pescadillo-1

Overview
Namepescadillo-1 (AFJ24809.1)
Smed IDSMED30022575
Length (bp)1686
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of pescadillo-1 (SMED30022575) t-SNE clustered cells

Violin plots show distribution of expression levels for pescadillo-1 (SMED30022575) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of pescadillo-1 (SMED30022575) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for pescadillo-1 (SMED30022575) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022575

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022575SMESG000032689.1 SmedASXL_012759SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022575SMESG000032689.1 SmedASXL_012759SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30022575SMESG000032689.1 dd_Smed_v4_900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022575SMESG000032689.1 dd_Smed_v4_900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022575SMESG000032689.1 dd_Smed_v4_900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022575SMESG000032689.1 dd_Smed_v4_900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022575SMESG000032689.1 dd_Smed_v4_900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022575SMESG000032689.1 dd_Smed_v4_900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022575SMESG000032689.1 dd_Smed_v4_900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022575SMESG000032689.1 dd_Smed_v4_900_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022575SMESG000032689.1 Contig16890uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022575SMESG000032689.1 Contig16890newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022575SMESG000032689.1 Contig5660uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022575SMESG000032689.1 Contig5660newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022575SMESG000078332.1 Contig5660uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022575SMESG000078332.1 Contig5660newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30022575SMESG000032689.1 dd_Smed_v6_900_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30022575SMESG000032689.1 dd_Smed_v6_900_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of pescadillo-1 vs. Ensembl Human
Match: PES1 (pescadillo ribosomal biogenesis factor 1 [Source:HGNC Symbol;Acc:HGNC:8848])

HSP 1 Score: 295.049 bits (754), Expect = 5.598e-92
Identity = 172/441 (39.00%), Postives = 248/441 (56.24%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---------------FAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ L +F RLC+ K IYP EP + K   KG T  + +Y  KDI+ LL EPIV K RE + F  +L++A  + + + V RL+ +KP Y L HI+KE YP+  DAL  LDD L   F+F++ P+  + +   I  C+RL +EFM++ I  +ALRK F+S+KG Y + E+ G  + W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK               +A+D  +   +   L++    ++    + E + D+       D   EL    E QEK    + LF   K FLNRE+PRE   F++R  G  EVSWD ++  GAT+ V D+ I + ++DRP +  S  I R YVQPQ+V DS+NA  LLPV +Y  G++L PHLSPF    +G YVPPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYLIKDIRFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHIIKERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIVWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEEDRRKEL----EAQEK---HKKLFEGLKFFLNREVPREALAFIIRSFGG-EVSWDKSLCIGATYDVTDSRITHQIVDRPGQQTSV-IGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPE 433          
BLAST of pescadillo-1 vs. Ensembl Human
Match: PES1 (pescadillo ribosomal biogenesis factor 1 [Source:HGNC Symbol;Acc:HGNC:8848])

HSP 1 Score: 294.664 bits (753), Expect = 8.570e-92
Identity = 170/442 (38.46%), Postives = 250/442 (56.56%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---------------FAVDETNDWNENDILASMAFPLLKAQCDSETDADQLAL-SEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ L +F RLC+ K IYP EP + K   KG T  + +Y  KDI+ LL EPIV K RE + F  +L++A  + + + V RL+ +KP Y L HI+KE YP+  DAL  LDD L   F+F++ P+  + +   I  C+RL +EFM++ I  +ALRK F+S+KG Y + E+ G  + W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK               +A+D  +   +   L++    ++    + E + D+     E    +++    +E QEK    + LF   K FLNRE+PRE   F++R  G  EVSWD ++  GAT+ V D+ I + ++DRP +  S  I R YVQPQ+V DS+NA  LLPV +Y  G++L PHLSPF    +G YVPPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYLIKDIRFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHIIKERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIVWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKELEAQEK---HKKLFEGLKFFLNREVPREALAFIIRSFGG-EVSWDKSLCIGATYDVTDSRITHQIVDRPGQQTSV-IGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPE 438          
BLAST of pescadillo-1 vs. Ensembl Human
Match: PES1 (pescadillo ribosomal biogenesis factor 1 [Source:HGNC Symbol;Acc:HGNC:8848])

HSP 1 Score: 278.87 bits (712), Expect = 6.027e-86
Identity = 168/442 (38.01%), Postives = 244/442 (55.20%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---------------FAVDETNDWNENDILASMAFPLLKAQCDSETDADQLAL-SEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ L +F RLC+ K IYP EP + K   KG T  + +Y  KDI+ LL EPIV K RE + F  +L++A  + + + V RL+ +KP Y L HI+KE YP+  DAL  LDD L   F+F++ P+  + +   I  C+RL +EFM++ I  +ALRK F+S+KG Y + E             H     P   DYR++A   EF   LL  +   LY    L YPPK               +A+D  +   +   L++    ++    + E + D+     E    +++    +E QEK    + LF   K FLNRE+PRE   F++R  G  EVSWD ++  GAT+ V D+ I + ++DRP +  S  I R YVQPQ+V DS+NA  LLPV +Y  G++L PHLSPF    +G YVPPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYLIKDIRFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHIIKERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAE-------------H-----PTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKELEAQEK---HKKLFEGLKFFLNREVPREALAFIIRSFGG-EVSWDKSLCIGATYDVTDSRITHQIVDRPGQQTSV-IGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPE 421          
BLAST of pescadillo-1 vs. Ensembl Human
Match: PES1 (pescadillo ribosomal biogenesis factor 1 [Source:HGNC Symbol;Acc:HGNC:8848])

HSP 1 Score: 183.341 bits (464), Expect = 3.940e-51
Identity = 110/303 (36.30%), Postives = 164/303 (54.13%), Query Frame = 3
Query:  432 FIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---------------FAVDETNDWNENDILASMAFPLLKAQCDSETDADQLAL-SEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            F+F++ P+  + +   I  C+RL +EFM++ I  +ALRK F+S+KG Y + E+ G  + W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK               +A+D  +   +   L++    ++    + E + D+     E    +++    +E QEK    + LF   K FLNRE+PRE   F++R  G  EVSWD ++  GAT+ V D+ I + ++DRP +  S  I R YVQPQ+V DS+NA  LLPV +Y  G++L PHLSPF    +G YVPPE
Sbjct:    3 FLFSTFPRTGKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIVWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKELEAQEK---HKKLFEGLKFFLNREVPREALAFIIRSFGG-EVSWDKSLCIGATYDVTDSRITHQIVDRPGQQTSV-IGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPE 299          
BLAST of pescadillo-1 vs. Ensembl Human
Match: PES1 (pescadillo ribosomal biogenesis factor 1 [Source:HGNC Symbol;Acc:HGNC:8848])

HSP 1 Score: 183.341 bits (464), Expect = 3.940e-51
Identity = 110/303 (36.30%), Postives = 164/303 (54.13%), Query Frame = 3
Query:  432 FIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---------------FAVDETNDWNENDILASMAFPLLKAQCDSETDADQLAL-SEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            F+F++ P+  + +   I  C+RL +EFM++ I  +ALRK F+S+KG Y + E+ G  + W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK               +A+D  +   +   L++    ++    + E + D+     E    +++    +E QEK    + LF   K FLNRE+PRE   F++R  G  EVSWD ++  GAT+ V D+ I + ++DRP +  S  I R YVQPQ+V DS+NA  LLPV +Y  G++L PHLSPF    +G YVPPE
Sbjct:    3 FLFSTFPRTGKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIVWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKELEAQEK---HKKLFEGLKFFLNREVPREALAFIIRSFGG-EVSWDKSLCIGATYDVTDSRITHQIVDRPGQQTSV-IGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPE 299          
BLAST of pescadillo-1 vs. Ensembl Celegans
Match: lpd-7 (Pescadillo homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95Y89])

HSP 1 Score: 251.521 bits (641), Expect = 2.014e-76
Identity = 164/433 (37.88%), Postives = 232/433 (53.58%), Query Frame = 3
Query:   18 RKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAP----LQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFA----VDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            R ++K   G AV Y SRKQAL+ LQ+ L +F RLC+ K IYP EP + K A KG T  K++Y RKDI  L  EPI+ K R+ + F  +L   K +K++DK+ +L ++KP Y+L  IVKE +P+   AL  +DD L   F FA LP         I  C++L  EFM++ I  Q+LR  F+S+KG Y + E+ G  + WV P    L HV        D+ +L   VEF   +L  +   LY + GL YPP+       DE       + + S+A PL K + D E   D   L    +  D   A+ +K  +  +I+++F+    +LNRE P+E   F++R  G             A    D   I +HV+DRP++     +NR YVQPQ+V D +NA R LP + Y+PG+ L PH SPF     G Y+P E
Sbjct:    4 RFKQKYTAGAAVAYMSRKQALKKLQLTLKDFRRLCIIKGIYPHEPAHKKQANKGSTANKVFYYRKDINFLAHEPIINKFRDYKVFLRKLNHLKAKKEEDKLKKLYENKPVYSLDTIVKERFPTFGSALRDMDDALSLCFTFAMLPHTRVLKEGMIDSCRKLTAEFMHYVIESQSLRNTFISIKGIYYQAEVHGEKITWVVPHERGLPHVT-----DVDFTVLVTFVEFYIAMLGFVNFKLYQDIGLFYPPQIGQVVKTDEMETEEYKEKVYSLAKPLAKRK-DVEQAEDDEPLDLLGEDSD---ALAQKVREAKSIKTMFKGCVFYLNRECPKEALTFIIRNGGGIVGWEGGPTDLKA----DSKNISHHVVDRPMD--KLEVNRLYVQPQWVFDCLNARRKLPTERYMPGVALPPHFSPFTSEKAGDYIPFE 421          
BLAST of pescadillo-1 vs. Ensembl Fly
Match: CG4364 (gene:FBgn0032138 transcript:FBtr0079848)

HSP 1 Score: 282.337 bits (721), Expect = 6.346e-87
Identity = 166/448 (37.05%), Postives = 248/448 (55.36%), Query Frame = 3
Query:   18 RKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSP------DYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAVDETNDWNE---------NDILASMAFPLLKA----QCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTK-GYVPPEYRYL 1301
            R+ +K + GEA QY SR+ ALR LQ+ L +F RLC+ K +YP EP + + A KG +  K+ Y  KDI+ LL E IV  LR+ + F+ +  R +  KD   + R     P   L HIVKE YP+  DAL  LDDCL  +F+F++ P +          C+RL +EF+++ I  ++LRK F+S+KGYY + EI G  V W+ P  +     P  P      D+++++  VEF  ++L      L+    L YPP+F      D  E         +D +A++ F LL+     + + E D D   L +  D    +    E QE +S +++LF+  K F+NRE+PRE    L+R  G  +VSWD ++  G+T+   D TI + ++DRP  + + +I+R Y+QPQ+V D +N  +LLP   Y  G  L PHLSPF D  +  Y+PPE + L
Sbjct:    2 RRPKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYPREPKHRRRAQKGSSEIKVLYHTKDIRFLLHESIVWTLRDYKIFAKKSNRDRAIKDFRNLKRRLALFPEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSLHLIPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQAEIKGQKVTWIVPHYY-----PFKPQSRQEVDFKVMSIFVEFYTIMLGFTNFRLFHGLNLAYPPQFPSSVLQDSEESLKDEASFVSDRIAALNFELLRTDKVQEDEEELDIDMELLEQDGDSKRIIKMKQEAQE-VSRLRTLFKGLKFFINREVPREPLVILIRSFGG-KVSWDSSIFAGSTYDEGDETITHQIVDRP-SITTQYISRDYIQPQWVFDCVNQRQLLPTNKYFIGETLPPHLSPFVDSKRDSYIPPEEKAL 441          
BLAST of pescadillo-1 vs. Ensembl Zebrafish
Match: pes (pescadillo [Source:NCBI gene;Acc:30228])

HSP 1 Score: 300.827 bits (769), Expect = 2.519e-94
Identity = 173/442 (39.14%), Postives = 255/442 (57.69%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK------------FAVD---ETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQ-SLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K + G A  Y +R +A + L + L +F RLC+ K IYP EP + K   KG T  + YY  KDI+ LL EPIV K RE + F  +L++A  + +   V RL+++KP Y L HI+KE YP+  DAL  +DD L   F+F++  +  + +   I  C+RL +E+MN+ I+ ++LRK F+S+KG Y + E+ G ++ W+ P Q  A + P   DYR++A   E    LL  +   LY    L+YPPK            F  D   E+  + E   L++++  L +     E +  +L        D E   V EK E+  + Q  LF   K FLNRE+PRE   F++RC G  EVSWD ++  G+T+   D TI +H++DRP  +   +INR+Y+QPQ+V DS+NA   LPV++Y  G+ L PHLSPF + T+G YVPPE
Sbjct:    3 GLQKKKYESGSATNYITRNKARKKLSLSLADFRRLCILKGIYPHEPKHKKKVNKGSTAARTYYLLKDIRFLLHEPIVGKFREYKIFVRKLRKAYGKAEWSAVERLKENKPGYKLDHIIKERYPTFIDALRDVDDALSMCFLFSTFARTGKCHVQTIQLCRRLSVEWMNYIISSRSLRKVFLSIKGIYYQAEVLGQTITWIVPYQ-FAHNHPTDVDYRVMATFTELYTTLLGFVNFRLYQTLNLVYPPKLDGQGEISLKAEFEEDYALESESYTEK--LSALSASLARMVASVEEEEAELDHFPTEGEDQEKMEVREKMEQQQSKQKKLFEGLKFFLNREVPRESLAFVIRCFGG-EVSWDKSLCIGSTYEATDETITHHIVDRP-SMDKQYINRYYIQPQWVYDSVNAKIQLPVEEYFLGVTLPPHLSPFVEETEGDYVPPE 439          
BLAST of pescadillo-1 vs. Ensembl Xenopus
Match: pes1 (pescadillo ribosomal biogenesis factor 1 [Source:NCBI gene;Acc:395049])

HSP 1 Score: 300.827 bits (769), Expect = 1.776e-94
Identity = 167/419 (39.86%), Postives = 249/419 (59.43%), Query Frame = 3
Query:   36 KKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T P+ +Y  KDIK LL EPIV K RE + F  +L++A  +++ D V R+R +KP Y L HI+KE YP+  DA+  LDD L   F+F++ P+  + +   I  C+RL +EF+N+ I  ++LRK F+S+KG Y + +I G +V W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK  V+  +      + AS++  +     +     +  A  E    ++E    ++++EK    +S+F   K FLNRE+PR+   F++R  G  EVSWD +V  GAT+   + +I +H++DRP  + +  INR+Y+QPQ+V D +NA  LLPV+DY PG+ L PHLSPF    +G Y+PPE
Sbjct:   14 ERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRKAYGKREWDAVDRIRDNKPAYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLSVEFLNYVIASRSLRKVFLSIKGIYYQADILGQTVTWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQTLNLQYPPK--VEPASYIKLAALSASLSRVIPSEPEEENEVDEFPADPENAGQEEEQKKQLQEEEK---HKSMFVGLKFFLNREVPRDALAFIIRSFGG-EVSWDASVCIGATYNSANPSITHHIVDRP-SIQTQIINRYYLQPQWVFDCVNARMLLPVEDYFPGVLLPPHLSPFVQEKEGDYIPPE 424          
BLAST of pescadillo-1 vs. Ensembl Xenopus
Match: pes1 (pescadillo ribosomal biogenesis factor 1 [Source:NCBI gene;Acc:395049])

HSP 1 Score: 300.442 bits (768), Expect = 3.554e-94
Identity = 172/443 (38.83%), Postives = 261/443 (58.92%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---FAVDETNDWNEN----------DILASMAFPLLKAQCDSETDADQL----ALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T P+ +Y  KDIK LL EPIV K RE + F  +L++A  +++ D V R+R +KP Y L HI+KE YP+  DA+  LDD L   F+F++ P+  + +   I  C+RL +EF+N+ I  ++LRK F+S+KG Y + +I G +V W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK   F+  +    NE+          + LA+++  L +       + +++    A  E    ++E    ++++EK    +S+F   K FLNRE+PR+   F++R  G  EVSWD +V  GAT+   + +I +H++DRP  + +  INR+Y+QPQ+V D +NA  LLPV+DY PG+ L PHLSPF    +G Y+PPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRKAYGKREWDAVDRIRDNKPAYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLSVEFLNYVIASRSLRKVFLSIKGIYYQADILGQTVTWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQTLNLQYPPKLDYFSEADLKSDNEDKYALETEAYMEKLAALSASLSRVIPSEPEEENEVDEFPADPENAGQEEEQKKQLQEEEK---HKSMFVGLKFFLNREVPRDALAFIIRSFGG-EVSWDASVCIGATYNSANPSITHHIVDRP-SIQTQIINRYYLQPQWVFDCVNARMLLPVEDYFPGVLLPPHLSPFVQEKEGDYIPPE 439          
BLAST of pescadillo-1 vs. Ensembl Xenopus
Match: pes1 (pescadillo ribosomal biogenesis factor 1 [Source:NCBI gene;Acc:395049])

HSP 1 Score: 298.901 bits (764), Expect = 6.245e-94
Identity = 167/419 (39.86%), Postives = 249/419 (59.43%), Query Frame = 3
Query:   36 KKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T P+ +Y  KDIK LL EPIV K RE + F  +L++A  +++ D V R+R +KP Y L HI+KE YP+  DA+  LDD L   F+F++ P+  + +   I  C+RL +EF+N+ I  ++LRK F+S+KG Y + +I G +V W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK  V+  +      + AS++  +     +     +  A  E    ++E    ++++EK    +S+F   K FLNRE+PR+   F++R  G  EVSWD +V  GAT+   + +I +H++DRP  + +  INR+Y+QPQ+V D +NA  LLPV+DY PG+ L PHLSPF    +G Y+PPE
Sbjct:   14 ERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRKAYGKREWDAVDRIRDNKPAYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLSVEFLNYVIASRSLRKVFLSIKGIYYQADILGQTVTWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQTLNLQYPPK--VEPASYIKLAALSASLSRVIPSEPEEENEVDEFPADPENAGQEEEQKKQLQEEEK---HKSMFVGLKFFLNREVPRDALAFIIRSFGG-EVSWDASVCIGATYNSANPSITHHIVDRP-SIQTQIINRYYLQPQWVFDCVNARMLLPVEDYFPGVLLPPHLSPFVQEKEGDYIPPE 424          
BLAST of pescadillo-1 vs. Ensembl Xenopus
Match: pes1 (pescadillo ribosomal biogenesis factor 1 [Source:NCBI gene;Acc:395049])

HSP 1 Score: 298.13 bits (762), Expect = 4.132e-93
Identity = 170/436 (38.99%), Postives = 256/436 (58.72%), Query Frame = 3
Query:   36 KKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---FAVDETNDWNEN----------DILASMAFPLLKAQCDSETDADQL----ALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T P+ +Y  KDIK LL EPIV K RE + F  +L++A  +++ D V R+R +KP Y L HI+KE YP+  DA+  LDD L   F+F++ P+  + +   I  C+RL +EF+N+ I  ++LRK F+S+KG Y + +I G +V W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK   F+  +    NE+          + LA+++  L +       + +++    A  E    ++E    ++++EK    +S+F   K FLNRE+PR+   F++R  G  EVSWD +V  GAT+   + +I +H++DRP  + +  INR+Y+QPQ+V D +NA  LLPV+DY PG+ L PHLSPF    +G Y+PPE
Sbjct:   14 ERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRKAYGKREWDAVDRIRDNKPAYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLSVEFLNYVIASRSLRKVFLSIKGIYYQADILGQTVTWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQTLNLQYPPKLDYFSEADLKSDNEDKYALETEAYMEKLAALSASLSRVIPSEPEEENEVDEFPADPENAGQEEEQKKQLQEEEK---HKSMFVGLKFFLNREVPRDALAFIIRSFGG-EVSWDASVCIGATYNSANPSITHHIVDRP-SIQTQIINRYYLQPQWVFDCVNARMLLPVEDYFPGVLLPPHLSPFVQEKEGDYIPPE 443          
BLAST of pescadillo-1 vs. Ensembl Mouse
Match: Pes1 (pescadillo ribosomal biogenesis factor 1 [Source:MGI Symbol;Acc:MGI:1890613])

HSP 1 Score: 303.908 bits (777), Expect = 1.613e-95
Identity = 180/446 (40.36%), Postives = 257/446 (57.62%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---------------FAVDETNDWNENDIL-ASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQS----LFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T  + +Y  KDIK LL EPIV K RE + F  +L++A  + + + V RL+ +KP Y L HIVKE YP+  DAL  LDD L   F+F++ P+  + +   I  C+RL +EF+++ IT +ALRK F+S+KG Y + E+ G  + W+AP    +   P   DYR++A   EF   LL  +   LY    L YPPK               +A+D  +   +   L AS+A  ++ A  ++E D       EF   D E+TA  E ++K    Q     LF   K FLNRE+PRE   F++R  G  +VSWD ++  GAT+ V D+ I + ++DRP +     I R+YVQPQ+V D +NA  LLPV +Y PGM+L PHLSPF    +G Y+PPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYLIKDIKFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNAVERLKDNKPCYKLDHIVKERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFLHYVITARALRKVFLSIKGIYYQAEVLGQPIVWIAPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQSLNLHYPPKLEGQAQAETKISEDTYALDSESSMEKLAALSASLARVVVPAIEEAEAD-------EF-PTDGEVTAQEEDRKKELEAQEKHKKLFEGLKFFLNREVPREALAFIIRSFGG-DVSWDKSLCIGATYDVTDSCITHQIVDRPGQQTPI-IGRYYVQPQWVFDCVNARLLLPVAEYFPGMQLPPHLSPFVSEKEGDYIPPE 437          
BLAST of pescadillo-1 vs. Ensembl Mouse
Match: Pes1 (pescadillo ribosomal biogenesis factor 1 [Source:MGI Symbol;Acc:MGI:1890613])

HSP 1 Score: 298.13 bits (762), Expect = 2.853e-93
Identity = 180/450 (40.00%), Postives = 257/450 (57.11%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRK----CFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---------------FAVDETNDWNENDIL-ASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQS----LFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T  + +Y  KDIK LL EPIV K RE + F  +L++A  + + + V RL+ +KP Y L HIVKE YP+  DAL  LDD L   F+F++ P+  + +   I  C+RL +EF+++ IT +ALRK     F+S+KG Y + E+ G  + W+AP    +   P   DYR++A   EF   LL  +   LY    L YPPK               +A+D  +   +   L AS+A  ++ A  ++E D       EF   D E+TA  E ++K    Q     LF   K FLNRE+PRE   F++R  G  +VSWD ++  GAT+ V D+ I + ++DRP +     I R+YVQPQ+V D +NA  LLPV +Y PGM+L PHLSPF    +G Y+PPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYLIKDIKFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNAVERLKDNKPCYKLDHIVKERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFLHYVITARALRKLPPQVFLSIKGIYYQAEVLGQPIVWIAPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQSLNLHYPPKLEGQAQAETKISEDTYALDSESSMEKLAALSASLARVVVPAIEEAEAD-------EF-PTDGEVTAQEEDRKKELEAQEKHKKLFEGLKFFLNREVPREALAFIIRSFGG-DVSWDKSLCIGATYDVTDSCITHQIVDRPGQQTPI-IGRYYVQPQWVFDCVNARLLLPVAEYFPGMQLPPHLSPFVSEKEGDYIPPE 441          
BLAST of pescadillo-1 vs. UniProt/SwissProt
Match: sp|A7SWH1|PESC_NEMVE (Pescadillo homolog OS=Nematostella vectensis OX=45351 GN=v1g194255 PE=3 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 6.573e-105
Identity = 177/450 (39.33%), Postives = 267/450 (59.33%), Query Frame = 3
Query:   12 MGRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFA--VDETNDWN-------ENDILASMAFPLLKAQCDSET-DADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPEYR-YLKGELDAEQ 1325
            MG+ ++KG++G A  Y SR QAL+ LQ+ LP+F RLC+ K IYP EP N K   KG T  K YY  KDI+ L  EP++ K RE + F  +LK+A  ++      RL  +KP YTL HIVKE YP+  DAL  LDD L  +F+F+ +P+  +   A +  C+RL +EF ++ I+ ++LRK F S+KG Y + EI G ++ W+ P Q      P   D+R++   V+F   ++  +   LY    + YPP  A   D+  D N       E+++LA++   L   Q   E  + D+  +    +  + + A  E++ K+  +++LF + K+FL+RE+PRE   F++R  G  +VSWD + A GATF   D +I + ++DRP +     ++R+Y+QPQ+V DSIN G+LLPV++Y PG +L PHLSPF    +G YVPPE +  +  E+D  Q
Sbjct:    1 MGKLKKKGERGAATNYVSRNQALKKLQLSLPDFRRLCILKGIYPVEPKNKKKVNKGSTANKTYYYVKDIQWLAHEPVLNKFREFKVFLRKLKKAIAKEQPGTADRLEDNKPVYTLDHIVKERYPTFIDALRDLDDALSMLFLFSIMPQTDKIQAAVVQDCRRLSVEFQHYIISSRSLRKVFFSIKGIYFQAEIQGQTITWITPYQ-FCQDPPTDVDFRVMLTFVDFYKTMMGFINFKLYNNLNMHYPPVLADKTDKKLDTNYCKDTEVEDEVLAALNHTLKIIQTQEEDLEVDEFPIDPNSEDAEAIQAQKEEETKLERLKNLFSECKVFLSREVPRETLVFMIRSFGG-QVSWDVSTAIGATFAETDESITHQIVDRPSQ-GHQFLSRYYIQPQWVADSINQGKLLPVEEYFPGEELPPHLSPFVKEEEGDYVPPERKAIMDQEMDTNQ 447          
BLAST of pescadillo-1 vs. UniProt/SwissProt
Match: sp|B5X171|PESC_SALSA (Pescadillo homolog OS=Salmo salar OX=8030 GN=pes1 PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 3.164e-98
Identity = 176/440 (40.00%), Postives = 252/440 (57.27%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKF---AVDETNDWNENDI----------LASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQS-LFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ L +F RLC+ K IYP EP + K   KG T P+ +Y  KDI+ LL EPIV K RE + F  +L++A  + +   V RLR +KP Y L HI+KE YP+  DAL  +DD L   F+F++  +  + +   I  C+RL +E+MN+ +T ++LRK F+S+KG Y + E+ G  + W+ P Q  A   P   DYR++A   E    L   +   LY    L+YPPK    A  E    +E D           L++++  L +     E + +QL      + D E     EK++K    Q  LF   K FLNRE+PRE   F+LRC GA EVSWD ++  G T+ V D TI + ++DRP ++   +INR+Y+QPQ+V DS+NA   LPV+DY  G  L PHLSPF +   G YVPPE
Sbjct:    3 GLQKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIRFLLHEPIVRKFREYKVFVRKLRKAYGKAEWTGVERLRDNKPGYKLDHIIKERYPTFIDALRDIDDALSMCFLFSTFARTGKCHVQTITLCRRLTVEWMNYVVTSRSLRKVFLSIKGIYYQAEVLGQLITWLVPYQ-FAHDHPTDVDYRVMATFTEMYTTLFGFINFRLYQTLNLVYPPKLDSKAESELKAEHEEDYAMDSESYLEKLSALSASLARVVATVEEEENQLDNFPTEEEDQENMQAREKEQKEQEAQKRLFEGLKFFLNREVPRESLAFILRCFGA-EVSWDKSLCIGGTYEVTDETITHQIVDRP-DMDKQYINRYYIQPQWVFDSVNAKMRLPVEDYFLGTMLPPHLSPFVEEKDGDYVPPE 439          
BLAST of pescadillo-1 vs. UniProt/SwissProt
Match: sp|Q7ZY69|PESC_XENLA (Pescadillo homolog OS=Xenopus laevis OX=8355 GN=pes1 PE=2 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 2.294e-97
Identity = 175/443 (39.50%), Postives = 266/443 (60.05%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKF----AVDETNDWNEN---------DILASMAFPL---LKAQCDSETDADQL-ALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T P+ +Y  KDIK LL EPIV K RE + F  +L++A  +++ D V R+R +KP Y L HI+KE YP+  DA+  LDD L   F+F++ P+  + +   I  C+RL +EF+N+ I  ++LRK F+S+KG Y + +I G ++ W+ P    +   P   DYR++A   EF   LL  +  +LY    L YPPK      VD  +D  +          + LA+++  L   + ++ + +T+ D+  A  E   +++E    ++++EK    +SLF   K FLNRE+PR+   F++R  G  EVSWD +V  GAT+   D +I +H++DRP  + +  INR+Y+QPQ+V D +NA  LLPV+DY PG+ L PHLSPF    +G Y+PPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRKAYGKREWDSVDRIRDNKPSYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLSVEFLNYVIDSRSLRKVFLSIKGIYYQADILGQTLTWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFHLYQTLNLQYPPKLDSFSEVDLKSDGEDKYALETEVYMEKLAALSASLSRVIPSEPNDDTEVDEFPADPENAGLEEEQKRQLQEEEK---HKSLFVGLKFFLNREVPRDALAFIIRSFGG-EVSWDASVCIGATYNSTDPSITHHIVDRP-SIQTQIINRYYLQPQWVFDCVNARLLLPVEDYFPGVLLPPHLSPFVHEKEGDYIPPE 439          
BLAST of pescadillo-1 vs. UniProt/SwissProt
Match: sp|Q9EQ61|PESC_MOUSE (Pescadillo homolog OS=Mus musculus OX=10090 GN=Pes1 PE=1 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.129e-94
Identity = 180/446 (40.36%), Postives = 257/446 (57.62%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---------------FAVDETNDWNENDIL-ASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQS----LFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T  + +Y  KDIK LL EPIV K RE + F  +L++A  + + + V RL+ +KP Y L HIVKE YP+  DAL  LDD L   F+F++ P+  + +   I  C+RL +EF+++ IT +ALRK F+S+KG Y + E+ G  + W+AP    +   P   DYR++A   EF   LL  +   LY    L YPPK               +A+D  +   +   L AS+A  ++ A  ++E D       EF   D E+TA  E ++K    Q     LF   K FLNRE+PRE   F++R  G  +VSWD ++  GAT+ V D+ I + ++DRP +     I R+YVQPQ+V D +NA  LLPV +Y PGM+L PHLSPF    +G Y+PPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYLIKDIKFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNAVERLKDNKPCYKLDHIVKERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFLHYVITARALRKVFLSIKGIYYQAEVLGQPIVWIAPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQSLNLHYPPKLEGQAQAETKISEDTYALDSESSMEKLAALSASLARVVVPAIEEAEAD-------EF-PTDGEVTAQEEDRKKELEAQEKHKKLFEGLKFFLNREVPREALAFIIRSFGG-DVSWDKSLCIGATYDVTDSCITHQIVDRPGQQTPI-IGRYYVQPQWVFDCVNARLLLPVAEYFPGMQLPPHLSPFVSEKEGDYIPPE 437          
BLAST of pescadillo-1 vs. UniProt/SwissProt
Match: sp|Q6DEV3|PESC_XENTR (Pescadillo homolog OS=Xenopus tropicalis OX=8364 GN=pes1 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.834e-93
Identity = 172/443 (38.83%), Postives = 261/443 (58.92%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK---FAVDETNDWNEN----------DILASMAFPLLKAQCDSETDADQL----ALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T P+ +Y  KDIK LL EPIV K RE + F  +L++A  +++ D V R+R +KP Y L HI+KE YP+  DA+  LDD L   F+F++ P+  + +   I  C+RL +EF+N+ I  ++LRK F+S+KG Y + +I G +V W+ P    +   P   DYR++A   EF   LL  +   LY    L YPPK   F+  +    NE+          + LA+++  L +       + +++    A  E    ++E    ++++EK    +S+F   K FLNRE+PR+   F++R  G  EVSWD +V  GAT+   + +I +H++DRP  + +  INR+Y+QPQ+V D +NA  LLPV+DY PG+ L PHLSPF    +G Y+PPE
Sbjct:    3 GLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIKFLLHEPIVGKFREYKVFVRRLRKAYGKREWDAVDRIRDNKPAYKLDHIIKERYPTFIDAVRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLSVEFLNYVIASRSLRKVFLSIKGIYYQADILGQTVTWITPYA-FSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQTLNLQYPPKLDYFSEADLKSDNEDKYALETEAYMEKLAALSASLSRVIPSEPEEENEVDEFPADPENAGQEEEQKKQLQEEEK---HKSMFVGLKFFLNREVPRDALAFIIRSFGG-EVSWDASVCIGATYNSANPSITHHIVDRP-SIQTQIINRYYLQPQWVFDCVNARMLLPVEDYFPGVLLPPHLSPFVQEKEGDYIPPE 439          
BLAST of pescadillo-1 vs. TrEMBL
Match: I1ZIF5 (Pescadillo-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 409/410 (99.76%), Postives = 410/410 (100.00%), Query Frame = 3
Query:  456 MTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKGYVPPEYRYLKGELDAEQLYADVDSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPVKATKKPARINRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVNKKRMS 1685
            MTQFNGAHIMKCKRLKLEFMN+CITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVLLESLLLNLYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKGYVPPEYRYLKGELDAEQLYADVDSEQDGDEEAVEEIDEEESELDDESDEEEEDCLYEEDEMEVEQQPVKATKKPARINRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVNKKRMS
Sbjct:    1 MTQFNGAHIMKCKRLKLEFMNYCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVLLESLLLNLYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKGYVPPEYRYLKGELDAEQLYADVDSEQDGDEEAVEEIDEEESELDDESDEEEEDCLYEEDEMEVEQQPVKATKKPARINRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVNKKRMS 410          
BLAST of pescadillo-1 vs. TrEMBL
Match: A0A074Z6E9 (Pescadillo homolog OS=Opisthorchis viverrini OX=6198 GN=T265_14797 PE=3 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.016e-138
Identity = 239/595 (40.17%), Postives = 351/595 (58.99%), Query Frame = 3
Query:   42 GEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAV----DETNDW---NEN--DILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFA-------------------------------DYTKGYVPPEYRYLKGELDAEQLYA---DVDSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPVKATK---KPARI---NRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVNKKR 1679
            G    + S+KQA+R LQ+ LPNF RLC+ K +YP EP+N K  GKG+++P+++Y  KDI  L  EP++EK R +R + ++LK+A+ER+DKDK +R+R +KPRYTLHH+VKE YP+ +DAL+ L D L  +F+FA LP++TQF+ + I   +RL +EF+NF +  +A+RK F+S+KG+Y++ +I G  V WV P   V  + P   DYR+LAN +EFD  L+ SLL +LY + GL+YPPK +V    D T+ +   NEN  ++L+ +++P+ + +  +  D     LSE + +DD++   V KQ ++  I+ LF  K+IFL RE+PRE  C ++R CG  E SWD  V   +TF  +D +I Y V+DRP  ++   + R+YVQPQ+V DS+NAGRLLP +DYLPG  L PHLSPFA                               D    Y PPE  YL G +   +L         E +   +  +   ++     D +D        +E      ++P K  +    P R+      + KEQ EA  E KLRE+ LP+K RN Y KM H+ K+ +  V NL  KR+A++ +R
Sbjct:   11 GLVAAFLSQKQAMRRLQLSLPNFRRLCILKGVYPVEPSNRKKVGKGNSQPRVFYHSKDIAFLAHEPLIEKFRRLRVYQLKLKKARERRDKDKEFRIRVNKPRYTLHHVVKERYPTCQDALNDLSDSLNLIFLFARLPRLTQFSPSLIALSRRLCVEFLNFVVATRAIRKAFISIKGFYIQADISGTLVVWVIPHSSVTHT-PSDVDYRILANCLEFDTTLVGSLLCHLYRQHGLLYPPKLSVHVDPDPTSYYCGQNENYFELLSCLSYPIRRTEDVAGEDVHSEGLSELQAIDDQVAKAVNKQLEVQRIRKLFDGKRIFLMREVPREVICLIVRSCGG-ECSWDKTVGPASTFTEEDPSIDYQVVDRP--MSEMKVTRYYVQPQWVFDSLNAGRLLPAQDYLPGSSLPPHLSPFAAGSGLTEILGEIGEGSVSQRGGLVGVAPGFGDGASLYRPPEADYLAGLVSLAKLRGPTIQASMEPNATVDEHQMELDDVHSALDNTDNSFGSHKKKEKANSKLRKPAKGEEPIVTPGRLESKESKRMKEQAEANAERKLREMLLPKKHRNAYKKMVHSIKRREKEVRNLTDKRRAIDSRR 601          
BLAST of pescadillo-1 vs. TrEMBL
Match: A0A4S2KPY2 (Pescadillo homolog OS=Opisthorchis felineus OX=147828 GN=CRM22_010735 PE=3 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.251e-137
Identity = 239/595 (40.17%), Postives = 351/595 (58.99%), Query Frame = 3
Query:   42 GEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAV----DETNDW---NEN--DILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFA-------------------------------DYTKGYVPPEYRYLKGELDAEQLYA---DVDSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPVKATK---KPARI---NRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVNKKR 1679
            G    + S+KQA+R LQ+ LPNF RLC+ K +YP EP+N K AGKG+++P+++Y  KDI  L  EP++EK R +R + ++LK+A+ER+DKDK +R+R +KPRYTLHH+VKE YP+ +DAL+ L D L  +F+FA LP++TQF+ + I   +RL +EF+NF +  +A+RK F+S+KG+Y++ +I G  V WV P   V  + P   DYR+LAN +EFD  L+ SLL +LY + GL+YPPK +V    D T+ +   NEN  ++L+ +++P+ + +  +  D     LSE + +DD++   V KQ ++  I+ LF  K+IFL RE+PRE  C ++R CG  E SWD  V   +TF  +D +I Y V+DRP  ++   + R+YVQPQ+V DS+NAGRLLP +DYLPG  L PHLSPFA                               D    Y PPE  YL G +   +L         E +G  +  +    +     D +D   +    +       ++P K  +    P R+      + KEQ +A  E KLRE+ LP+K RN Y KM H+ K+ +  V NL  KR+A++  R
Sbjct:   11 GLVAAFLSQKQAMRRLQLSLPNFRRLCILKGVYPVEPSNRKKAGKGNSQPRVFYHSKDIAFLAHEPLIEKFRRLRVYQLKLKKARERRDKDKEFRIRVNKPRYTLHHVVKERYPTSQDALNDLSDSLNLIFLFARLPRLTQFSPSLIALSRRLCVEFLNFIVATRAIRKAFISIKGFYMQADISGTLVVWVVPHSSVTHT-PSDVDYRILANCLEFDTTLVGSLLCHLYRQHGLLYPPKLSVHVDPDPTSYYCGQNENYFELLSCLSYPIRRTEDVAGEDVHSEGLSELQAIDDQVAKAVNKQLEVQRIRKLFDGKRIFLMREVPREVICLIVRSCGG-ECSWDKTVGPASTFTEEDPSIDYQVVDRP--MSEMKVTRYYVQPQWVFDSLNAGRLLPAQDYLPGSSLPPHLSPFAAGSGLTEILGEIGEGSVSQRGGLVGVAPGFGDGASLYRPPEADYLAGLVSLAKLRGPTVQASMEPNGPIDERQMEVGDVHSALDNTDNSFDGYKKKGKTNSKLRKPAKGEEPIVTPGRLESKESKRMKEQSDANAERKLREMLLPKKHRNAYKKMVHSIKRREKEVRNLTDKRRAIDSWR 601          
BLAST of pescadillo-1 vs. TrEMBL
Match: A0A419PWB4 (Pescadillo homolog OS=Clonorchis sinensis OX=79923 GN=pes1 PE=3 SV=1)

HSP 1 Score: 421.394 bits (1082), Expect = 2.902e-137
Identity = 238/592 (40.20%), Postives = 350/592 (59.12%), Query Frame = 3
Query:   42 GEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAV----DETNDW---NEN--DILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFA-------------------------------DYTKGYVPPEYRYLKGELDAEQLYA---DVDSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPVKATK---KPARI---NRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVN 1670
            G    + S+KQA+R LQ+ LPNF RLC+ K +YP EP+N K AGKG+++P+++Y  KDI  L  EP++EK R +R + ++LK+A+ER+DKDK +R+R +KPRYTLHH+VKE YP+ +DAL+ L D L  +F+FA LP++TQF+ + I   +RL +EF+NF +  +A+RK F+S+KG+Y++ +I G  V WV P   V  + P   DYR+LAN +EFD  L+ SLL +LY + GL+YPPK +V    D T+ +   NEN  ++L+ +++P+ + +     D     LSE + +DD++   V KQ ++  I+ LF  K+IFL RE+PRE  C ++R CG  E SWD  V   +TF  +D +I Y ++DRP  ++   + R+YVQPQ+V DS+NAGRLLP +DYLPG  L PHLSPFA                               D    Y PPE  YL G +   +L         E +G  +  +   E+     D +D   +    +       ++P K  +    P R+      + KEQ +A  E KLRE+ LP+K RN Y KM H+ K+ +  V NL  KR+A++
Sbjct:   32 GLVAAFLSQKQAMRRLQLSLPNFRRLCILKGVYPVEPSNRKKAGKGNSQPRVFYHSKDIAFLAHEPLIEKFRRLRVYQLKLKKARERRDKDKEFRIRVNKPRYTLHHVVKERYPTSQDALNDLSDSLNLIFLFARLPRLTQFSPSLIALSRRLCVEFLNFVVATRAIRKAFISIKGFYMQADISGTLVVWVIPHSSVTHT-PSDVDYRILANCLEFDTTLVGSLLCHLYRQHGLLYPPKLSVHVDPDPTSYYCGQNENYFELLSCLSYPIRRTEDVPGEDVHSEGLSELQAIDDQVAKAVNKQLEVQRIRKLFDGKRIFLMREVPREVICLIVRSCGG-ECSWDKTVGPASTFTEEDPSIDYQIVDRP--MSEMKVTRYYVQPQWVFDSLNAGRLLPAQDYLPGSSLPPHLSPFAAGSGLTEILGEISEGSVSQRGGLIGVAPGFGDGASLYRPPEADYLAGLVSLAKLRGPTVQASMEPNGPVDEHQMELEDVHSALDNTDNSFDSLKKKGKANSKLRKPAKGEEPIVTPGRLESKESKRMKEQADANAERKLREMLLPKKHRNAYKKMVHSIKRREKEVRNLTDKRRAID 619          
BLAST of pescadillo-1 vs. TrEMBL
Match: A0A5J4NUQ3 (Pescadillo homolog OS=Paragonimus westermani OX=34504 GN=DEA37_0012486 PE=3 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.779e-136
Identity = 244/613 (39.80%), Postives = 368/613 (60.03%), Query Frame = 3
Query:   12 MGRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPK----FAVDETNDW-NEND----ILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFA----------------------------DYTKG---YVPPEYRYLKG-----EL--DAEQLYADVDSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPVKATKKPAR-----INRGK--------YKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVN 1670
            M + ++K +KG    + ++KQA+R LQ+ LPNF RLC+ K +YP EP+N K  GKG+++P+++Y  KDI  L  EP+++K R++R + ++LK+++ERKD+DK +R+R +KPRYTLHHIVKE YP+R+DAL+ L D L  VF+F+ LP++TQFN A I  C+RL +EF+N  +  QA+RK F+S+KG+Y++VE+ G +V W+ P        P   DYR+LA  +EFD  L+ S+L +LY  +GL+YPPK    F  D T+ +  +ND    +L+ +++P+ + +     +     LSE + +DD+++  V KQ ++  +++LFR K++FL RE+PRE  C ++R CG  E SWD  V  G+TF  +D +I + V+DRP  +++  + R+YVQPQ+V DS+NAGRLLP +DYLPG  L PHLSPFA                             + +G   Y PPE  YL G     EL   A Q  AD        E   E + + + EL +       +    +   EV+Q+     KKPA+     I  G+         +E+ EA  E KLRE+ LP+K+RN Y KM H+ K++   V  L +KR+A++
Sbjct:    1 MTKMKKKHQKGLVTAFLTQKQAMRRLQLSLPNFRRLCILKGVYPVEPSNRKKVGKGNSQPRVFYHSKDIAFLAHEPLMDKFRKLRIYQLKLKKSRERKDRDKEFRVRMNKPRYTLHHIVKERYPTRQDALNDLSDSLNLVFLFSRLPRLTQFNPALIGLCRRLCVEFLNLVVGIQAVRKAFISIKGFYVQVELDGTAVVWIIP-HSSTTHTPSDVDYRILATCLEFDTTLVGSILCHLYRVNGLLYPPKLSFHFDPDPTSYYCGQNDSYFEMLSCLSYPIKRTEEADYEETHMDNLSELQAIDDQVSEAVNKQMEVHRVRNLFRGKRVFLMREVPREVICLIIRSCGG-ECSWDKTVGPGSTFSEEDPSIDFQVVDRP--MSTMKVTRYYVQPQWVFDSLNAGRLLPAQDYLPGATLPPHLSPFAASSRRNGSLEDPLLVTVNQRGGLTGVAPGFGEGAALYRPPEADYLAGLVSLAELRGSAVQACADPYHNTKELELDDENVAKPDGELSESDQLRTMNATVGKKGGEVKQRKNSKVKKPAKGELPLITSGRPESKAAKFVQEKAEANAERKLREMLLPKKQRNAYKKMVHSIKRKDKEVRQLTEKRRAID 609          
BLAST of pescadillo-1 vs. Ensembl Cavefish
Match: pes (pescadillo [Source:NCBI gene;Acc:30228])

HSP 1 Score: 266.159 bits (679), Expect = 1.238e-81
Identity = 159/430 (36.98%), Postives = 235/430 (54.65%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDE----LTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K + G A  Y SR +A + L + L +F RLC+ K +YP EP + K   KG T  + +Y  KDI+ LL EPIV K RE + F               V +LRK+             YP+  DAL  +DD L   F+F++  +  + +   I  C+RL +E+MN+ +T ++L+K F+S+KG Y + E+ G ++ W+ P Q  A   P   DYR++A   EF   LL  +   LY    L+YPPK  V +T+  +      + A+ L             L+ S       E    + A V+ Q +    + LF   K FLNRE+PRE   F+LRC GA +VSWD ++  G+T+  +D TI +H++DRP  +   ++NR+Y+QPQ+V DS+NA  LLPV+DY  G+ L PHLSPF +  +G YVPPE
Sbjct:    3 GLQKKKYESGSATNYISRNKARKKLCLSLADFRRLCILKGVYPHEPKHKKKVNKGSTAQRTFYLLKDIRFLLHEPIVGKFREYKIF---------------VRKLRKAYGDLQ--------YPTFIDALRDVDDALSMCFLFSTFARTGKCHVQTIQLCRRLSVEWMNYIVTSRSLKKVFLSIKGIYYQAEVLGQTITWLVPYQ-FAHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQTLNLLYPPK--VRDTHTLSAPGSELTNAYLLQSLALFHWFLCLILSFSHLHPCSQEDMEKMEARVKAQHEQDKQKKLFEGLKFFLNREVPRESLAFILRCFGA-QVSWDKSLCIGSTYDAEDETITHHIVDRP-NMDKQYMNRYYIQPQWVFDSVNAKMLLPVEDYFLGVTLPPHLSPFVEEKEGDYVPPE 404          
BLAST of pescadillo-1 vs. Ensembl Sea Lamprey
Match: pes (pescadillo [Source:NCBI gene;Acc:30228])

HSP 1 Score: 125.561 bits (314), Expect = 2.262e-32
Identity = 70/145 (48.28%), Postives = 90/145 (62.07%), Query Frame = 3
Query:  864 LALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLL--RCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            L   E R++ +   A   KQ   +A+ SLF   K FLNREI RE F F++  R  G  +VSW  +V  GAT+   D TI + ++DRP     T INR YVQPQ+V D +NAG LLPV+DY PG+ L PHLSPF +  +G Y+PPE
Sbjct:   32 LVEEEDRELSERRKADAAKQ---AALCSLFEGTKFFLNREILREMFTFIIVPRSFGG-QVSWHSSVCIGATYPETDETITHQLVDRP-NPPQTFINRCYVQPQWVCDCVNAGVLLPVQDYFPGVLLPPHLSPFVEEKEGDYIPPE 171          
BLAST of pescadillo-1 vs. Ensembl Yeast
Match: NOP7 (Component of several different pre-ribosomal particles; forms a complex with Ytm1p and Erb1p that is required for maturation of the large ribosomal subunit; required for exit from G0 and the initiation of cell proliferation [Source:SGD;Acc:S000003335])

HSP 1 Score: 191.045 bits (484), Expect = 6.463e-54
Identity = 107/288 (37.15%), Postives = 169/288 (58.68%), Query Frame = 3
Query:   18 RKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKA-QCDSETDADQLALSE 878
            R ++K  +G A  + +R QA+R LQ+ L +F RLC++K IYP EP N K A KG T P  +Y  KDI+ L+ EP++ K RE + F+ +L RA  R +     RL +++  YTL HI+KE YPS  DA+  +DD L  +F+F++LP   Q +   I   +++  +++ +   ++ +RK FVS+KG Y +  I G  VRW+ P +    ++P   D+R++   +EF   LL  +L  LYT+SGLIYPPK       D  ++ I++ ++  +L++ Q DS    D   + E
Sbjct:    2 RIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKKKANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVSSAKRLEENRDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPSTNQVSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWLVPFK-FPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKL------DLKKDKIISGLSSYILESRQEDSLLKLDPTEIEE 282          

HSP 2 Score: 81.6481 bits (200), Expect = 7.498e-17
Identity = 42/117 (35.90%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  933 SAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKGYVP 1283
            S + SLF     +++RE+P +   FL+  CG   +S            +D + + + ++DRP+ L +    R Y+QPQ++ D IN G L+P   YLPG  L PHLSP+ D   GY P
Sbjct:  354 SPVASLFSAFVFYVSREVPIDILEFLILSCGGNVISEAAMDQIENKKDIDMSKVTHQIVDRPV-LKNKVAGRTYIQPQWIFDCINKGELVPANKYLPGEALPPHLSPWGDAI-GYDP 468          
BLAST of pescadillo-1 vs. Ensembl Nematostella
Match: EDO31954 (Pescadillo homolog [Source:UniProtKB/Swiss-Prot;Acc:A7SWH1])

HSP 1 Score: 328.176 bits (840), Expect = 2.694e-106
Identity = 177/450 (39.33%), Postives = 267/450 (59.33%), Query Frame = 3
Query:   12 MGRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFA--VDETNDWN-------ENDILASMAFPLLKAQCDSET-DADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPEYR-YLKGELDAEQ 1325
            MG+ ++KG++G A  Y SR QAL+ LQ+ LP+F RLC+ K IYP EP N K   KG T  K YY  KDI+ L  EP++ K RE + F  +LK+A  ++      RL  +KP YTL HIVKE YP+  DAL  LDD L  +F+F+ +P+  +   A +  C+RL +EF ++ I+ ++LRK F S+KG Y + EI G ++ W+ P Q      P   D+R++   V+F   ++  +   LY    + YPP  A   D+  D N       E+++LA++   L   Q   E  + D+  +    +  + + A  E++ K+  +++LF + K+FL+RE+PRE   F++R  G  +VSWD + A GATF   D +I + ++DRP +     ++R+Y+QPQ+V DSIN G+LLPV++Y PG +L PHLSPF    +G YVPPE +  +  E+D  Q
Sbjct:    1 MGKLKKKGERGAATNYVSRNQALKKLQLSLPDFRRLCILKGIYPVEPKNKKKVNKGSTANKTYYYVKDIQWLAHEPVLNKFREFKVFLRKLKKAIAKEQPGTADRLEDNKPVYTLDHIVKERYPTFIDALRDLDDALSMLFLFSIMPQTDKIQAAVVQDCRRLSVEFQHYIISSRSLRKVFFSIKGIYFQAEIQGQTITWITPYQ-FCQDPPTDVDFRVMLTFVDFYKTMMGFINFKLYNNLNMHYPPVLADKTDKKLDTNYCKDTEVEDEVLAALNHTLKIIQTQEEDLEVDEFPIDPNSEDAEAIQAQKEEETKLERLKNLFSECKVFLSREVPRETLVFMIRSFGG-QVSWDVSTAIGATFAETDESITHQIVDRPSQ-GHQFLSRYYIQPQWVADSINQGKLLPVEEYFPGEELPPHLSPFVKEEEGDYVPPERKAIMDQEMDTNQ 447          
BLAST of pescadillo-1 vs. Ensembl Medaka
Match: pes (pescadillo ribosomal biogenesis factor 1 [Source:NCBI gene;Acc:101158030])

HSP 1 Score: 311.612 bits (797), Expect = 1.011e-98
Identity = 174/440 (39.55%), Postives = 256/440 (58.18%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKF---AVDETNDWNENDI----------LASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQE-KISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T P+ +Y  KDI+ LL EPIV K RE + F  +L++A  + +   V RL+++KP Y L HI+KE YPS  DAL  +DD L   F+F++  +  + +   I  C+RL +E+MN+ I  ++LRK FVS+KG Y + E+ G  + W+ P Q  +   P   DYR++A   E    LL  +   LY    L+YPPK    A  E    NE++           LA+++  L +    +E +  QL      + D E     EK++ ++   + +F   K FLNRE+PRE   F++RC G  EVSWD +V  G+T+   D TI + ++DRP  +  ++INR+Y+QPQ+V D +NA  LLPV+DY  G+ L PHLSPF +   G YVPPE
Sbjct:    3 GTQKKKFERGSATNYITRNRARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIRFLLHEPIVAKFREYKIFVRKLRKAYGKTEWSAVERLKENKPTYKLDHIIKERYPSFIDALRDIDDALCMCFLFSTFARTGKCHVQTIQLCRRLTVEWMNYVIASRSLRKVFVSIKGMYYQAEVMGQLITWLVPYQ-FSHDHPTDVDYRVMATFTELYTTLLGFVNFRLYHSLNLVYPPKLDIKAESELKGENEDEYAMDSESYPEKLAALSASLARVVSTAEEEDAQLDAFPTEEEDLEKVEAREKEQMQLETQKKIFEGLKFFLNREVPRESLAFVIRCFGG-EVSWDRSVCIGSTYDATDETITHQIVDRP-NVDKSYINRYYIQPQWVYDCVNAKVLLPVEDYFLGVTLPPHLSPFVEEKDGDYVPPE 439          
BLAST of pescadillo-1 vs. Ensembl Medaka
Match: pes (pescadillo ribosomal biogenesis factor 1 [Source:NCBI gene;Acc:101158030])

HSP 1 Score: 310.842 bits (795), Expect = 4.475e-98
Identity = 175/440 (39.77%), Postives = 255/440 (57.95%), Query Frame = 3
Query:   15 GRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKF---AVDETNDWNENDI----------LASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEK-QEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKG-YVPPE 1289
            G +++K ++G A  Y +R +A + LQ+ LP+F RLC+ K IYP EP + K   KG T P+ +Y  KDI+ LL EPIV K RE + F  +L++A  + +   V RL+++KP Y L HI+KE YPS  DAL  +DD L   F+F++  +  + +   I  C+RL +E+MN+ I  ++LRK FVS+KG Y + E+ G  + W+ P Q  +   P   DYR++A   E    LL  +   LY    L+YPPK    A  E    NE++           LA+++  L +    +E +  QL      + D E     EK Q ++   + +F   K FLNRE+PRE   F++RC G  EVSWD +V  G+T+   D TI + ++DRP  +  ++INR+Y+QPQ+V D +NA  LLPV+DY  G+ L PHLSPF +   G YVPPE
Sbjct:    3 GTQKKKFERGSATNYITRNRARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTAPRTFYLLKDIRFLLHEPIVAKFREYKIFVRKLRKAYGKTEWSAVERLKENKPTYKLDHIIKERYPSFIDALRDIDDALCMCFLFSTFARTGKCHVQTIQLCRRLTVEWMNYVIASRSLRKVFVSIKGMYYQAEVMGQLITWLVPYQ-FSHDHPTDVDYRVMATFTELYTTLLGFVNFRLYHSLNLVYPPKLDIKAESELKGENEDEYAMDSESYPEKLAALSASLARVVSTAEEEDAQLDAFPTEEEDLEKVEAREKEQMQLETQKKIFEGLKFFLNREVPRESLAFVIRCFGG-EVSWDRSVCIGSTYDATDETITHQIVDRP-NVDKSYINRYYIQPQWVYDCVNAKVLLPVEDYFLGVTLPPHLSPFVEEKDGDYVPPE 439          
BLAST of pescadillo-1 vs. Planmine SMEST
Match: SMESG000032689.1 (SMESG000032689.1)

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 548/567 (96.65%), Postives = 553/567 (97.53%), Query Frame = 3
Query:   12 MGRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVXXXXXXXXXYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKGYVPPEYRYLKGELDAEQLYADVDSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXXXXQQPVKATKKPARINRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVNKKRMS 1685
            MGRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMN+CITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVLLESLLLNLYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKGYVPPEYRYLKGELDAEQLYADVDSEQDGDEEAVEEIDEEESELDDE D+E ++   EE+         EMEVEQQPVKATKKPARINRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVNKKRMS
Sbjct:    1 MGRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEPNNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKERKDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLPKMTQFNGAHIMKCKRLKLEFMNYCITKQALRKCFVSVKGYYLEVEICGISVRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVLLESLLLNLYTESGLIYPPKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDELTAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWAVATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLLPVKDYLPGMKLIPHLSPFADYTKGYVPPEYRYLKGELDAEQLYADVDSEQDGDEEAVEEIDEEESELDDELDDESDEEEEEEEEEDCLYEEDEMEVEQQPVKATKKPARINRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQKRKAVNKKRMS 567          
The following BLAST results are available for this feature:
BLAST of pescadillo-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PES15.598e-9239.00pescadillo ribosomal biogenesis factor 1 [Source:H... [more]
PES18.570e-9238.46pescadillo ribosomal biogenesis factor 1 [Source:H... [more]
PES16.027e-8638.01pescadillo ribosomal biogenesis factor 1 [Source:H... [more]
PES13.940e-5136.30pescadillo ribosomal biogenesis factor 1 [Source:H... [more]
PES13.940e-5136.30pescadillo ribosomal biogenesis factor 1 [Source:H... [more]
back to top
BLAST of pescadillo-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lpd-72.014e-7637.88Pescadillo homolog [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of pescadillo-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG43646.346e-8737.05gene:FBgn0032138 transcript:FBtr0079848[more]
back to top
BLAST of pescadillo-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pes2.519e-9439.14pescadillo [Source:NCBI gene;Acc:30228][more]
back to top
BLAST of pescadillo-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pes11.776e-9439.86pescadillo ribosomal biogenesis factor 1 [Source:N... [more]
pes13.554e-9438.83pescadillo ribosomal biogenesis factor 1 [Source:N... [more]
pes16.245e-9439.86pescadillo ribosomal biogenesis factor 1 [Source:N... [more]
pes14.132e-9338.99pescadillo ribosomal biogenesis factor 1 [Source:N... [more]
back to top
BLAST of pescadillo-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pes11.613e-9540.36pescadillo ribosomal biogenesis factor 1 [Source:M... [more]
Pes12.853e-9340.00pescadillo ribosomal biogenesis factor 1 [Source:M... [more]
back to top
BLAST of pescadillo-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7SWH1|PESC_NEMVE6.573e-10539.33Pescadillo homolog OS=Nematostella vectensis OX=45... [more]
sp|B5X171|PESC_SALSA3.164e-9840.00Pescadillo homolog OS=Salmo salar OX=8030 GN=pes1 ... [more]
sp|Q7ZY69|PESC_XENLA2.294e-9739.50Pescadillo homolog OS=Xenopus laevis OX=8355 GN=pe... [more]
sp|Q9EQ61|PESC_MOUSE1.129e-9440.36Pescadillo homolog OS=Mus musculus OX=10090 GN=Pes... [more]
sp|Q6DEV3|PESC_XENTR1.834e-9338.83Pescadillo homolog OS=Xenopus tropicalis OX=8364 G... [more]
back to top
BLAST of pescadillo-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIF50.000e+099.76Pescadillo-1 OS=Schmidtea mediterranea OX=79327 PE... [more]
A0A074Z6E92.016e-13840.17Pescadillo homolog OS=Opisthorchis viverrini OX=61... [more]
A0A4S2KPY21.251e-13740.17Pescadillo homolog OS=Opisthorchis felineus OX=147... [more]
A0A419PWB42.902e-13740.20Pescadillo homolog OS=Clonorchis sinensis OX=79923... [more]
A0A5J4NUQ31.779e-13639.80Pescadillo homolog OS=Paragonimus westermani OX=34... [more]
back to top
BLAST of pescadillo-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pes1.238e-8136.98pescadillo [Source:NCBI gene;Acc:30228][more]
back to top
BLAST of pescadillo-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pes2.262e-3248.28pescadillo [Source:NCBI gene;Acc:30228][more]
back to top
BLAST of pescadillo-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NOP76.463e-5437.15Component of several different pre-ribosomal parti... [more]
back to top
BLAST of pescadillo-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319542.694e-10639.33Pescadillo homolog [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of pescadillo-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pes1.011e-9839.55pescadillo ribosomal biogenesis factor 1 [Source:N... [more]
pes4.475e-9839.77pescadillo ribosomal biogenesis factor 1 [Source:N... [more]
back to top
BLAST of pescadillo-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000032689.10.000e+096.65SMESG000032689.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022575
GenBankAFJ24809.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022575 ID=SMED30022575|Name=pescadillo-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1686bp
CTTCAAGTGCAATGGGACGAAAACAAGAAAAAGGTAAAAAGGGTGAAGCA
GTTCAATATTATTCCAGAAAGCAAGCTTTGAGATATTTACAAATTGGCCT
GCCTAATTTTATCCGCCTCTGTTTATGGAAAAGCATTTATCCATCTGAAC
CGAACAATCTCAAAGCCGCAGGCAAAGGAGATACTAGACCGAAGATTTAT
TATAAAAGAAAGGATATAAAAACACTCCTTCAGGAGCCGATTGTAGAAAA
GTTACGAGAAATTCGAGCATTTAGTATTCAATTGAAGCGCGCAAAAGAGA
GGAAAGATAAAGACAAAGTTTACCGATTGAGAAAGTCAAAGCCCAGATAC
ACTCTGCACCATATCGTAAAAGAATTATATCCCAGCAGGGAAGATGCACT
GAGCCATCTCGATGATTGTCTAAAATCGGTTTTCATTTTTGCCTCCCTGC
CGAAAATGACCCAATTTAATGGAGCTCATATCATGAAATGCAAGCGATTG
AAATTGGAATTCATGAATTTTTGCATCACCAAGCAAGCGCTCAGGAAATG
CTTCGTCAGTGTCAAGGGATATTATCTGGAGGTGGAGATCTGTGGTATCT
CGGTGCGCTGGGTGGCGCCCCTCCAGCACGTGGCCATGAGTGTGCCAGTC
AGTCCCGATTACCGCATGCTAGCCAATCAGGTGGAATTCGACTGCGTCCT
ATTGGAGAGCCTGCTACTCAACCTCTACACGGAATCCGGCCTCATTTACC
CACCGAAATTCGCTGTAGATGAGACAAATGACTGGAATGAGAATGACATT
TTGGCATCGATGGCGTTTCCGTTGTTGAAGGCGCAGTGCGACAGTGAGAC
TGATGCCGACCAATTGGCCTTGTCCGAGTTCCGGGACATGGATGACGAGC
TGACGGCTGTCGTCGAGAAGCAGGAGAAAATCTCCGCCATACAATCGCTG
TTCAGAGACAAGAAAATCTTTTTGAATCGAGAAATTCCTCGGGAATTCTT
TTGCTTCCTGTTGCGGTGCTGCGGTGCTACTGAGGTCTCGTGGGACTGGG
CGGTTGCGACGGGCGCTACATTCGGTGTCGATGACAATACGATCCAATAT
CACGTGCTCGACAGGCCTCTCGAGCTCGCCAGCACCCACATCAATCGATT
CTATGTGCAGCCGCAATTCGTGATCGACTCAATCAATGCTGGCCGCTTGC
TGCCGGTGAAGGATTACCTGCCGGGCATGAAGCTGATTCCGCATCTCTCG
CCGTTTGCTGACTACACTAAGGGCTACGTGCCACCTGAATACCGCTACTT
GAAGGGTGAGCTTGATGCTGAGCAGCTGTATGCCGATGTAGACAGTGAGC
AGGATGGTGATGAGGAGGCGGTCGAGGAGATTGATGAGGAGGAAAGTGAA
TTGGATGATGAATCGGATGAGGAGGAGGAGGATTGTCTATATGAGGAGGA
TGAGATGGAGGTCGAGCAGCAGCCAGTCAAGGCAACCAAGAAGCCAGCCA
GAATCAACAGGGGTAAATACAAGGAGCAAGTTGAAGCAAGAAAAGAAATC
AAATTGAGAGAAATCGACTTGCCAAGAAAGAGACGGAACTTGTACAATAA
GATGAAGCACGCTGAGAAGAAAGAGAAGTCGACTGTCGAGAATCTGAAGC
AGAAAAGGAAAGCAGTCAACAAAAAGAGAATGTCAT
back to top

protein sequence of SMED30022575-orf-1

>SMED30022575-orf-1 ID=SMED30022575-orf-1|Name=SMED30022575-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=561bp
SSAMGRKQEKGKKGEAVQYYSRKQALRYLQIGLPNFIRLCLWKSIYPSEP
NNLKAAGKGDTRPKIYYKRKDIKTLLQEPIVEKLREIRAFSIQLKRAKER
KDKDKVYRLRKSKPRYTLHHIVKELYPSREDALSHLDDCLKSVFIFASLP
KMTQFNGAHIMKCKRLKLEFMNFCITKQALRKCFVSVKGYYLEVEICGIS
VRWVAPLQHVAMSVPVSPDYRMLANQVEFDCVLLESLLLNLYTESGLIYP
PKFAVDETNDWNENDILASMAFPLLKAQCDSETDADQLALSEFRDMDDEL
TAVVEKQEKISAIQSLFRDKKIFLNREIPREFFCFLLRCCGATEVSWDWA
VATGATFGVDDNTIQYHVLDRPLELASTHINRFYVQPQFVIDSINAGRLL
PVKDYLPGMKLIPHLSPFADYTKGYVPPEYRYLKGELDAEQLYADVDSEQ
DGDEEAVEEIDEEESELDDESDEEEEDCLYEEDEMEVEQQPVKATKKPAR
INRGKYKEQVEARKEIKLREIDLPRKRRNLYNKMKHAEKKEKSTVENLKQ
KRKAVNKKRMS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036420BRCT_dom_sf
IPR010613PES
IPR001357BRCT_dom
Vocabulary: biological process
TermDefinition
GO:0042254ribosome biogenesis
GO:0006364rRNA processing
Vocabulary: cellular component
TermDefinition
GO:0005730nucleolus
GO:0005634nucleus
GO:0005654nucleoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 389..416
NoneNo IPR availableCOILSCoilCoilcoord: 302..340
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 297..364
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 297..343
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..419
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..409
NoneNo IPR availablePANTHERPTHR12221:SF6PESCADILLO HOMOLOGcoord: 7..417
NoneNo IPR availableCDDcd17709BRCT_pescadillo_likecoord: 165..254
e-value: 4.01554E-31
score: 112.283
IPR010613PescadilloPFAMPF06732Pescadillo_Ncoord: 7..112
e-value: 3.0E-23
score: 82.7
IPR010613PescadilloPANTHERPTHR12221PESCADILLO - RELATEDcoord: 7..417
IPR036420BRCT domain superfamilyGENE3DG3DSA:3.40.50.10190coord: 169..246
e-value: 1.2E-23
score: 85.0
IPR036420BRCT domain superfamilySUPERFAMILYSSF52113BRCT domaincoord: 164..257
IPR001357BRCT domainPROSITEPS50172BRCTcoord: 161..256
score: 8.026