct:   61 VQIV---LAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEE-IYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQ----------------VKQNQHEELQNV-----RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPL 549          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Human
Match: ATL2 (atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:24047])

HSP 1 Score: 260.766 bits (665), Expect = 8.936e-79
Identity = 146/524 (27.86%), Postives = 270/524 (51.53%), Query Frame = 1
Query:   97 NDTIKTSGHSIQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPF-LTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPV 1659
            +D +      +Q+V   L+H +   F  + ++LE++L    I   ++ V+S+ G  RKGKSFLL+ +LRY ++K + +W+   ++PL GF+W  G    T GI +WNE F + + +  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW++P E  YGL GG Q+++  ++                V ++      N+     +++  N FS+L CFLLPHPGLKV+ N +FDGR++DI+  F   ++ L+  +L+P+NL  K+I+G  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   +  Y  SM+++   ++ Y+    L+ +H+ L ++   +  + +     +      + L+  +      +   N+ KN+  +  TP +L  V+   Y++  L   I +  ++++  ++   AL     W    +  E   I  + DQ+ + L   V KP+
Sbjct:   33 SDEVMKKPCPVQIV---LAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEE-IYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQ----------------VKQNQHEELQNV-----RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPL 531          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Human
Match: ATL2 (atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:24047])

HSP 1 Score: 260.766 bits (665), Expect = 1.624e-78
Identity = 145/523 (27.72%), Postives = 270/523 (51.63%), Query Frame = 1
Query:  127 IQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPF-LTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPV 1686
            +Q+V   L+H +   F  + ++LE++L    I   ++ V+S+ G  RKGKSFLL+ +LRY ++K + +W+   ++PL GF+W  G    T GI +WNE F + + +  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW++P E  YGL GG Q+++  ++                V ++      N+     +++  N FS+L CFLLPHPGLKV+ N +FDGR++DI+  F   ++ L+  +L+P+NL  K+I+G  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   +  Y  SM+++   ++ Y+    L+ +H+ L ++   +  + +     +      + L+  +      +   N+ KN+  +  TP +L  V+   Y++  L   I +  ++++  ++   AL     W    +  E   I  + DQ+ + L   VF  +  + + + V
Sbjct:   61 VQIV---LAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEE-IYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQ----------------VKQNQHEELQNV-----RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVFSKLFEVTRRRMV 558          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Human
Match: ATL1 (atlastin GTPase 1 [Source:HGNC Symbol;Acc:HGNC:11231])

HSP 1 Score: 253.832 bits (647), Expect = 3.589e-76
Identity = 146/521 (28.02%), Postives = 273/521 (52.40%), Query Frame = 1
Query:   97 NDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFL-TKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
             + +K +G  +Q++  K  H    F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +++ + +W+ + ++PL GFSW  G    T GI +W+E FL  K D ++  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EF YG  GG ++++  +K                VS +      N+     +++  + F+++ CFLLPHPGLKV+ N NFDG++++I+  F++++K LI  +LSP++L +K+ING+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K  Y   M++I   ++ ++    L  +H++L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y++  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   26 EEPVKKAG-PVQVLIVKDDHS---FELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLK----------------VSGNQHEELQNV-----RKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 514          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Human
Match: ATL1 (atlastin GTPase 1 [Source:HGNC Symbol;Acc:HGNC:11231])

HSP 1 Score: 253.447 bits (646), Expect = 4.445e-76
Identity = 146/520 (28.08%), Postives = 273/520 (52.50%), Query Frame = 1
Query:  100 DTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFL-TKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            + +K +G  +Q++  K  H    F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +++ + +W+ + ++PL GFSW  G    T GI +W+E FL  K D ++  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EF YG  GG ++++  +K                VS +      N+     +++  + F+++ CFLLPHPGLKV+ N NFDG++++I+  F++++K LI  +LSP++L +K+ING+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K  Y   M++I   ++ ++    L  +H++L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y++  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   27 EPVKKAG-PVQVLIVKDDHS---FELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLK----------------VSGNQHEELQNV-----RKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 514          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Celegans
Match: atln-1 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:U4PLG5])

HSP 1 Score: 254.603 bits (649), Expect = 4.376e-77
Identity = 144/479 (30.06%), Postives = 242/479 (50.52%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRY--FFSKC----------NSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIF---YGALSI 1557
            F  N + LE++L DP ++ K ++VI + G  RKGKSFLLN  LRY  + SK           NS W+S  + PL GFSW  G   +T GI++W+EPF+ K  + EE  +L++D QG F+  S++ +C  + A S ++SS  + N+ +   E      +LF  Y  L +    + KPFQ+++ ++RDW+FP E  +G  GG + +   ++                      S   + +    +Q+ ++ F  ++CFL+PHPGLKV+ N NFDG++ DI   F + +  +I  +L    L  K+ING  +TC+E  +YFK+ +HI   ++ P+ ++++   A  N L  + + + +Y   M+++   +  Y+   +L   H ++  I   E   AR              L+  L      Y   NN KNL  S+ TP  L+ ++ I Y+      +I + F++ +   +     GAL +
Sbjct:   46 FELNTELLEKILLDPKVADKKVAVIGVAGAYRKGKSFLLNFFLRYLTWRSKADKVMGEVELDNSQWMSP-NSPLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFALSTMISSVQIYNLSQNIQEDDLQHLQLFTEYGRLALEDSAS-KPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEV---------------------SEKQHAELQQLRQHIRSCFEDIRCFLMPHPGLKVATNPNFDGKLVDIENEFQQQLGVMIPRLLDSHALVHKEINGQKMTCRELLEYFKAYMHIFRGQDLPEPKSMLMATAEANNLAAVASARAVYQREMEEVCGGDTPYMSTNELLEHHDRVKNIAIREFRNARKMGGVDFSMQFLERLESDLQESYENYLKVNNGKNLFKSMRTPTVLVTLMIIDYIFQEFFQLIGLDFIAGLCSSVLCLVIGALGV 501          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Celegans
Match: atln-1 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:U4PLG5])

HSP 1 Score: 254.603 bits (649), Expect = 9.418e-77
Identity = 144/479 (30.06%), Postives = 242/479 (50.52%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRY--FFSKC----------NSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIF---YGALSI 1557
            F  N + LE++L DP ++ K ++VI + G  RKGKSFLLN  LRY  + SK           NS W+S  + PL GFSW  G   +T GI++W+EPF+ K  + EE  +L++D QG F+  S++ +C  + A S ++SS  + N+ +   E      +LF  Y  L +    + KPFQ+++ ++RDW+FP E  +G  GG + +   ++                      S   + +    +Q+ ++ F  ++CFL+PHPGLKV+ N NFDG++ DI   F + +  +I  +L    L  K+ING  +TC+E  +YFK+ +HI   ++ P+ ++++   A  N L  + + + +Y   M+++   +  Y+   +L   H ++  I   E   AR              L+  L      Y   NN KNL  S+ TP  L+ ++ I Y+      +I + F++ +   +     GAL +
Sbjct:   46 FELNTELLEKILLDPKVADKKVAVIGVAGAYRKGKSFLLNFFLRYLTWRSKADKVMGEVELDNSQWMSP-NSPLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFALSTMISSVQIYNLSQNIQEDDLQHLQLFTEYGRLALEDSAS-KPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEV---------------------SEKQHAELQQLRQHIRSCFEDIRCFLMPHPGLKVATNPNFDGKLVDIENEFQQQLGVMIPRLLDSHALVHKEINGQKMTCRELLEYFKAYMHIFRGQDLPEPKSMLMATAEANNLAAVASARAVYQREMEEVCGGDTPYMSTNELLEHHDRVKNIAIREFRNARKMGGVDFSMQFLERLESDLQESYENYLKVNNGKNLFKSMRTPTVLVTLMIIDYIFQEFFQLIGLDFIAGLCSSVLCLVIGALGV 501          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Celegans
Match: atln-2 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:A0A061AKV6])

HSP 1 Score: 192.586 bits (488), Expect = 1.007e-54
Identity = 114/379 (30.08%), Postives = 188/379 (49.60%), Query Frame = 1
Query:  166 QFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSN-------WLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTV-KPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIK 1275
            +F  N  +L  +L   + + K + +IS+ G  RKGKSFLLN  L Y +S   S        WL++ D  L GF W  G+  +TVGI +W EP + + +  E   ++++D QG F+  S+  +C  + A S ++SS  + N+ +   E       LF+ Y  + +       KPFQ ++  +RD+    E+ +G +GG  ++   ++T       + P +I  V                ++  +  F  +QC+LLPHPG KV+   +F G ++D+ PLF E +K ++ ++L P  L+ K +NG  +TC++  QYFK      + E  PQ Q+I+  NA    +E     K  Y   MD+         + + L+A HIK
Sbjct:   42 KFRLNESALNSVLGHSACANKKIVIISVAGAFRKGKSFLLNFFLEYLYSLHKSQQSDSSLEWLTD-DCQLHGFHWRAGVKRDTVGIWLWGEPIMIESVTGEMFAVVLMDTQGTFDNNSTYQQCMTVFALSTIVSSVQIYNVVDNIQEDALQHLSLFVEYGRIAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNP-----EQPEEIKQV----------------RELLREYFEDIQCYLLPHPGYKVAERQSFRGHVKDLRPLFREELKKMVPNLLGPHILKPKIVNGKTVTCRKMIQYFKEYAASFDGETLPQPQSILNANAKLICIEAAHEAKVNYSRGMDRSTYGTRMMSEKKLLEA-HIK 397          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Celegans
Match: atln-2 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:A0A061AKV6])

HSP 1 Score: 193.741 bits (491), Expect = 1.694e-54
Identity = 114/379 (30.08%), Postives = 188/379 (49.60%), Query Frame = 1
Query:  166 QFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSN-------WLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTV-KPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIK 1275
            +F  N  +L  +L   + + K + +IS+ G  RKGKSFLLN  L Y +S   S        WL++ D  L GF W  G+  +TVGI +W EP + + +  E   ++++D QG F+  S+  +C  + A S ++SS  + N+ +   E       LF+ Y  + +       KPFQ ++  +RD+    E+ +G +GG  ++   ++T       + P +I  V                ++  +  F  +QC+LLPHPG KV+   +F G ++D+ PLF E +K ++ ++L P  L+ K +NG  +TC++  QYFK      + E  PQ Q+I+  NA    +E     K  Y   MD+        + ++KL   HIK
Sbjct:   42 KFRLNESALNSVLGHSACANKKIVIISVAGAFRKGKSFLLNFFLEYLYSLHKSQQSDSSLEWLTD-DCQLHGFHWRAGVKRDTVGIWLWGEPIMIESVTGEMFAVVLMDTQGTFDNNSTYQQCMTVFALSTIVSSVQIYNVVDNIQEDALQHLSLFVEYGRIAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNP-----EQPEEIKQV----------------RELLREYFEDIQCYLLPHPGYKVAERQSFRGHVKDLRPLFREELKKMVPNLLGPHILKPKIVNGKTVTCRKMIQYFKEYAASFDGETLPQPQSILNANAKLICIEAAHEAKVNYSRGMDRSTYGTR-MMSEKKLLEAHIK 397          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Celegans
Match: atln-2 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:A0A061AKV6])

HSP 1 Score: 133.265 bits (334), Expect = 2.006e-34
Identity = 77/276 (27.90%), Postives = 134/276 (48.55%), Query Frame = 1
Query:  451 VLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTV-KPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIK 1275
             ++++D QG F+  S+  +C  + A S ++SS  + N+ +   E       LF+ Y  + +       KPFQ ++  +RD+    E+ +G +GG  ++   ++T       + P +I  V                ++  +  F  +QC+LLPHPG KV+   +F G ++D+ PLF E +K ++ ++L P  L+ K +NG  +TC++  QYFK      + E  PQ Q+I+  NA    +E     K  Y   MD+         + + L+A HIK
Sbjct:   11 AVVLMDTQGTFDNNSTYQQCMTVFALSTIVSSVQIYNVVDNIQEDALQHLSLFVEYGRIAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNP-----EQPEEIKQV----------------RELLREYFEDIQCYLLPHPGYKVAERQSFRGHVKDLRPLFREELKKMVPNLLGPHILKPKIVNGKTVTCRKMIQYFKEYAASFDGETLPQPQSILNANAKLICIEAAHEAKVNYSRGMDRSTYGTRMMSEKKLLEA-HIK 264          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Fly
Match: atl (gene:FBgn0039213 transcript:FBtr0084656)

HSP 1 Score: 251.906 bits (642), Expect = 5.887e-76
Identity = 141/492 (28.66%), Postives = 242/492 (49.19%), Query Frame = 1
Query:  115 SGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKC----NSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLIL-DVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSS--PKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
             G ++Q+++    H    FV N  +L E+L    +  + + V+S+ G  RKGKSFLL+  LRY +SK      ++WL     PL+GFSW  G   +T GI+MW++ FL    + +++ +IL D QG F+  S++ +C  + A S ++SS  + N+ +   E      +LF  Y  L +      KPFQ +  ++RDW+FP E  YG  GGD+ +K  ++      P++  +   IS                       + F+ + CFL+PHPGL V+ N  FDGR++DI P F   +++L+  +L+PDNL  K+I+G  +  ++  QYF+S ++I +    P+ ++++   A  N L  +   K LY   M+++      Y+    L  EH+++      + A  R     +  E     L+  L  +   Y++ N +KN+  +  TP        I Y+L  +  ++ +   +    ++   AL    LW
Sbjct:    2 GGSAVQVINASEEH---TFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALAD-TGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHIS-----------------------SCFTEVACFLMPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKNIFKAARTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVALLTLALW 466          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Fly
Match: atl (gene:FBgn0039213 transcript:FBtr0084657)

HSP 1 Score: 251.906 bits (642), Expect = 5.887e-76
Identity = 141/492 (28.66%), Postives = 242/492 (49.19%), Query Frame = 1
Query:  115 SGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKC----NSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLIL-DVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSS--PKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
             G ++Q+++    H    FV N  +L E+L    +  + + V+S+ G  RKGKSFLL+  LRY +SK      ++WL     PL+GFSW  G   +T GI+MW++ FL    + +++ +IL D QG F+  S++ +C  + A S ++SS  + N+ +   E      +LF  Y  L +      KPFQ +  ++RDW+FP E  YG  GGD+ +K  ++      P++  +   IS                       + F+ + CFL+PHPGL V+ N  FDGR++DI P F   +++L+  +L+PDNL  K+I+G  +  ++  QYF+S ++I +    P+ ++++   A  N L  +   K LY   M+++      Y+    L  EH+++      + A  R     +  E     L+  L  +   Y++ N +KN+  +  TP        I Y+L  +  ++ +   +    ++   AL    LW
Sbjct:    2 GGSAVQVINASEEH---TFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALAD-TGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHIS-----------------------SCFTEVACFLMPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKNIFKAARTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVALLTLALW 466          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Fly
Match: atl (gene:FBgn0039213 transcript:FBtr0345218)

HSP 1 Score: 251.906 bits (642), Expect = 5.887e-76
Identity = 141/492 (28.66%), Postives = 242/492 (49.19%), Query Frame = 1
Query:  115 SGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKC----NSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLIL-DVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSS--PKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
             G ++Q+++    H    FV N  +L E+L    +  + + V+S+ G  RKGKSFLL+  LRY +SK      ++WL     PL+GFSW  G   +T GI+MW++ FL    + +++ +IL D QG F+  S++ +C  + A S ++SS  + N+ +   E      +LF  Y  L +      KPFQ +  ++RDW+FP E  YG  GGD+ +K  ++      P++  +   IS                       + F+ + CFL+PHPGL V+ N  FDGR++DI P F   +++L+  +L+PDNL  K+I+G  +  ++  QYF+S ++I +    P+ ++++   A  N L  +   K LY   M+++      Y+    L  EH+++      + A  R     +  E     L+  L  +   Y++ N +KN+  +  TP        I Y+L  +  ++ +   +    ++   AL    LW
Sbjct:    2 GGSAVQVINASEEH---TFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALAD-TGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHIS-----------------------SCFTEVACFLMPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKNIFKAARTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVALLTLALW 466          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Zebrafish
Match: atl1 (atlastin GTPase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8003])

HSP 1 Score: 265.003 bits (676), Expect = 1.143e-80
Identity = 148/500 (29.60%), Postives = 260/500 (52.00%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNI---LDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            F  +  +L ++L    +  + +  IS+ G  RKGKSFL++ +LRY +S+ +  WL + ++PL GFSW  G    T GI +W+E FL  K D  +  +L++D QG F+  S+L +   + A S ++SS  + NI +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG ++++  +K                +S++      N+     +++  + F+++ CFL+PHPGLKV+ N +FDGR+R+I+  F+ +++ L+  +L P NL +K+ING  +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY   M+ +   +  ++   +L A H   L+I +  LA  R   K    E +      L+  +  + ++Y   N++KN+  +  TP +L +V+ + Y+   +   + +  ++ V  ++   AL      I  C W       E   + A+ DQ+   L
Sbjct:   47 FELDEAALSKILLSEEVRDREVVAISVAGAFRKGKSFLMDFMLRYMYSQASEKWLGDAEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGSKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFPYGQEGGMKFLEKRLK----------------ISENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLREIDQEFINNLQVLVPCLLRPKNLDVKEINGSKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGAKDLYNRKMEVVSGGDRPFLAPSELQARH---LEIREEALALFRSVKKMGGEEFSRRYLLQLETEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVAAGITGFVGVDVIASVCNMVLGFAL------ITLCTWAYIRYSGEYRELGAVIDQVAGAL 515          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Zebrafish
Match: atl1 (atlastin GTPase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8003])

HSP 1 Score: 264.618 bits (675), Expect = 1.909e-80
Identity = 148/500 (29.60%), Postives = 260/500 (52.00%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNI---LDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            F  +  +L ++L    +  + +  IS+ G  RKGKSFL++ +LRY +S+ +  WL + ++PL GFSW  G    T GI +W+E FL  K D  +  +L++D QG F+  S+L +   + A S ++SS  + NI +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG ++++  +K                +S++      N+     +++  + F+++ CFL+PHPGLKV+ N +FDGR+R+I+  F+ +++ L+  +L P NL +K+ING  +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY   M+ +   +  ++   +L A H   L+I +  LA  R   K    E +      L+  +  + ++Y   N++KN+  +  TP +L +V+ + Y+   +   + +  ++ V  ++   AL      I  C W       E   + A+ DQ+   L
Sbjct:   47 FELDEAALSKILLSEEVRDREVVAISVAGAFRKGKSFLMDFMLRYMYSQASEKWLGDAEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGSKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFPYGQEGGMKFLEKRLK----------------ISENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLREIDQEFINNLQVLVPCLLRPKNLDVKEINGSKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGAKDLYNRKMEVVSGGDRPFLAPSELQARH---LEIREEALALFRSVKKMGGEEFSRRYLLQLETEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVAAGITGFVGVDVIASVCNMVLGFAL------ITLCTWAYIRYSGEYRELGAVIDQVAGAL 515          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Zebrafish
Match: atl3 (atlastin 3 [Source:ZFIN;Acc:ZDB-GENE-041010-109])

HSP 1 Score: 254.218 bits (648), Expect = 6.688e-77
Identity = 143/490 (29.18%), Postives = 251/490 (51.22%), Query Frame = 1
Query:  106 IKTSGHSIQLVS-DKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
            +++    +Q+V+ +K  H    F  + ++L  +L  P +  KH+ V+S+ G  RKGKSFLL+ LLRY + K   +WL   + PL GFSW  G    T GI +W+E F+  K D  E  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +  +  +KPFQ+++ ++RDW+FP E+ YG  GG  ++   ++                       +S + +    +++  + F+S+ CFLLPHPGLKV+ +  F G++ D+ P F E ++ LI ++L  D+L +K+ING+ +TC+   +YFK+ I I + E  P  ++++   A  N L  + + K  Y  +M+K+   +  YV    L+ +H   L+      ++ +              L+K L  +       N +KN+  +  TP  L +++ + Y+L  ++  I ++ VS   + I   A+   L W
Sbjct:    1 MRSEPGPVQIVTVNKEKHS---FDLDTEALSRILLVPEVRDKHVVVVSVAGAFRKGKSFLLDFLLRYMYRKPGQDWLGQDNDPLTGFSWRGGSEPETTGIQLWSEVFVVRKKDGSEVAVLLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEF-FLKPFQSLMFLVRDWSFPYEYKYGFKGGSSFLDKRLQV---------------------KQSQHEELQTVREHIHSCFTSISCFLLPHPGLKVATSPAFTGQLCDVAPEFKEGLRELIPNLLKTDDLAVKEINGNKVTCRGLLEYFKAYIKIYQGEGLPHPKSMLEATAEANNLAAVASAKDQYYKNMEKVCGGDLPYVAPNSLEEKHRFFLQEALHLFSSTKKMGGQHFCHRYQEQLEKELKEMWENLSKHNESKNVFSAFRTPAVLFVLVCLLYVLSGILFFIGLETVSFACDCIVGLAMIAILTW 465          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Zebrafish
Match: atl3 (atlastin 3 [Source:ZFIN;Acc:ZDB-GENE-041010-109])

HSP 1 Score: 254.218 bits (648), Expect = 6.688e-77
Identity = 143/490 (29.18%), Postives = 251/490 (51.22%), Query Frame = 1
Query:  106 IKTSGHSIQLVS-DKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
            +++    +Q+V+ +K  H    F  + ++L  +L  P +  KH+ V+S+ G  RKGKSFLL+ LLRY + K   +WL   + PL GFSW  G    T GI +W+E F+  K D  E  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +  +  +KPFQ+++ ++RDW+FP E+ YG  GG  ++   ++                       +S + +    +++  + F+S+ CFLLPHPGLKV+ +  F G++ D+ P F E ++ LI ++L  D+L +K+ING+ +TC+   +YFK+ I I + E  P  ++++   A  N L  + + K  Y  +M+K+   +  YV    L+ +H   L+      ++ +              L+K L  +       N +KN+  +  TP  L +++ + Y+L  ++  I ++ VS   + I   A+   L W
Sbjct:    1 MRSEPGPVQIVTVNKEKHS---FDLDTEALSRILLVPEVRDKHVVVVSVAGAFRKGKSFLLDFLLRYMYRKPGQDWLGQDNDPLTGFSWRGGSEPETTGIQLWSEVFVVRKKDGSEVAVLLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEF-FLKPFQSLMFLVRDWSFPYEYKYGFKGGSSFLDKRLQV---------------------KQSQHEELQTVREHIHSCFTSISCFLLPHPGLKVATSPAFTGQLCDVAPEFKEGLRELIPNLLKTDDLAVKEINGNKVTCRGLLEYFKAYIKIYQGEGLPHPKSMLEATAEANNLAAVASAKDQYYKNMEKVCGGDLPYVAPNSLEEKHRFFLQEALHLFSSTKKMGGQHFCHRYQEQLEKELKEMWENLSKHNESKNVFSAFRTPAVLFVLVCLLYVLSGILFFIGLETVSFACDCIVGLAMIAILTW 465          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Zebrafish
Match: atl3 (atlastin 3 [Source:ZFIN;Acc:ZDB-GENE-041010-109])

HSP 1 Score: 253.832 bits (647), Expect = 8.700e-77
Identity = 139/468 (29.70%), Postives = 240/468 (51.28%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
            F  + ++L  +L  P +  KH+ V+S+ G  RKGKSFLL+ LLRY + K   +WL   + PL GFSW  G    T GI +W+E F+  K D  E  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +  +  +KPFQ+++ ++RDW+FP E+ YG  GG  ++   ++                       +S + +    +++  + F+S+ CFLLPHPGLKV+ +  F G++ D+ P F E ++ LI ++L  D+L +K+ING+ +TC+   +YFK+ I I + E  P  ++++   A  N L  + + K  Y  +M+K+   +  YV    L+ +H   L+      ++ +              L+K L  +       N +KN+  +  TP  L +++ + Y+L  ++  I ++ VS   + I   A+   L W
Sbjct:   20 FDLDTEALSRILLVPEVRDKHVVVVSVAGAFRKGKSFLLDFLLRYMYRKPGQDWLGQDNDPLTGFSWRGGSEPETTGIQLWSEVFVVRKKDGSEVAVLLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEF-FLKPFQSLMFLVRDWSFPYEYKYGFKGGSSFLDKRLQV---------------------KQSQHEELQTVREHIHSCFTSISCFLLPHPGLKVATSPAFTGQLCDVAPEFKEGLRELIPNLLKTDDLAVKEINGNKVTCRGLLEYFKAYIKIYQGEGLPHPKSMLEATAEANNLAAVASAKDQYYKNMEKVCGGDLPYVAPNSLEEKHRFFLQEALHLFSSTKKMGGQHFCHRYQEQLEKELKEMWENLSKHNESKNVFSAFRTPAVLFVLVCLLYVLSGILFFIGLETVSFACDCIVGLAMIAILTW 465          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 255.373 bits (651), Expect = 7.171e-77
Identity = 145/521 (27.83%), Postives = 266/521 (51.06%), Query Frame = 1
Query:   97 NDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            N  +    H +Q++  K  H    F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +     +WL + ++PL GFSW  G    T GI +W+E FL +  D  +  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG+++++  +K                VS++      N+     +++  + F+++ CFL+PHPGL V+ N NFDG++++I+  F++++K  I  +LSP+NL +K+I+G+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY  +M+++   +  ++    L   H  L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y+L  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   43 NRVVAKKAHPVQVLVVKDDHS---FELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLK----------------VSENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIFITYVLAAVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 532          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 253.062 bits (645), Expect = 2.867e-76
Identity = 144/514 (28.02%), Postives = 264/514 (51.36%), Query Frame = 1
Query:  118 GHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
             H +Q++  K  H    F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +     +WL + ++PL GFSW  G    T GI +W+E FL +  D  +  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG+++++  +K                VS++      N+     +++  + F+++ CFL+PHPGL V+ N NFDG++++I+  F++++K  I  +LSP+NL +K+I+G+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY  +M+++   +  ++    L   H  L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y+L  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   32 AHPVQVLVVKDDHS---FELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLK----------------VSENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIFITYVLAAVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 514          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 253.447 bits (646), Expect = 2.992e-76
Identity = 144/514 (28.02%), Postives = 264/514 (51.36%), Query Frame = 1
Query:  118 GHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
             H +Q++  K  H    F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +     +WL + ++PL GFSW  G    T GI +W+E FL +  D  +  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG+++++  +K                VS++      N+     +++  + F+++ CFL+PHPGL V+ N NFDG++++I+  F++++K  I  +LSP+NL +K+I+G+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY  +M+++   +  ++    L   H  L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y+L  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   34 AHPVQVLVVKDDH---SFELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLK----------------VSENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIFITYVLAAVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 516          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 253.062 bits (645), Expect = 4.215e-76
Identity = 144/517 (27.85%), Postives = 265/517 (51.26%), Query Frame = 1
Query:  109 KTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            +   H +Q++  K  H    F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +     +WL + ++PL GFSW  G    T GI +W+E FL +  D  +  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG+++++  +K                VS++      N+     +++  + F+++ CFL+PHPGL V+ N NFDG++++I+  F++++K  I  +LSP+NL +K+I+G+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY  +M+++   +  ++    L   H  L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y+L  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   27 EKKAHPVQVLVVKDDHS---FELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLK----------------VSENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIFITYVLAAVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 512          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 253.062 bits (645), Expect = 4.781e-76
Identity = 144/514 (28.02%), Postives = 264/514 (51.36%), Query Frame = 1
Query:  118 GHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTK-IDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
             H +Q++  K  H    F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +     +WL + ++PL GFSW  G    T GI +W+E FL +  D  +  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG+++++  +K                VS++      N+     +++  + F+++ CFL+PHPGL V+ N NFDG++++I+  F++++K  I  +LSP+NL +K+I+G+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY  +M+++   +  ++    L   H  L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y+L  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   31 AHPVQVLVVKDDHS---FELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLK----------------VSENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIFITYVLAAVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 513          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Mouse
Match: Atl2 (atlastin GTPase 2 [Source:MGI Symbol;Acc:MGI:1929492])

HSP 1 Score: 265.774 bits (678), Expect = 1.402e-80
Identity = 146/514 (28.40%), Postives = 269/514 (52.33%), Query Frame = 1
Query:  127 IQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPF-LTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPV 1659
            +Q+V   L+H +   F  + ++LE++L    I   ++ V+S+ G  RKGKSFLL+ +LRY ++K + +W+   ++PL GF+W  G    T GI +WNE F + + +  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW++P E  YGL GG Q+++  ++                V ++      N+     +++  N FS+L CFLLPHPGLKV+ N +FDGR++DI+  F   ++ L+  +L+P+NL  K+I+G  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   + +Y  SM+++   ++ Y+    L+ +H+ L ++   +  + +     +      + L+  +      +   N+ KN+  +  TP +L  V+   Y++  L   I +  ++++  ++   AL+    W    +  E   I  M DQ+ + L   V KP+
Sbjct:   61 VQIV---LAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAM-EEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQ----------------VKQNQHEELQNV-----RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAETLWEQVLKPL 549          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Mouse
Match: Atl1 (atlastin GTPase 1 [Source:MGI Symbol;Acc:MGI:1921241])

HSP 1 Score: 255.373 bits (651), Expect = 5.949e-77
Identity = 140/497 (28.17%), Postives = 263/497 (52.92%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFL-TKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +++ + +W+ + ++PL GFSW  G    T GI +W+E FL  K+D ++  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EF YG  GG ++++  +K                VS +      N+     +++  + F+++ CFLLPHPGLKV+ N NFDG++++I+  F++++K LI  +LSP+ L +K+ING+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K  Y   M+++   ++ ++    L ++H++L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y++  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   46 FELDEAALNRILLSQAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLK----------------VSGNQHEELQNV-----RKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPERLDIKEINGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEVCGGDKPFLAPNDLQSKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 514          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Mouse
Match: Atl3 (atlastin GTPase 3 [Source:MGI Symbol;Acc:MGI:1924270])

HSP 1 Score: 225.713 bits (574), Expect = 7.133e-66
Identity = 146/522 (27.97%), Postives = 255/522 (48.85%), Query Frame = 1
Query:   76 AITSQTLNDTIKTSGHS-IQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSK---CNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLIL-DVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQL 1623
            A+ S+   D ++      +Q+V   L H E+  F    ++L  +L    I    + V+S+ G  RKGKSF+L+ +LRY +S+    +S+WL + ++PL GFSW  G +  T GI +W+E F  K    ++V ++L D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW+FP E+ YGL GG  ++   +                +V +       N+ N     +  + FS + CFLLPHPGL+V+ + NFDG+++DI   F E ++ LI  +L+P  L  K+ING  +TC+   +YFK+ I I + E+ P  ++++   A  N L    + K +Y  +M++I   E+ Y+  + L+ +H++  ++        +              L++ +  +   +   N +KN+  +  TP  L   +   Y+       I ++ V+ +   +      + LL IA   W     S  + +L
Sbjct:    9 AVASRGAGDAMENGKPGPVQVV---LVHKEQHSFELEERALASVLLQDHIRDLDVVVVSVAGAFRKGKSFILDFMLRYLYSQKEGGHSDWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVKKPCGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQ-KPFQTLMFLIRDWSFPYEYNYGLQGGMAFLDKRL----------------HVKEHQHEEIQNVRN-----HIHSCFSDVTCFLLPHPGLQVATSPNFDGKLKDIASEFKEQLQALIPYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEANNLAAAASAKDIYYNNMEEICGGEKPYLSPDILEEKHLEFKQLALDHFKKIKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPAVLFTGIAALYIASGFTGFIGLEVVAQLFNCM------VGLLLIALLTWGYIRYSGQYREL 499          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Mouse
Match: Atl3 (atlastin GTPase 3 [Source:MGI Symbol;Acc:MGI:1924270])

HSP 1 Score: 223.787 bits (569), Expect = 3.316e-65
Identity = 146/525 (27.81%), Postives = 255/525 (48.57%), Query Frame = 1
Query:   64 SFMEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSK---CNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLIL-DVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQL 1623
            +F  A+T   + +        +Q+V   L H E+  F    ++L  +L    I    + V+S+ G  RKGKSF+L+ +LRY +S+    +S+WL + ++PL GFSW  G +  T GI +W+E F  K    ++V ++L D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW+FP E+ YGL GG  ++   +                +V +       N+ N     +  + FS + CFLLPHPGL+V+ + NFDG+++DI   F E ++ LI  +L+P  L  K+ING  +TC+   +YFK+ I I + E+ P  ++++   A  N L    + K +Y  +M++I   E+ Y+  + L+ +H++  ++        +              L++ +  +   +   N +KN+  +  TP  L   +   Y+       I ++ V+ +   +      + LL IA   W     S  + +L
Sbjct:    4 TFQYAVTGDAMENGKPGP---VQVV---LVHKEQHSFELEERALASVLLQDHIRDLDVVVVSVAGAFRKGKSFILDFMLRYLYSQKEGGHSDWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVKKPCGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQ-KPFQTLMFLIRDWSFPYEYNYGLQGGMAFLDKRL----------------HVKEHQHEEIQNVRN-----HIHSCFSDVTCFLLPHPGLQVATSPNFDGKLKDIASEFKEQLQALIPYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEANNLAAAASAKDIYYNNMEEICGGEKPYLSPDILEEKHLEFKQLALDHFKKIKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPAVLFTGIAALYIASGFTGFIGLEVVAQLFNCM------VGLLLIALLTWGYIRYSGQYREL 494          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Mouse
Match: Atl2 (atlastin GTPase 2 [Source:MGI Symbol;Acc:MGI:1929492])

HSP 1 Score: 194.126 bits (492), Expect = 2.320e-55
Identity = 107/400 (26.75%), Postives = 200/400 (50.00%), Query Frame = 1
Query:  463 LDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPV 1659
            +D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW++P E  YGL GG Q+++  ++                V ++      N+     +++  N FS+L CFLLPHPGLKV+ N +FDGR++DI+  F   ++ L+  +L+P+NL  K+I+G  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   + +Y  SM+++   ++ Y+    L+ +H+ L ++   +  + +     +      + L+  +      +   N+ KN+  +  TP +L  V+   Y++  L   I +  ++++  ++   AL+    W    +  E   I  M DQ+ + L   V KP+
Sbjct:    1 MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAM-EEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQ----------------VKQNQHEELQNV-----RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAETLWEQVLKPL 378          
BLAST of GB1/RHD3-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95LN3|ATLA2_MACFA (Atlastin-2 OS=Macaca fascicularis OX=9541 GN=ATL2 PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 5.306e-80
Identity = 148/524 (28.24%), Postives = 271/524 (51.72%), Query Frame = 1
Query:   97 NDTIKTSGHSIQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPF-LTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPV 1659
            +D +      +Q+V   L+H +   F  + ++LE++L    I   ++ V+S+ G  RKGKSFLL+ +LRY ++K + +W+   ++PL GF+W  G    T GI +WNE F + + +  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW++P E  YGL GG Q+++  ++                V K+      N+     +++  N FS+L CFLLPHPGLKV+ N +FDGR++DI+  F   ++ L+  +L+P+NL  K+I+G  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   +  Y  SM+++   ++ Y+    L+ +H+ L ++   +  + +     +      + L+  +      +   N+ KN+  +  TP +L  V+   Y++  L   I +  ++++  ++   AL+    W    +  E   I  M DQ+ + L   V KP+
Sbjct:   33 SDEVMKKPCPVQIV---LAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEE-IYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQ----------------VKKNQHEELQNV-----RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALTFLCTWAYVKYSGEFREIGTMIDQIAETLWEQVLKPL 531          
BLAST of GB1/RHD3-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PA06|ATLA2_MOUSE (Atlastin-2 OS=Mus musculus OX=10090 GN=Atl2 PE=1 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 9.808e-80
Identity = 146/514 (28.40%), Postives = 269/514 (52.33%), Query Frame = 1
Query:  127 IQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPF-LTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPV 1659
            +Q+V   L+H +   F  + ++LE++L    I   ++ V+S+ G  RKGKSFLL+ +LRY ++K + +W+   ++PL GF+W  G    T GI +WNE F + + +  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW++P E  YGL GG Q+++  ++                V ++      N+     +++  N FS+L CFLLPHPGLKV+ N +FDGR++DI+  F   ++ L+  +L+P+NL  K+I+G  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   + +Y  SM+++   ++ Y+    L+ +H+ L ++   +  + +     +      + L+  +      +   N+ KN+  +  TP +L  V+   Y++  L   I +  ++++  ++   AL+    W    +  E   I  M DQ+ + L   V KP+
Sbjct:   61 VQIV---LAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAM-EEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQ----------------VKQNQHEELQNV-----RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAETLWEQVLKPL 549          
BLAST of GB1/RHD3-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NHH9|ATLA2_HUMAN (Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2 PE=1 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 3.665e-78
Identity = 145/514 (28.21%), Postives = 267/514 (51.95%), Query Frame = 1
Query:  127 IQLVSDKLSHGEKQ-FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPF-LTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPV 1659
            +Q+V   L+H +   F  + ++LE++L    I   ++ V+S+ G  RKGKSFLL+ +LRY ++K + +W+   ++PL GF+W  G    T GI +WNE F + + +  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW++P E  YGL GG Q+++  ++                V ++      N+     +++  N FS+L CFLLPHPGLKV+ N +FDGR++DI+  F   ++ L+  +L+P+NL  K+I+G  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   +  Y  SM+++   ++ Y+    L+ +H+ L ++   +  + +     +      + L+  +      +   N+ KN+  +  TP +L  V+   Y++  L   I +  ++++  ++   AL     W    +  E   I  + DQ+ + L   V KP+
Sbjct:   61 VQIV---LAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEE-IYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQ----------------VKQNQHEELQNV-----RKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPL 549          
BLAST of GB1/RHD3-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PST4|ATLA1_RAT (Atlastin-1 OS=Rattus norvegicus OX=10116 GN=Atl1 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 3.269e-76
Identity = 141/497 (28.37%), Postives = 263/497 (52.92%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFL-TKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +++ + +W+ + ++PL GFSW  G    T GI +W+E FL  K+D ++  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EF YG  GG ++++  +K                VS +      N+     +++  + F+++ CFLLPHPGLKV+ N NFDG++++I+  F++++K LI  +LSP++L +K+ING+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K  Y   M++I   ++ ++    L  +H++L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y++  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   46 FELDEAALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLK----------------VSGNQHEELQNV-----RKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEDSVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 514          
BLAST of GB1/RHD3-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BH66|ATLA1_MOUSE (Atlastin-1 OS=Mus musculus OX=10090 GN=Atl1 PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 4.161e-76
Identity = 140/497 (28.17%), Postives = 263/497 (52.92%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFL-TKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            F  +  +L  +L   ++  K +  +S+ G  RKGKSFL++ +LRY +++ + +W+ + ++PL GFSW  G    T GI +W+E FL  K+D ++  +L++D QG F+  S+L +   + A S ++SS  + N+ +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EF YG  GG ++++  +K                VS +      N+     +++  + F+++ CFLLPHPGLKV+ N NFDG++++I+  F++++K LI  +LSP+ L +K+ING+ +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K  Y   M+++   ++ ++    L ++H++L +         +     +        L+  +  + ++Y   N++KN+  +  TP +L +V+ I+Y++  +   I +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   46 FELDEAALNRILLSQAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLK----------------VSGNQHEELQNV-----RKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPERLDIKEINGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEVCGGDKPFLAPNDLQSKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI------MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAAL 514          
BLAST of GB1/RHD3-type G domain-containing protein vs. TrEMBL
Match: A0A4Z2DC72 (Atlastin-1 isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_002322 PE=4 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 8.999e-91
Identity = 172/523 (32.89%), Postives = 281/523 (53.73%), Query Frame = 1
Query:  118 GHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDS-EERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPVIGIMKNK 1680
            GH+IQ+++ +    +  F  N +SL  +L  P +  K + V+S+ G  R+GKSFLL+  LRY  S   +NWL + ++PL GF W  G   +T+GI++W+EPF   + S EE V+L++D QG F+  S++ +C  + A S ++SS  + NI     E       LF  Y  L + S  +  PFQ+++ ++RDW+FP E+ +G +GG+Q +   +K                V + +T   A       + + ++ FS L CFL+PHPGLKVS N NFDGR++DI+P F+E++  L+  +L+P NL +KKING  +TC+E F YFK+ I I E++  P+ ++++   A  N L  I   + +Y  +M KI   +  Y++   LDA H+K  K    +  T                L +TL  +   Y+  N+ K++  +  TP  L +VL I +++  L   + +  VS +  + FY AL     W+   +      +++  DQ  +++I  VF P I I+ N+
Sbjct:    3 GHAIQIINVEECMKKTSFSLNEESLSSILLRPDVRDKKVVVVSVAGAFRQGKSFLLDFFLRYLLSSDRTNWLGDPEKPLKGFPWRGGSERDTIGILLWSEPFFMILPSGEEVVVLLMDTQGSFDSTSTVRQCATVFALSTMVSSTQVYNIHGNIQEDHLQHLHLFTEYGRLALESDISGTPFQHLLFLVRDWSFPYEYDFGNNGGNQLLDNRLKI---------------VQQHHTEHQA------VRSHIRSCFSKLDCFLMPHPGLKVSTNPNFDGRVKDIDPNFIENLIALVPHLLAPVNLVVKKINGQEVTCRELFTYFKAYIKIYESDTLPEPRSMLEATAEANNLNAILTCQEMYSEAMSKICGPDRPYINPTDLDAAHLKTYKAAVEKFNTIPKMGGEAFSADYLERLKETLKQLGEDYRMSNSKKDIFKTFRTPAVLAVVLLIFHIITGLSEFVGLSMVSGILALPFYIALISLFTWLFLSYTGRAPELASAIDQSAEIVINKVFNPAIQIVGNR 504          
BLAST of GB1/RHD3-type G domain-containing protein vs. TrEMBL
Match: G4VPP5 (Putative atlastin OS=Schistosoma mansoni OX=6183 GN=Smp_146800 PE=4 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.360e-90
Identity = 169/527 (32.07%), Postives = 282/527 (53.51%), Query Frame = 1
Query:  106 IKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDS-EERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPVIGIMKNK 1680
            +   GH++Q+++ +    +  F  + +SL  +L  P +  K + V+S+ G  R+GKSFLL+  LRY  S   +NWL + + PL GF W  G   +TVGI++W+EPF   + S EE V+L++D QG F+  S++ +C  + A S ++SS  + NI     E       LF  Y  L + S  +  PFQ+++ ++RDW+FP E+ +G +GG+Q +   +K                V + +T   A       +++ ++ FS L CFL+PHPGLKVS N  FDGR++DI+P F+E++  L+  +L+P NL +K ING  +TC+E F YFK+ I I E++  P+ ++++   A  N L  I   + +Y  +M+KI   +  Y++   LD+ H+K+ K    +  T                L +TL  +   Y+  N+ K++  +  TP  L +VL I +++  +   I +  VS +  + FY AL     W+   +      +++  DQ  +L+I  VF P I I+ N+
Sbjct:    2 VAADGHAVQIINVEECMKKTSFTLDEESLSSILLRPDVRDKKVVVVSVAGAFRQGKSFLLDFFLRYLLSSDRTNWLGDPETPLKGFPWRGGSERDTVGILLWSEPFFMTLPSGEEVVVLLMDTQGSFDSTSTVRQCATVFALSTMVSSTQVYNIHGNIQEDHLQHLHLFTEYGRLALESDISGTPFQHLLFLVRDWSFPYEYDFGNNGGNQLLDNRLKI---------------VQQHHTEHQA------VRRHIRSCFSKLDCFLMPHPGLKVSTNPKFDGRVKDIDPSFVENLIALVPHLLAPVNLVVKNINGQEVTCRELFTYFKAYIKIYESDTLPEPRSMLEATAEANNLNAILTCQEMYSEAMNKICGPDRPYINPTDLDSAHLKIYKAAVQKFNTIPKMGGEAFSAGYLERLKETLKQLGEDYRMSNSKKDIFQTFRTPAVLAVVLLIFHIVTGISEFIGLSMVSGILALPFYIALVSLFTWLFLSYTGRAPELASAIDQSAELVIKKVFNPAIKIVGNR 507          
BLAST of GB1/RHD3-type G domain-containing protein vs. TrEMBL
Match: A0A4S2LV29 (GB1/RHD3-type G domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004645 PE=4 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 4.742e-89
Identity = 160/529 (30.25%), Postives = 275/529 (51.98%), Query Frame = 1
Query:  115 SGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERV-LLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKIL 1695
            SGH++Q+V     +G   F  +  +L  +L  PS+  K + +IS+ G  R+GKSFLL+  LRY  SK + NW+ + D PL GF W  G   +T GI++W+EPF+ K+ S E V +L +D QG F+  S++ +C  + A S ++SS  + NI     E       LF  Y  L + S     PFQ+++ ++RDW+FP ++ +G  GG++ +   +K            Q ++ ++  T R          ++ ++ FS + CFLLPHPGLKV+ N  FDGR+ DI+P FL  ++  + ++LSP  LQLKKING  +TC+E   YFK+ + I + +  P+ ++++   A  N L  I   +  Y  +M+K+   ++ Y++   L+  H +  +    +  + R     +        L  TL  +  +Y++ N NKN+  +  TP    ++L I +++  +   + I  V+ +  + FY AL   + W+   +      ++   D   D+++  V  P I  +  + V+ L
Sbjct:    5 SGHAVQVVKVDEDNGTTTFTLDEPALSSILLHPSVRDKLVVIISVAGAFRQGKSFLLDFFLRYMSSKDHDNWIGSSDTPLQGFPWRGGAERDTTGILLWSEPFIIKLQSGEDVAVLFMDTQGSFDSTSTVRQCATVFALSTMLSSIQIYNIHGNIQEDHLQHLHLFTEYGRLAMESEVAETPFQHLLFLVRDWSFPYDYEFGSIGGNRLLDARLKI-----------QPNHHTEHETVR----------RHIRSCFSRVSCFLLPHPGLKVATNPKFDGRLSDIDPQFLNELRVFVPTVLSPATLQLKKINGEKITCRELLTYFKAYMEIYQGDTLPEPRSMLEATAEANNLNAIMACQDAYTEAMNKVCGPDKPYINPNDLEIAHSRAFQAAIQKFTSIRKMGGEQYAAIYLERLKTTLQQLGNEYRTANTNKNIFQTFRTPAVFAVILIIFHIITGISEFVGINAVTNMFLVPFYLALVTLMTWMFLSYTGRAPELAQAIDSAADVVVEKVVTPAIQHIGQRSVQQL 512          
BLAST of GB1/RHD3-type G domain-containing protein vs. TrEMBL
Match: A0A430QM53 (Atlastin OS=Schistosoma bovis OX=6184 GN=DC041_0002496 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 8.800e-89
Identity = 169/527 (32.07%), Postives = 280/527 (53.13%), Query Frame = 1
Query:  106 IKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDS-EERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPVIGIMKNK 1680
            +   G ++Q+++ +    +  F  + +SL  +L  P +  K + V+S+ G  R+GKSFLL+  LRY  S   +NWL + + PL GF W  G   +TVGI++W+EPF   + S EE V+L++D QG F+  S++ +C  + A S ++SS  + NI     E       LF  Y  L + S  +  PFQ+++ ++RDW+FP E+ +G  GG Q +   +K                V + +T   A       +++ ++ FS L CFL+PHPGLKVS N NFDGR++DI+P F+E++  L+  +L+P NL +K+ING  +TC+E F YFK+ I I E++  P+ ++++   A  N L  I   + +Y  +M+KI   +  Y++   LD  H+K+ K    +  T                L +TL  +   Y+  N+ K++  +  TP  L +VL I +++  +   I +  VS +  + FY AL     W+   +      +++  DQ  +L+I  VF P I I+ N+
Sbjct:    2 VAAGGRAVQIINVEECMKKTSFSLDEESLSSILLRPDVRDKKVVVVSVAGAFRQGKSFLLDFFLRYLLSNDRTNWLGDPEIPLKGFPWRGGSERDTVGILLWSEPFFMTLPSGEEVVVLLMDTQGSFDSTSTVRQCATVFALSTMISSTQVYNIHGNIQEDHLQHLHLFTEYGRLALESDISGTPFQHLLFLVRDWSFPYEYDFGNSGGTQLLDNRLKI---------------VQQHHTEHQA------VRRHIRSCFSKLDCFLMPHPGLKVSTNPNFDGRVKDIDPSFVENLIALVPHLLAPVNLVVKRINGQEVTCRELFTYFKAYIKIYESDTLPEPRSMLEATAEANNLNAILTCQEMYSEAMNKICGPDRPYINPTDLDLAHLKIYKAAIEKFNTIPKMGGEAFSAGYLERLKETLKQLGEDYRMSNSKKDIFQTFRTPAVLAVVLLIFHIVTGISEFIGLSMVSGILALPFYIALISLFTWLFLSYTGRAPELASAIDQSAELVIKKVFNPAIKIVGNR 507          
BLAST of GB1/RHD3-type G domain-containing protein vs. TrEMBL
Match: A0A419PLD9 (Atlastin-1 OS=Clonorchis sinensis OX=79923 GN=ATL1 PE=4 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 1.464e-88
Identity = 160/529 (30.25%), Postives = 275/529 (51.98%), Query Frame = 1
Query:  115 SGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERV-LLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKIL 1695
            SGH++Q+V     +G   F  +  +L  +L  PS+  K + +IS+ G  R+GKSFLL+  LRY  SK   NW+ + D PL+GF W  G   +T GI++W+EPF+ K+ S E V +L +D QG F+  S++ +C  + A S ++SS  + NI     E       LF  Y  L + S     PFQ+++ ++RDW+FP ++ +G  GG++ +   +K            Q ++ ++  T R          ++ ++ FS + CFLLPHPGLKV+ N  FDGR+ DI+P FL  ++  + ++LSP  LQLKKING  +TC+E   YFK+ + I + +  P+ ++++   A  N L  I   +  Y  +M+K+   ++ Y++   L+  H +  +    +  + R     +        L  TL  +  +Y++ N NKN+  +  TP    ++L I +++  +   + I  V+ +  + FY AL   + W+   +      ++   D   D+++  V  P I  +  + V+ L
Sbjct:    5 SGHAVQVVKVDEDNGTTTFSLDEPALSSILLHPSVRDKLVVIISVAGAFRQGKSFLLDFFLRYMSSKDRDNWIGSSDTPLEGFPWRGGAERDTTGILLWSEPFIIKLQSGEDVAVLFMDTQGSFDSTSTVRQCATVFALSTMLSSIQIYNIHGNIQEDHLQHLHLFTEYGRLAMESEVAETPFQHLLFLVRDWSFPYDYEFGSIGGNRLLDARLKI-----------QPNHHTEHETVR----------RHIRSCFSRVSCFLLPHPGLKVATNPKFDGRLSDIDPQFLNELRVFVPTVLSPATLQLKKINGEKITCRELLTYFKAYMEIYQGDTLPEPRSMLEATAEANNLNAIMACQDAYTEAMNKVCGPDKPYLNPNDLEIAHSRAFQAAIQKFTSIRKMGGEQYAAIYLERLKTTLQQLGNEYRTANTNKNIFQTFRTPAVFAVILLIFHIITGISEFVGINAVTNMFLVPFYLALVTLMTWMFLSYTGRAPELAQAIDSAADVVVQKVVTPAIQHIGQRSVQQL 512          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Cavefish
Match: atl3 (atlastin-3-like [Source:NCBI gene;Acc:103047852])

HSP 1 Score: 256.529 bits (654), Expect = 5.607e-78
Identity = 148/482 (30.71%), Postives = 254/482 (52.70%), Query Frame = 1
Query:  127 IQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERV-LLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
            +Q+V+  ++  E  F  + ++LE +L  P I   ++ V+S+ G  RKGKSFLL+ +LRY + K + +WL   D+PL GFSW  G    T GI +W+E F+ +  + ++V +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +     +KPFQ+++ +IRDW+FP E+ YGL GG Q++   ++                  KD+            +Q+  + F+S+ CFLLPHPGLKV+ N  F G++ D+ P F + ++ LI ++L PD L +K+ING+ +TC+   +YFKS I I + E+ P  ++++   A  N L  + + K  Y  +M+K+   E  YV  + L+ +H   L+       + +              L+  L  + + +   N +KN+  +  TP  L +++ + Y+L  L+  I +  VS V + +   A+   L W
Sbjct:    8 VQIVT--VNKEEHSFDLDTEALERILLVPKIRDMNVVVLSVAGAFRKGKSFLLDFMLRYMYRKSSDDWLGRDDEPLTGFSWRGGSEPETTGIQLWSEVFVVRKSNGKQVAVLLMDTQGAFDNQSTVKDCATIFALSTMTSSIQIYNLSQNIQEDDLQQLQLFTEYGRLAMDE-IFLKPFQSLMFLIRDWSFPYEYDYGLKGGSQFLDKRLQV-----------------KDSQHEELQT----VRQHIHSCFTSISCFLLPHPGLKVATNPAFQGQLCDVAPEFKKELRDLIPALLDPDKLAVKEINGNTVTCRGLLEYFKSYIKIYQGEDLPHPKSMLLATAEANNLAAVASSKDQYYKNMEKVCGGELPYVAPDSLEEKHNFYLRESLHHFTSIKKMGGQDFCNRYQAQLESELNELWVSFSKHNESKNVFSAFRTPAVLFVLVCLLYVLSGLLLFIGLDSVSFVCDCMLGLAMIAMLTW 465          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Cavefish
Match: atl3 (atlastin-3-like [Source:NCBI gene;Acc:103047852])

HSP 1 Score: 256.529 bits (654), Expect = 7.288e-78
Identity = 148/482 (30.71%), Postives = 254/482 (52.70%), Query Frame = 1
Query:  127 IQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERV-LLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
            +Q+V+  ++  E  F  + ++LE +L  P I   ++ V+S+ G  RKGKSFLL+ +LRY + K + +WL   D+PL GFSW  G    T GI +W+E F+ +  + ++V +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +     +KPFQ+++ +IRDW+FP E+ YGL GG Q++   ++                  KD+            +Q+  + F+S+ CFLLPHPGLKV+ N  F G++ D+ P F + ++ LI ++L PD L +K+ING+ +TC+   +YFKS I I + E+ P  ++++   A  N L  + + K  Y  +M+K+   E  YV  + L+ +H   L+       + +              L+  L  + + +   N +KN+  +  TP  L +++ + Y+L  L+  I +  VS V + +   A+   L W
Sbjct:   35 VQIVT--VNKEEHSFDLDTEALERILLVPKIRDMNVVVLSVAGAFRKGKSFLLDFMLRYMYRKSSDDWLGRDDEPLTGFSWRGGSEPETTGIQLWSEVFVVRKSNGKQVAVLLMDTQGAFDNQSTVKDCATIFALSTMTSSIQIYNLSQNIQEDDLQQLQLFTEYGRLAMDE-IFLKPFQSLMFLIRDWSFPYEYDYGLKGGSQFLDKRLQV-----------------KDSQHEELQT----VRQHIHSCFTSISCFLLPHPGLKVATNPAFQGQLCDVAPEFKKELRDLIPALLDPDKLAVKEINGNTVTCRGLLEYFKSYIKIYQGEDLPHPKSMLLATAEANNLAAVASSKDQYYKNMEKVCGGELPYVAPDSLEEKHNFYLRESLHHFTSIKKMGGQDFCNRYQAQLESELNELWVSFSKHNESKNVFSAFRTPAVLFVLVCLLYVLSGLLLFIGLDSVSFVCDCMLGLAMIAMLTW 492          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Cavefish
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:103024846])

HSP 1 Score: 246.899 bits (629), Expect = 8.337e-74
Identity = 146/519 (28.13%), Postives = 264/519 (50.87%), Query Frame = 1
Query:  112 TSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNI---LDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            T    +Q++  K  H    F  +  +L  +L    +  + +  +S+ G  RKGKSFL++ +LRY +++   +WL + ++PL GFSW  G    T GI +W+E FL  K D  +  +L++D QG F+  S+L +   + A S ++SS  + NI +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG ++++  +K                +S++      N+     +++  + F+++ CFL+PHPGLKV+ N +FDGR+++I+  F+ +++ L+  +L P NL +K+ING  +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY   M+++   +  ++   +L + H     I +  L   R   K    E +      L+  +  + ++Y   N++KN+  +  TP +L +V+ + Y+   +   + +  ++ V  ++   AL      I  C W       E   + A+ DQ+   L
Sbjct:   31 TRARPVQVLVVKDDHS---FELDEAALSRILLAEELRDREVVAVSVAGAFRKGKSFLMDFMLRYMYNQARDDWLGDPEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGTKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSMIFLVRDWSFPYEFPYGQEGGMKFLEKRLK----------------ISENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLKEIDREFIGNLQVLVPWLLGPKNLDVKEINGSKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAAAKDLYNKKMEEVSGGDRPFLAPTELQSRHA---SIREEALTVFRGVKKMGGEEFSRRYLLQLEAEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVSAGITGFVGVDVIASVCNMVLGFAL------ITLCTWAYIRYSGEYRELGAVIDQVAGAL 515          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Cavefish
Match: atl2 (atlastin GTPase 2 [Source:NCBI gene;Acc:103030630])

HSP 1 Score: 243.047 bits (619), Expect = 6.000e-72
Identity = 139/506 (27.47%), Postives = 251/506 (49.60%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFS-KCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLLIFFVFKPV 1659
            F  +  +LE++L    +   ++ V+S+ G  RKGKSFLL+ +LRY  + + + +W+   D+PL GFSW  G    T GI  W+E F+  K D  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW +P E  YGL GG+++++  ++                V ++      N+     +++    FS++ CFLLPHPGLKV+ N  FDGR+RDI+  F + ++ L+  +L+P+NL  K+ING  +TC++  +YFK+ I I + E  P  ++++   A  N L  +   K  Y   M+++   ++ Y+    L   H  L +    +    +     +  +     L+  L  +   +   N +KN+  +  TP +L  ++  +Y++  +   I +  ++ +  ++    + I+L+ +  C W       E   +    D   + L   V KP+
Sbjct:   90 FELDASALEKILMQEHVRDLNVVVVSVAGAFRKGKSFLLDFMLRYMHNHQSSESWMGGEDEPLTGFSWRGGCERETTGIQAWSEVFVVEKGDGSKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAM-EQIYEKPFQRLLFLIRDWCYPYEHNYGLAGGNRFLERRLQ----------------VKQNQHEELQNV-----RKHIHACFSNIGCFLLPHPGLKVATNPYFDGRLRDIDDEFTKELQNLVPLLLAPENLVEKEINGAKVTCRDLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDTYSRGMEQVCGGDKPYIAPIDLQRYHEDLKQTSVQQFRAVKKMGGLEFSQRYQEQLETELDEVFANFTKHNESKNIFYAARTPATLFAIMFATYIVSTITGFIGLSVIAALANLV----MGISLMSL--CIWAYVRYSGEYREVGVAIDLTAEALWEQVLKPM 567          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Cavefish
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:103024846])

HSP 1 Score: 234.958 bits (598), Expect = 1.481e-69
Identity = 145/524 (27.67%), Postives = 262/524 (50.00%), Query Frame = 1
Query:  112 TSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSS-HLLVNIPEGFDEMIY----DFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNI---LDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            T    +Q++  K  H    F  +  +L  +L    +  + +  +S+ G  RKGKSFL++ +LRY +++   +WL + ++PL GFSW  G    T GI +W+E FL  K D  +  +L++D QG F+  S+L +   + A S ++SS  ++V +        Y        LF  Y  L +     +KPFQ++I ++RDW+FP EFPYG  GG ++++  +K                V ++      N+     +++  + F+++ CFL+PHPGLKV+ N +FDGR+++I+  F+ +++ L+  +L P NL +K+ING  +TC+   +YFK+ I I + E  P  ++++   A  N L  +   K LY   M+++   +  ++   +L + H     I +  L   R   K    E +      L+  +  + ++Y   N++KN+  +  TP +L +V+ + Y+   +   + +  ++ V  ++   AL      I  C W       E   + A+ DQ+   L
Sbjct:   32 TRARPVQVLVVKDDH---SFELDEAALSRILLAEELRDREVVAVSVAGAFRKGKSFLMDFMLRYMYNQARDDWLGDPEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGTKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVIVQLSSHTTNNTYYHVTQALTLFTEYGRLAMEE-TFLKPFQSMIFLVRDWSFPYEFPYGQEGGMKFLEKRLK----------------VRENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLKEIDREFIGNLQVLVPWLLGPKNLDVKEINGSKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAAAKDLYNKKMEEVSGGDRPFLAPTELQSRHA---SIREEALTVFRGVKKMGGEEFSRRYLLQLEAEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVSAGITGFVGVDVIASVCNMVLGFAL------ITLCTWAYIRYSGEYRELGAVIDQVAGAL 521          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Sea Lamprey
Match: atl2 (atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6505])

HSP 1 Score: 254.988 bits (650), Expect = 6.361e-78
Identity = 143/492 (29.07%), Postives = 255/492 (51.83%), Query Frame = 1
Query:  121 HSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKS---KTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW 1587
            H++ +V     H    F  + Q+LE+ L   ++  K + VIS+ G  RKGKSFLL+ +LRY +SK +  WL   ++PL GFSW  G   +T GI++W++ FL + D  +  +L++D QG F+  S++ +C  + A S + SS  + N+     E      +LF  Y  L +      KPFQ++  ++RDW+FP EF YG  GG  +++  +                     N  +   +     + +  + FSS+ CFL+PHPGL V+ + +FDGR+ D++  F + ++ L+  +L+P+NL +K+ING  +TC+   +YFKS + I + E  P  ++++   A  N L  +   K +Y T M+K+   + +++   +L+  H ++        +  +M       +  E   N +++ LY   +KY   N +KN+  +  TP SL +V+  +Y+L  ++  + +  V+ +        L++ +L +  C W
Sbjct:    6 HAVPVVLAGEGH---MFSLDEQALEDTLLKKNLRDKPVVVISVAGAFRKGKSFLLDFMLRYMYSKGSPAWLGGDNEPLTGFSWRGGSERDTTGILLWSDVFLDRPDGSQVAVLLMDTQGAFDSQSTIRDCATVFALSTMTSSLQVYNVSHNIQEDDLQHLQLFTEYGRLAMEEIVN-KPFQSLTFLVRDWSFPYEFVYGADGGRHFLEKRLLV-------------------NDQQHEELQTV--RMHINSCFSSVSCFLMPHPGLMVATDPHFDGRLADVDTAFKQCLQELVPMLLAPENLVVKEINGTPITCRSLVEYFKSYMKIYQGEELPHPKSMLLATAEANNLSAVAAAKEIYTTEMEKVCGGDRAFLAPSELERHHRRVATGGALFRSVKKMGGDEFICRYQEQLENEVEQ-LYGNFVKY---NESKNIFHTFRTPASLFVVMLAAYVLSGVLGFVGLDIVASLCN------LAVTVLLLLLCTW 462          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Sea Lamprey
Match: atl2 (atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6505])

HSP 1 Score: 250.366 bits (638), Expect = 3.985e-76
Identity = 141/499 (28.26%), Postives = 258/499 (51.70%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLLIFFVFKPV 1659
            F  + ++L  +L D  +  K + V+S+ G  RKGKSFLL+ +LRY ++K  S+WL   D+PL GF+W  G    T GI MW++ FL  K D  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ+++ ++RDW+FP E+PYG  GG+++++  +K                +S++      N+     +++  + FS + CFL+PHPGLKV+ N NFDGR++DI+  F ++++ L+  +L+  NL +K+ING  +TC+   QYFK+ + I + E  P  ++++   A  N L  +   K +Y   M+K+    + ++    L+  H  LL+    +  + +     +        L+  +      +   N++KN+  +  TP +   V+   Y+    +  + +  ++ +  ++   +L +   W    +  E   + A+ D+L ++L   V KP+
Sbjct:   23 FELDEEALGRVLLDERVRDKDVVVVSVAGAFRKGKSFLLDFMLRYMYNKNTSSWLGGNDEPLTGFTWRGGCERETTGIQMWSDVFLVDKPDGSQVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLTQNIQEDDLQHLQLFTEYGRLAMDQVIN-KPFQSLMFLVRDWSFPYEYPYGHEGGNKFLEKRLK----------------LSENQHEEVQNV-----RKHIHSCFSKVSCFLMPHPGLKVATNPNFDGRLKDIDSEFKQNLQNLVPLLLASQNLAVKEINGSRITCRALVQYFKTYMKIYQGEELPHPKSMLQATAEANNLTAVATAKDMYNREMEKVCGGNQPFLAPSDLEQRHHNLLEGCIKQFRSTKKMGGEEYSRKYEEQLECEIQETFGNFSKHNDSKNIFKAARTPATFFSVVVAMYVASGALGFVGLSALASLCNLVLTMSLLLLCTWSYVRYSGEYRDVGAVIDELANVLWEQVIKPL 499          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Sea Lamprey
Match: GBP6 (guanylate binding protein family member 6 [Source:HGNC Symbol;Acc:HGNC:25395])

HSP 1 Score: 61.2326 bits (147), Expect = 2.923e-10
Identity = 86/412 (20.87%), Postives = 165/412 (40.05%), Query Frame = 1
Query:  238 VISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFN-KFSSLNECTKLSAFSLLMSSHLLVNI-----PEGFDEMIY-----DFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSM---KTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSI 1431
            V++I G  R GKS+L+N L         SN         +GFS    + S+T GI +W        D   + LL++D +G+ + + +  N  T L   ++L+S+ L+ N       +GFD++ +     +     I+     +G     + F + +  +RD+T   E        DQY+++ +   K G +        Q   +S                    + F   +CF+ P P     ++       + +NP FL+  +   T IL      +K ++   LT   + +  +  ++   + + P I++ +T+  +   ++  E+   LY   M+ +         +++L     KL +  Q  L  A      ++V    +  +K L   L+    D N KN + S+
Sbjct:   43 VVAIAGRYRTGKSYLMNRL-------AGSN---------NGFSLGNTVQSHTKGIWIWPRAHPLHKD---KCLLLIDTEGLGDVEKAGDNHDTWLFVMAVLLSTTLVWNTTGVLSKDGFDQLHFVANMTEHVRTKIHQREDEVGQDFK-RYFPSFVVCVRDFTLKLEIEGKACDADQYLEHCLGIRKKGMTANCRSFNEQRELLS--------------------SFFKKRKCFVFPMPTHPEDLHKLETISEQQLNPEFLQTAEDFTTHILQ--TAHIKHVDNAVLTGPLFLKLTEQYVNSQRSGDVPCIESALTQVVTLANMQAREDAMSLYEKRMEAV---------NQQLPLPIAKLNEFHQHALEQAVEAFHQRSVLDCEHKHEKELMDSLVTAYDDWNQKNKDTSM 403          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010770.1 (pep scaffold:Pmarinus_7.0:GL476415:1116328:1128394:1 gene:ENSPMAG00000009749.1 transcript:ENSPMAT00000010770.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 4.395e-6
Identity = 78/314 (24.84%), Postives = 121/314 (38.54%), Query Frame = 1
Query:  151 SHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGI--FNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKP--------------FQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKIN 1044
            S  E +F  N ++  EL    S   K L V++I G  R GKS+LLN L     S               GF+    + ++T GI +W  P   + DS  + LL+LD +G+   NK  S +  T L   S+L+SS L++N     D+  ++      N A  V      V P              F   +  IRD    +E        D++M+  ++ G   K S+       + K                     F+  +CF+ P P   +      D     +NP F+E +K     +L     ++K IN
Sbjct:   16 SDEEMKFRVNRETAAEL----SAIDKPLVVVAIAGRYRTGKSYLLNRLAGGGDS---------------GFALGHTVRAHTRGIWVWPLPH-PRDDS--KCLLLLDTEGLGDINK-GSCDHDTWLFVMSILLSSTLVLNAMRTLDKDSFELLHFVSNMAEHV-NMKIHVSPSAGDDQEEVNYKTIFPVFVVCIRDSLSTSEDTESSCSADEFMEECLQNGK--KSSEFKETCEMLCK--------------------YFTERKCFMFPMPAQMLKFTKLKDLPDDKLNPEFVETLKDFENYVLGEG--RVKHIN 281          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Nematostella
Match: EDO43003 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZT7])

HSP 1 Score: 262.692 bits (670), Expect = 1.057e-80
Identity = 159/494 (32.19%), Postives = 258/494 (52.23%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSK--CNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKI-DSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKI-KFVSMVTEIIFYGALSINLLWIAACF-WEIEFISAMFDQLTDLL 1635
            F  + ++L ++L D SI  K ++V+S+ G  RKGKSFLL+  LRY   K  C+ +WL    + L+GFSW  G   +T GI+MWN+P++ K  D EE V+L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L + +   +KPFQ ++ ++RDW+FP E  YG  GG Q ++  +KT       +  S++  V K                + K  F  + CFL+PHPGL+V+ N  FDGR+ DI+  F E+++ LI S+L+P+NL+LK ING  +TC+   +YFK+ + I + +  PQ ++++   A  N L  +   K  Y  +M+ ++  +  Y+   +L+ +H++      S     R     +  E     L K +      +   N++KN+  +  TP     ++ +SY+L  + N I I  F  M    I+ G L I L+W    F  E     A  D L +L+
Sbjct:   18 FELDEKALSKILLDDSIRDKKVAVVSVAGAFRKGKSFLLDFFLRYLDRKDSCD-DWLGGETEALEGFSWRGGSERDTTGILMWNKPYICKRPDGEEVVVLLMDTQGAFDSSSTVKDCATIFALSTMTSSTQVYNVSQNIQEDDLQHLQLFTEYGKLAMEN-NEIKPFQRLLFLVRDWSFPYEANYGEAGGSQILERRLKT-----TERQHSELLQVRK----------------HIKECFEKIGCFLMPHPGLRVATNPTFDGRLVDIDDEFKENLRKLIPSLLAPENLELKGINGEEVTCRGLLEYFKAYMKIFQGDELPQPKSMLLATAEANNLAALATAKDTYSKAMESVVGGDMPYLSPNELERKHLETRDSALSHFHGTRKMGGKEFSEKYVEQLLKEIDETFENFVKLNDSKNIFNAARTPAVFFTIVVLSYILSSVFNSIGILSFTRMCNLTIWMGLLGI-LVWSYIRFSGEFREFGAKLDHLAELI 487          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Nematostella
Match: EDO34670 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS4])

HSP 1 Score: 55.8398 bits (133), Expect = 4.248e-8
Identity = 55/193 (28.50%), Postives = 88/193 (45.60%), Query Frame = 1
Query:   67 FMEAITSQTLND--TIKTSGHSIQLV-SDKLSHGEKQFVYNVQSLE--ELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKI-DSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASL 627
            F E   S  +N   +IK     +QLV  D+ SH  KQ V + ++L   +L+ +P      ++ ++++G    GKSFLLN L+                    GF     +   T+GI MW +P   K+ D +E  L+ LD +G      S +   K+ A + L+SS+L+ N  +  D+   D+ EL      L
Sbjct:   66 FQEQSQSSQINSWSSIKELDKPVQLVYPDQSSH--KQLVLHKENLRLLQLIQEP------IATVAVVGKFHTGKSFLLNQLM----------------GKQAGFGVGPFVRPETMGIWMWGKPLKIKLQDGQEVALVFLDTEGFAATNVSESYDAKVFAVATLLSSYLIYNSVKIIDQGDIDYLELLSRRTQL 234          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001294.2 (atlastin GTPase 2 [Source:NCBI gene;Acc:101169833])

HSP 1 Score: 264.233 bits (674), Expect = 3.635e-80
Identity = 141/471 (29.94%), Postives = 240/471 (50.96%), Query Frame = 1
Query:  160 EKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
            E  F     +LE+LL    +   H+ V+S+ G  RKGKSFLL+ +LRY + K    W+   + PL GF+W  G    T GI+ W+E F+  K D ++  +L++D QG F+  S++ +C  L A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW +P E  YGL GG  +++  ++                V ++      N+     +++  + FS++ CFLLPHPGLKV+ N +FDGR+RDI+  F   ++ LI ++LSP+NL  K+I G  +TC++   YFK+ + I + E  P  ++++   A  N L  +   K LY  SM++I   ++ Y+   +L+  H +LL+       + +              L+  L      +   N+ KN+  +  TP  L  V+ + Y++  +   + I +V+++  ++   AL+   +W
Sbjct:   67 EHSFSLQEAALEQLLLQKEVQDLHVVVVSVAGAFRKGKSFLLDFMLRYMYKKSEDWWIGGENDPLTGFTWRGGCERETTGILAWSEVFVVEKPDGQKVAVLLIDTQGAFDSQSTIKDCATLFALSTMTSSVQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-VYEKPFQTLMFLIRDWCYPYEHQYGLEGGQSFLEKRLQ----------------VKQNQHEELQNV-----RKHIHSCFSNISCFLLPHPGLKVATNPHFDGRLRDIDDEFKRALQDLIPTLLSPENLVEKEIGGVKITCRDLLHYFKAYMKIYQGEELPHPKSMLQATAEANNLAAVAGAKDLYNKSMEQICGGDKPYISPAELERRHTELLQTSVRHFRSVKKMGGEDFCRRYQEQLEAELNESYTNFTKHNDGKNIFFAARTPAMLFAVMFVMYVVSLVTGFVGISYVAVLCNLVMGVALTALCIW 515          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001295.2 (atlastin GTPase 2 [Source:NCBI gene;Acc:101169833])

HSP 1 Score: 264.233 bits (674), Expect = 4.318e-80
Identity = 141/471 (29.94%), Postives = 240/471 (50.96%), Query Frame = 1
Query:  160 EKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW 1569
            E  F     +LE+LL    +   H+ V+S+ G  RKGKSFLL+ +LRY + K    W+   + PL GF+W  G    T GI+ W+E F+  K D ++  +L++D QG F+  S++ +C  L A S + SS  + N+ +   E      +LF  Y  L +      KPFQ ++ +IRDW +P E  YGL GG  +++  ++                V ++      N+     +++  + FS++ CFLLPHPGLKV+ N +FDGR+RDI+  F   ++ LI ++LSP+NL  K+I G  +TC++   YFK+ + I + E  P  ++++   A  N L  +   K LY  SM++I   ++ Y+   +L+  H +LL+       + +              L+  L      +   N+ KN+  +  TP  L  V+ + Y++  +   + I +V+++  ++   AL+   +W
Sbjct:   67 EHSFSLQEAALEQLLLQKEVQDLHVVVVSVAGAFRKGKSFLLDFMLRYMYKKSEDWWIGGENDPLTGFTWRGGCERETTGILAWSEVFVVEKPDGQKVAVLLIDTQGAFDSQSTIKDCATLFALSTMTSSVQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-VYEKPFQTLMFLIRDWCYPYEHQYGLEGGQSFLEKRLQ----------------VKQNQHEELQNV-----RKHIHSCFSNISCFLLPHPGLKVATNPHFDGRLRDIDDEFKRALQDLIPTLLSPENLVEKEIGGVKITCRDLLHYFKAYMKIYQGEELPHPKSMLQATAEANNLAAVAGAKDLYNKSMEQICGGDKPYISPAELERRHTELLQTSVRHFRSVKKMGGEDFCRRYQEQLEAELNESYTNFTKHNDGKNIFFAARTPAMLFAVMFVMYVVSLVTGFVGISYVAVLCNLVMGVALTALCIW 515          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Medaka
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:101159304])

HSP 1 Score: 252.677 bits (644), Expect = 4.719e-76
Identity = 140/497 (28.17%), Postives = 254/497 (51.11%), Query Frame = 1
Query:  169 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLL 1635
            F  +  +L  +L    +  + +  IS+ G  RKGKSFL++ +LR+ ++    NW+ + D+PL GFSW  G    T GI +W+E FL  K D  +  +L++D QG F+  S+L +   + A S ++SS  + NI +   E      +LF  Y  L +     +KPFQ++I ++RDW+FP EFPYGL GG ++++  +K                +S++      N+     +++  + F+++ CFL+PHPGLKV+ N +FDGRM++I+  F+ ++K L+  +LSP N+ +K+ING  +TC+   +YFK+ I I + E  P  ++++   A  N L  +   + LY   M+++   +  ++   +L A H  + +         +              L+  +  + ++Y   N++KN+  +  TP +L +V+ + Y+   +   + +  ++ +  +I      + L  I  C W       E   + A+ DQ+   L
Sbjct:   47 FELDEAALSRILLAEEVQDREVVAISVAGAFRKGKSFLMDFMLRFMYNHTTENWVGDSDEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGRKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEE-TFLKPFQSMIFLVRDWSFPYEFPYGLEGGTKFLEKRLK----------------ISENQHEELQNV-----RKHIHSCFTNISCFLMPHPGLKVATNPHFDGRMKEIDGEFINNLKVLVPWLLSPGNIDVKEINGSRITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAAAQDLYNKKMEQVCGGDRPFMAPSELQARHGGVREEALQLFRGVKKMGGEDFSRRYLQQLEGEIDEVFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVAAGITGFVGVDIIASLCNMI------LGLALITLCTWAYIRYSGEYRELGAVIDQVAGAL 515          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Medaka
Match: atl2 (atlastin-2 [Source:NCBI gene;Acc:101156948])

HSP 1 Score: 253.062 bits (645), Expect = 1.273e-75
Identity = 145/508 (28.54%), Postives = 254/508 (50.00%), Query Frame = 1
Query:  160 EKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLLIFFVFKPV 1659
            E  F  +  +LE++L    +   ++ V+S+ G  RKGKSFLL+ +LRY  S+ N  W+   D PL GF W  G    T GI +W++ F+  K D  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ+++ +IRDW++P E  YGL GG  +++  ++                V ++      N+     +++  + FS ++CFLLPHPGLKVS N  FDGR+RDI+  F + +  L+  +LSP++L  K+I G+ +TC++  +YFK+ I I + E  P  ++++   A  N L  +   K +Y  SM++I   ++ Y+    L+  H +  +       + +     +  +   N L+  L      +   N+ KNL  +  TP +L  V+ ++Y++  +   I +   + +  ++   AL      ++ C W       E   +  + DQ+ + L   V KP+
Sbjct:   98 EHSFELDAAALEKILLQDHVKDLNVVVVSVAGAFRKGKSFLLDFMLRYMHSQSNECWMGGDDDPLTGFIWRGGCERETTGIQVWSDVFVVDKPDGTKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-IYFKPFQSLMFLIRDWSYPYEHEYGLEGGKAFLEKRLQ----------------VKQNQHEELQNV-----RKHIHSCFSKIECFLLPHPGLKVSTNPKFDGRLRDIDEDFKKELAKLVPLLLSPEHLVEKEIGGNKVTCRDLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDMYSKSMEQICGGDKPYIAPADLERCHEEFRQHSIHFFRSVKKMGGEEFCQRYQNQLESELDETYSSFTKHNDGKNLFYAARTPATLFAVMFVTYVVSGVTGFIGLSTFATLANLVMGVAL------LSLCAWAYVKYSGEFRELGLLIDQVAETLWEQVLKPL 577          
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Medaka
Match: atl2 (atlastin-2 [Source:NCBI gene;Acc:101156948])

HSP 1 Score: 253.447 bits (646), Expect = 2.041e-75
Identity = 145/508 (28.54%), Postives = 254/508 (50.00%), Query Frame = 1
Query:  160 EKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLT-KIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFW-------EIEFISAMFDQLTDLLIFFVFKPV 1659
            E  F  +  +LE++L    +   ++ V+S+ G  RKGKSFLL+ +LRY  S+ N  W+   D PL GF W  G    T GI +W++ F+  K D  +  +L++D QG F+  S++ +C  + A S + SS  + N+ +   E      +LF  Y  L +      KPFQ+++ +IRDW++P E  YGL GG  +++  ++                V ++      N+     +++  + FS ++CFLLPHPGLKVS N  FDGR+RDI+  F + +  L+  +LSP++L  K+I G+ +TC++  +YFK+ I I + E  P  ++++   A  N L  +   K +Y  SM++I   ++ Y+    L+  H +  +       + +     +  +   N L+  L      +   N+ KNL  +  TP +L  V+ ++Y++  +   I +   + +  ++   AL      ++ C W       E   +  + DQ+ + L   V KP+
Sbjct:  135 EHSFELDAAALEKILLQDHVKDLNVVVVSVAGAFRKGKSFLLDFMLRYMHSQSNECWMGGDDDPLTGFIWRGGCERETTGIQVWSDVFVVDKPDGTKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNVQEDDLQHLQLFTEYGRLAMEE-IYFKPFQSLMFLIRDWSYPYEHEYGLEGGKAFLEKRLQ----------------VKQNQHEELQNV-----RKHIHSCFSKIECFLLPHPGLKVSTNPKFDGRLRDIDEDFKKELAKLVPLLLSPEHLVEKEIGGNKVTCRDLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDMYSKSMEQICGGDKPYIAPADLERCHEEFRQHSIHFFRSVKKMGGEEFCQRYQNQLESELDETYSSFTKHNDGKNLFYAARTPATLFAVMFVTYVVSGVTGFIGLSTFATLANLVMGVAL------LSLCAWAYVKYSGEFRELGLLIDQVAETLWEQVLKPL 614          
BLAST of GB1/RHD3-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000081995.1 (SMESG000081995.1)

HSP 1 Score: 1040.8 bits (2690), Expect = 0.000e+0
Identity = 521/559 (93.20%), Postives = 524/559 (93.74%), Query Frame = 1
Query:   70 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKILNPFYQNFTKKSVNFISE 1746
            MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE                                + ++  DWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKILNPFYQNFTKKSVNFISE
Sbjct:    1 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE--------------------------------VWSLDLDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKILNPFYQNFTKKSVNFISE 527          
BLAST of GB1/RHD3-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000081995.1 (SMESG000081995.1)

HSP 1 Score: 1033.09 bits (2670), Expect = 0.000e+0
Identity = 516/554 (93.14%), Postives = 519/554 (93.68%), Query Frame = 1
Query:   70 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKILNPFYQNFTKKSV 1731
            MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE                                + ++  DWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKILNPFYQNFTKKSV
Sbjct:    1 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE--------------------------------VWSLDLDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKILNPFYQNFTKKSV 522          
BLAST of GB1/RHD3-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000081995.1 (SMESG000081995.1)

HSP 1 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 492/540 (91.11%), Postives = 499/540 (92.41%), Query Frame = 1
Query:   70 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFV-FKPVIGIMKNKPV 1686
            MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE                                + ++  DWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFV +  VI +++  PV
Sbjct:    1 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE--------------------------------VWSLDLDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFVAWCNVISVLEEHPV 508          
BLAST of GB1/RHD3-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000081995.1 (SMESG000081995.1)

HSP 1 Score: 975.311 bits (2520), Expect = 0.000e+0
Identity = 488/526 (92.78%), Postives = 491/526 (93.35%), Query Frame = 1
Query:   70 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFV 1647
            MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE                                + ++  DWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFV
Sbjct:    1 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE--------------------------------VWSLDLDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFV 494          
BLAST of GB1/RHD3-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000081995.1 (SMESG000081995.1)

HSP 1 Score: 973.77 bits (2516), Expect = 0.000e+0
Identity = 488/526 (92.78%), Postives = 491/526 (93.35%), Query Frame = 1
Query:   70 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNIIAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFV 1647
            MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE                                + ++  DWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFV
Sbjct:    1 MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPE--------------------------------VWSLDLDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNLNMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLWIAACFWEIEFISAMFDQLTDLLIFFV 494          
The following BLAST results are available for this feature:
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATL27.632e-7928.21atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:240... [more]
ATL28.936e-7927.86atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:240... [more]
ATL21.624e-7827.72atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:240... [more]
ATL13.589e-7628.02atlastin GTPase 1 [Source:HGNC Symbol;Acc:HGNC:112... [more]
ATL14.445e-7628.08atlastin GTPase 1 [Source:HGNC Symbol;Acc:HGNC:112... [more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atln-14.376e-7730.06ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
atln-19.418e-7730.06ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
atln-21.007e-5430.08ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
atln-21.694e-5430.08ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
atln-22.006e-3427.90ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atl5.887e-7628.66gene:FBgn0039213 transcript:FBtr0084656[more]
atl5.887e-7628.66gene:FBgn0039213 transcript:FBtr0084657[more]
atl5.887e-7628.66gene:FBgn0039213 transcript:FBtr0345218[more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atl11.143e-8029.60atlastin GTPase 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
atl11.909e-8029.60atlastin GTPase 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
atl36.688e-7729.18atlastin 3 [Source:ZFIN;Acc:ZDB-GENE-041010-109][more]
atl36.688e-7729.18atlastin 3 [Source:ZFIN;Acc:ZDB-GENE-041010-109][more]
atl38.700e-7729.70atlastin 3 [Source:ZFIN;Acc:ZDB-GENE-041010-109][more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atl17.171e-7727.83atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
atl12.867e-7628.02atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
atl12.992e-7628.02atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
atl14.215e-7627.85atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
atl14.781e-7628.02atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atl21.402e-8028.40atlastin GTPase 2 [Source:MGI Symbol;Acc:MGI:19294... [more]
Atl15.949e-7728.17atlastin GTPase 1 [Source:MGI Symbol;Acc:MGI:19212... [more]
Atl37.133e-6627.97atlastin GTPase 3 [Source:MGI Symbol;Acc:MGI:19242... [more]
Atl33.316e-6527.81atlastin GTPase 3 [Source:MGI Symbol;Acc:MGI:19242... [more]
Atl22.320e-5526.75atlastin GTPase 2 [Source:MGI Symbol;Acc:MGI:19294... [more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95LN3|ATLA2_MACFA5.306e-8028.24Atlastin-2 OS=Macaca fascicularis OX=9541 GN=ATL2 ... [more]
sp|Q6PA06|ATLA2_MOUSE9.808e-8028.40Atlastin-2 OS=Mus musculus OX=10090 GN=Atl2 PE=1 S... [more]
sp|Q8NHH9|ATLA2_HUMAN3.665e-7828.21Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2 PE=1 SV... [more]
sp|Q6PST4|ATLA1_RAT3.269e-7628.37Atlastin-1 OS=Rattus norvegicus OX=10116 GN=Atl1 P... [more]
sp|Q8BH66|ATLA1_MOUSE4.161e-7628.17Atlastin-1 OS=Mus musculus OX=10090 GN=Atl1 PE=1 S... [more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DC728.999e-9132.89Atlastin-1 isoform 4 OS=Schistosoma japonicum OX=6... [more]
G4VPP51.360e-9032.07Putative atlastin OS=Schistosoma mansoni OX=6183 G... [more]
A0A4S2LV294.742e-8930.25GB1/RHD3-type G domain-containing protein OS=Opist... [more]
A0A430QM538.800e-8932.07Atlastin OS=Schistosoma bovis OX=6184 GN=DC041_000... [more]
A0A419PLD91.464e-8830.25Atlastin-1 OS=Clonorchis sinensis OX=79923 GN=ATL1... [more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atl35.607e-7830.71atlastin-3-like [Source:NCBI gene;Acc:103047852][more]
atl37.288e-7830.71atlastin-3-like [Source:NCBI gene;Acc:103047852][more]
atl18.337e-7428.13atlastin GTPase 1 [Source:NCBI gene;Acc:103024846][more]
atl26.000e-7227.47atlastin GTPase 2 [Source:NCBI gene;Acc:103030630][more]
atl11.481e-6927.67atlastin GTPase 1 [Source:NCBI gene;Acc:103024846][more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atl26.361e-7829.07atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
atl23.985e-7628.26atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
GBP62.923e-1020.87guanylate binding protein family member 6 [Source:... [more]
ENSPMAT00000010770.14.395e-624.84pep scaffold:Pmarinus_7.0:GL476415:1116328:1128394... [more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO430031.057e-8032.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346704.248e-828.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001294.23.635e-8029.94atlastin GTPase 2 [Source:NCBI gene;Acc:101169833][more]
ENSORLT00000001295.24.318e-8029.94atlastin GTPase 2 [Source:NCBI gene;Acc:101169833][more]
atl14.719e-7628.17atlastin GTPase 1 [Source:NCBI gene;Acc:101159304][more]
atl21.273e-7528.54atlastin-2 [Source:NCBI gene;Acc:101156948][more]
atl22.041e-7528.54atlastin-2 [Source:NCBI gene;Acc:101156948][more]
back to top
BLAST of GB1/RHD3-type G domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081995.10.000e+093.20SMESG000081995.1[more]
SMESG000081995.10.000e+093.14SMESG000081995.1[more]
SMESG000081995.10.000e+091.11SMESG000081995.1[more]
SMESG000081995.10.000e+092.78SMESG000081995.1[more]
SMESG000081995.10.000e+092.78SMESG000081995.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022577 ID=SMED30022577|Name=GB1/RHD3-type G domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1786bp
CTTCAATTTTTCTTGTAATGTATTTTTCTGGAAGATTTAAATCTGAATTC
TGTTTCACCTAATTCATTTATGGAAGCGATCACCAGCCAAACTCTTAATG
ATACAATAAAAACGAGTGGTCATTCAATCCAATTAGTATCTGATAAACTT
TCGCACGGTGAAAAGCAATTTGTTTATAATGTACAATCTCTGGAAGAACT
TCTTTGCGATCCCTCCATATCAACCAAGCATTTGTCTGTTATTTCAATAA
TAGGTCCTGGTCGAAAGGGAAAATCATTTTTACTAAACATTCTTTTGAGA
TATTTCTTTTCCAAATGTAATTCAAATTGGTTGTCAAATCTCGATCAGCC
TTTAGATGGGTTTTCATGGAATTGCGGTATTAACAGTAACACAGTTGGAA
TAGTAATGTGGAATGAACCATTTCTAACAAAGATAGACTCCGAAGAACGA
GTTTTGTTGATCTTGGATGTTCAGGGAATATTCAATAAATTTAGCTCATT
GAATGAATGCACAAAATTATCCGCATTTAGTCTACTCATGAGTAGTCATT
TGTTAGTCAATATACCTGAAGGTTTCGATGAAATGATCTATGATTTTGCT
GAATTGTTCATAAATTATGCTAGTTTGGTCATTGGATCTTGGTGCACCGT
GAAACCATTTCAAAACATCATTGCAATTATCAGAGATTGGACATTTCCCA
ATGAATTTCCTTATGGTTTGCACGGAGGAGACCAATATATGAAATATTCT
ATGAAAACTGGATCATCACCCAAAGTGTCAAAAGTTCCGTCTCAGATTAG
TTATGTTTCAAAAGACAATACTTCACGGTCAGCAAATATAGACAATGCCT
ACTTCAAACAATATTACAAAAATATATTTTCTAGCTTACAATGCTTTTTA
TTGCCACATCCTGGACTCAAAGTTTCCATGAATTCCAATTTTGACGGCAG
AATGAGAGACATAAATCCATTATTTCTTGAACACGTAAAAACCTTAATAA
CATCTATTTTAAGTCCAGATAATTTGCAATTAAAGAAAATAAATGGTCAT
TATTTGACATGCAAAGAATACTTTCAATATTTTAAATCGTTAATTCACAT
AATGGAAACCGAAAATTTCCCTCAAATCCAAAATATAATGACCGAGAATG
CTTCTTTTAATCAATTGGAGTTTATTGAAAACATGAAATATTTATATATT
ACTTCAATGGACAAGATTATTGCATCCGAAGAAAGTTACGTAGATGATGA
AAAATTAGATGCAGAACATATAAAATTACTGAAAATTATACAATCGGAAT
TAGCAACAGCAAGAATGTTTAATAAAAGTAAAACTGTAGAATCCACAAGC
AATATCCTTGACAAAACTTTGTATAGCATTTTATTGAAATATAAGTCAGA
TAACAATAATAAAAATCTAAATATGAGTATTTTTACTCCATACTCATTAA
TTATTGTTTTAACGATATCATATCTACTCTATCATTTAATGAATATAATT
AAAATAAAATTCGTTTCCATGGTAACGGAAATTATATTTTATGGAGCACT
GAGCATTAATTTGTTGTGGATTGCCGCCTGTTTTTGGGAAATTGAATTTA
TCAGTGCTATGTTCGATCAGCTGACAGATTTACTCATTTTTTTCGTTTTC
AAGCCGGTAATTGGAATAATGAAAAACAAACCAGTGAAAATCCTAAATCC
ATTTTATCAAAATTTTACAAAAAAATCTGTAAACTTTATTAGTGAATAGA
ATAATTATTAAAAAAATAAATAATATAAAAATAGAA
back to top

protein sequence of SMED30022577-orf-1

>SMED30022577-orf-1 ID=SMED30022577-orf-1|Name=SMED30022577-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=560bp
MEAITSQTLNDTIKTSGHSIQLVSDKLSHGEKQFVYNVQSLEELLCDPSI
STKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSW
NCGINSNTVGIVMWNEPFLTKIDSEERVLLILDVQGIFNKFSSLNECTKL
SAFSLLMSSHLLVNIPEGFDEMIYDFAELFINYASLVIGSWCTVKPFQNI
IAIIRDWTFPNEFPYGLHGGDQYMKYSMKTGSSPKVSKVPSQISYVSKDN
TSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINP
LFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENF
PQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEH
IKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKNL
NMSIFTPYSLIIVLTISYLLYHLMNIIKIKFVSMVTEIIFYGALSINLLW
IAACFWEIEFISAMFDQLTDLLIFFVFKPVIGIMKNKPVKILNPFYQNFT
KKSVNFISE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR015894Guanylate-bd_N
IPR030386G_GB1_RHD3_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015894Guanylate-binding protein, N-terminalPFAMPF02263GBPcoord: 32..319
e-value: 1.7E-41
score: 142.3
NoneNo IPR availableGENE3DG3DSA:1.20.58.420coord: 351..459
e-value: 2.1E-7
score: 33.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 17..350
e-value: 1.7E-80
score: 272.3
NoneNo IPR availablePANTHERPTHR10751:SF42ATLASTIN-2coord: 14..532
NoneNo IPR availablePANTHERPTHR10751GUANYLATE BINDING PROTEINcoord: 14..532
NoneNo IPR availableTMHMMTMhelixcoord: 488..510
NoneNo IPR availableTMHMMTMhelixcoord: 454..476
IPR030386GB1/RHD3-type guanine nucleotide-binding (G) domainPROSITEPS51715G_GB1_RHD3coord: 52..314
score: 23.892
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 33..318