START domain-containing protein

Overview
NameSTART domain-containing protein
Smed IDSMED30022574
Length (bp)1122
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of START domain-containing protein (SMED30022574) t-SNE clustered cells

Violin plots show distribution of expression levels for START domain-containing protein (SMED30022574) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of START domain-containing protein (SMED30022574) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for START domain-containing protein (SMED30022574) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022574

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022574SMESG000046413.1 SMESG000037645.1 SmedASXL_005035SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022574SMESG000046413.1 SMESG000037645.1 dd_Smed_v4_3734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022574SMESG000046413.1 SMESG000037645.1 dd_Smed_v4_3734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022574SMESG000046413.1 SMESG000037645.1 dd_Smed_v6_3734_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30022574SMESG000046413.1 SMESG000037645.1 OX_Smed_1.0.16382ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30022574SMESG000077303.1 Contig5427GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022574SMESG000046413.1 SMESG000037645.1 Contig5427GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Category 4 cellSMED30022574SMESG000046413.1 SMESG000037645.1 dd_Smed_v4_3734_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022574SMESG000046413.1 SMESG000037645.1 dd_Smed_v4_3734_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022574SMESG000046413.1 SMESG000037645.1 dd_Smed_v4_3734_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30022574SMESG000046413.1 SMESG000037645.1 dd_Smed_v4_3734_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 184.111 bits (466), Expect = 4.509e-55
Identity = 89/251 (35.46%), Postives = 145/251 (57.77%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V+ P D DF +F   C+    ++  Y++  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA + YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ V E+
Sbjct:   22 VQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVAES 271          
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 184.111 bits (466), Expect = 4.509e-55
Identity = 89/251 (35.46%), Postives = 145/251 (57.77%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V+ P D DF +F   C+    ++  Y++  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA + YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ V E+
Sbjct:   22 VQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVAES 271          
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 179.489 bits (454), Expect = 1.081e-53
Identity = 82/215 (38.14%), Postives = 129/215 (60.00%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW 742
            V+ P D DF +F   C+    ++  Y++  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA + YP WK+++ P+F PW
Sbjct:   22 VQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPW 236          
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 168.318 bits (425), Expect = 1.368e-49
Identity = 75/196 (38.27%), Postives = 120/196 (61.22%), Query Frame = 2
Query:  263 VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA + YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ V E+
Sbjct:   31 VPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVAES 225          
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 168.703 bits (426), Expect = 2.129e-49
Identity = 75/196 (38.27%), Postives = 120/196 (61.22%), Query Frame = 2
Query:  263 VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA + YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ V E+
Sbjct:   48 VPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVAES 242          
BLAST of START domain-containing protein vs. Ensembl Celegans
Match: T28D6.7 (pep chromosome:WBcel235:III:11344255:11346789:-1 gene:WBGene00012127.1 transcript:T28D6.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T28D6.7)

HSP 1 Score: 180.259 bits (456), Expect = 1.276e-53
Identity = 82/222 (36.94%), Postives = 136/222 (61.26%), Query Frame = 2
Query:   83 KHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGIL-KVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWS 745
            K   +   R  +DSD+     LC+D+E + EVY K D+++  ++   SS++M K    L  V+A V+Y+ LHD+ YR+ WDK +++   I  +  N+D+ YY++ S    + RDFV QR W  +D +  I +HSV H+ YPP K  +RA   ++GYL++   E   E+ Y++ S+P+G +P+W +N+  K V PK++ +  KA + YP WK++++P + PWS
Sbjct:   53 KLMRVNVARVWEDSDYEKVKNLCEDSEGWVEVYKKKDITICTQNIEKSSYQMIKAIAQLPDVSATVVYDVLHDSAYRAKWDKYMIKQETIGTINPNNDVCYYSLNSVSPIRPRDFVMQRSWLETDKDRLICSHSVCHEDYPPAKGCIRATVLISGYLIKE-KEQGCEVIYISHSDPKGKLPTWLVNRVTKVVAPKVIKKLHKACLGYPEWKEKHHPTWKPWS 273          
BLAST of START domain-containing protein vs. Ensembl Celegans
Match: strl-1 (Steroidogenic acute regulatory-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O17883])

HSP 1 Score: 53.1434 bits (126), Expect = 7.802e-8
Identity = 46/160 (28.75%), Postives = 71/160 (44.38%), Query Frame = 2
Query:  170 DEVYNKNDVSVFVKSTSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPK-KQFVRAISYVTGYLLRPIDEN--TTEMTYVTQSNPRGSIPSWAINK 640
            DE  N+ DV V+ K T +           + V   VM  T +  +    W++N+    +I    SN DI  Y     L    R+FV+ R WR   + F + + SV   ++  K K  VRA  ++ G   RP  EN  TT    V  ++ +G +P   +N+
Sbjct:   57 DESNNEGDV-VYAKDTPHGRMVTISTELPMPVED-VMKETWNGMEALPEWNQNINFAARIAAPTSNFDIVTYGNNDVLVVSGREFVSARIWRKVGDGFILASRSVTVPSFKSKHKGKVRAHLHLAGARFRPNPENPETTLTDVVMLADLKGYLPKMIVNQ 214          
BLAST of START domain-containing protein vs. Ensembl Celegans
Match: strl-1 (Steroidogenic acute regulatory-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O17883])

HSP 1 Score: 53.1434 bits (126), Expect = 7.802e-8
Identity = 46/160 (28.75%), Postives = 71/160 (44.38%), Query Frame = 2
Query:  170 DEVYNKNDVSVFVKSTSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPK-KQFVRAISYVTGYLLRPIDEN--TTEMTYVTQSNPRGSIPSWAINK 640
            DE  N+ DV V+ K T +           + V   VM  T +  +    W++N+    +I    SN DI  Y     L    R+FV+ R WR   + F + + SV   ++  K K  VRA  ++ G   RP  EN  TT    V  ++ +G +P   +N+
Sbjct:   57 DESNNEGDV-VYAKDTPHGRMVTISTELPMPVED-VMKETWNGMEALPEWNQNINFAARIAAPTSNFDIVTYGNNDVLVVSGREFVSARIWRKVGDGFILASRSVTVPSFKSKHKGKVRAHLHLAGARFRPNPENPETTLTDVVMLADLKGYLPKMIVNQ 214          
BLAST of START domain-containing protein vs. Ensembl Celegans
Match: strl-1 (Steroidogenic acute regulatory-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O17883])

HSP 1 Score: 52.7582 bits (125), Expect = 9.933e-8
Identity = 46/160 (28.75%), Postives = 71/160 (44.38%), Query Frame = 2
Query:  170 DEVYNKNDVSVFVKSTSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPK-KQFVRAISYVTGYLLRPIDEN--TTEMTYVTQSNPRGSIPSWAINK 640
            DE  N+ DV V+ K T +           + V   VM  T +  +    W++N+    +I    SN DI  Y     L    R+FV+ R WR   + F + + SV   ++  K K  VRA  ++ G   RP  EN  TT    V  ++ +G +P   +N+
Sbjct:   75 DESNNEGDV-VYAKDTPHGRMVTISTELPMPVED-VMKETWNGMEALPEWNQNINFAARIAAPTSNFDIVTYGNNDVLVVSGREFVSARIWRKVGDGFILASRSVTVPSFKSKHKGKVRAHLHLAGARFRPNPENPETTLTDVVMLADLKGYLPKMIVNQ 232          
BLAST of START domain-containing protein vs. Ensembl Fly
Match: CG6565 (gene:FBgn0032513 transcript:FBtr0342631)

HSP 1 Score: 48.9062 bits (115), Expect = 4.800e-6
Identity = 39/142 (27.46%), Postives = 67/142 (47.18%), Query Frame = 2
Query:  155 DNEDFDEVYNKNDVSVFVKS--TSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICR---VESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIF--NHSVFHKAYPPKKQFVRAISYVTGYLLRP 559
            D++ ++  ++KN+ S++ +   +S  S+K++     +  +  +   T  D DYR  WD   +    I       SNS + Y+ M+ P  F NRD+V  R +   DN+  IF  N    H  YP     VR   Y +  +++P
Sbjct:  188 DDQKWEPYFSKNEFSIWRRQERSSLYSYKVYARFDDITADDFLHVQT--DLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFICNRGATHNTYPALSGKVRVTDYWSLMVIKP 327          
BLAST of START domain-containing protein vs. Ensembl Fly
Match: CG6565 (gene:FBgn0032513 transcript:FBtr0080468)

HSP 1 Score: 48.9062 bits (115), Expect = 4.800e-6
Identity = 39/142 (27.46%), Postives = 67/142 (47.18%), Query Frame = 2
Query:  155 DNEDFDEVYNKNDVSVFVKS--TSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICR---VESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIF--NHSVFHKAYPPKKQFVRAISYVTGYLLRP 559
            D++ ++  ++KN+ S++ +   +S  S+K++     +  +  +   T  D DYR  WD   +    I       SNS + Y+ M+ P  F NRD+V  R +   DN+  IF  N    H  YP     VR   Y +  +++P
Sbjct:  188 DDQKWEPYFSKNEFSIWRRQERSSLYSYKVYARFDDITADDFLHVQT--DLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFICNRGATHNTYPALSGKVRVTDYWSLMVIKP 327          
BLAST of START domain-containing protein vs. Ensembl Fly
Match: CG6565 (gene:FBgn0032513 transcript:FBtr0346420)

HSP 1 Score: 48.9062 bits (115), Expect = 4.800e-6
Identity = 39/142 (27.46%), Postives = 67/142 (47.18%), Query Frame = 2
Query:  155 DNEDFDEVYNKNDVSVFVKS--TSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICR---VESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIF--NHSVFHKAYPPKKQFVRAISYVTGYLLRP 559
            D++ ++  ++KN+ S++ +   +S  S+K++     +  +  +   T  D DYR  WD   +    I       SNS + Y+ M+ P  F NRD+V  R +   DN+  IF  N    H  YP     VR   Y +  +++P
Sbjct:  188 DDQKWEPYFSKNEFSIWRRQERSSLYSYKVYARFDDITADDFLHVQT--DLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFICNRGATHNTYPALSGKVRVTDYWSLMVIKP 327          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard15 (StAR-related lipid transfer (START) domain containing 15 [Source:ZFIN;Acc:ZDB-GENE-070424-267])

HSP 1 Score: 212.231 bits (539), Expect = 1.790e-66
Identity = 101/249 (40.56%), Postives = 151/249 (60.64%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTE 847
            V+ P D+DF++F   C+  + +   YNK  V+V+ +     S +  K+R + K V A  +Y+ LHD  YR  WD N+++ F I R+  N+D+GYY+ K P   KNRDFVT R W    N++ I N+SV H  YPPKK +VRA+S +TGYL++    N+  + Y+TQ +PRGS+P W +N+ ++FV PK + +  KA + YP WK+++ PN  PW      T P IN  D+  Q   D   N++E+ V+E
Sbjct:    3 VQIPDDTDFLSFRDQCESQDGWVSRYNKGSVTVWCRDEECKSVQKLKMRIVCKDVTAETLYDVLHDTSYRKKWDTNMIDTFDIGRLTVNADVGYYSWKCPTPLKNRDFVTMRSWLPLGNDYLIINYSVKHPEYPPKKDYVRAVSLLTGYLIQSNGANSCTLYYLTQVDPRGSLPKWVVNRVSQFVAPKAMKKIYKACLKYPEWKRKHEPNLKPWRYPEQNTLPCINVADLTVQ-RADSLENIDESGVSE 250          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard14 (START domain containing 14 [Source:ZFIN;Acc:ZDB-GENE-040426-963])

HSP 1 Score: 199.134 bits (505), Expect = 3.023e-61
Identity = 92/221 (41.63%), Postives = 135/221 (61.09%), Query Frame = 2
Query:  113 PKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSF--------KMFKVR---GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW 742
            P +S F  F + C   E++   Y+KND+ V+V+    S+         K+ K+R    I  V+A  MY+ LHD  YR TWD  ++E F I R+  N+D+GYY+   P   KNRD VT R W+ S+NE+ I N SV H  YPP+K  VRA+S +TGYL++P    +   TY++Q++P+GS+P W +NKA++ + PK++    KA  +YPAWK  N+P+  PW
Sbjct:    9 PDESMFAEFKRQCLSTENWVNKYDKNDMEVWVEQAPLSASINNKGNYSKVHKIRCQINIKDVSAATMYDVLHDGQYRKTWDPTMLESFDIARLAHNADVGYYSWICPKPLKNRDVVTLRSWQASENEYVIINFSVKHPKYPPRKDLVRAVSLMTGYLIKPTGPQSCTFTYLSQADPKGSLPKWVVNKASQVLAPKVLRSAHKAGQNYPAWKAANSPDHKPW 229          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard14 (START domain containing 14 [Source:ZFIN;Acc:ZDB-GENE-040426-963])

HSP 1 Score: 198.749 bits (504), Expect = 3.440e-61
Identity = 92/221 (41.63%), Postives = 135/221 (61.09%), Query Frame = 2
Query:  113 PKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSF--------KMFKVR---GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW 742
            P +S F  F + C   E++   Y+KND+ V+V+    S+         K+ K+R    I  V+A  MY+ LHD  YR TWD  ++E F I R+  N+D+GYY+   P   KNRD VT R W+ S+NE+ I N SV H  YPP+K  VRA+S +TGYL++P    +   TY++Q++P+GS+P W +NKA++ + PK++    KA  +YPAWK  N+P+  PW
Sbjct:    9 PDESMFAEFKRQCLSTENWVNKYDKNDMEVWVEQAPLSASINNKGNYSKVHKIRCQINIKDVSAATMYDVLHDGQYRKTWDPTMLESFDIARLAHNADVGYYSWICPKPLKNRDVVTLRSWQASENEYVIINFSVKHPKYPPRKDLVRAVSLMTGYLIKPTGPQSCTFTYLSQADPKGSLPKWVVNKASQVLAPKVLRSAHKAGQNYPAWKAANSPDHKPW 229          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard14 (START domain containing 14 [Source:ZFIN;Acc:ZDB-GENE-040426-963])

HSP 1 Score: 198.749 bits (504), Expect = 3.440e-61
Identity = 92/221 (41.63%), Postives = 135/221 (61.09%), Query Frame = 2
Query:  113 PKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSF--------KMFKVR---GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW 742
            P +S F  F + C   E++   Y+KND+ V+V+    S+         K+ K+R    I  V+A  MY+ LHD  YR TWD  ++E F I R+  N+D+GYY+   P   KNRD VT R W+ S+NE+ I N SV H  YPP+K  VRA+S +TGYL++P    +   TY++Q++P+GS+P W +NKA++ + PK++    KA  +YPAWK  N+P+  PW
Sbjct:    9 PDESMFAEFKRQCLSTENWVNKYDKNDMEVWVEQAPLSASINNKGNYSKVHKIRCQINIKDVSAATMYDVLHDGQYRKTWDPTMLESFDIARLAHNADVGYYSWICPKPLKNRDVVTLRSWQASENEYVIINFSVKHPKYPPRKDLVRAVSLMTGYLIKPTGPQSCTFTYLSQADPKGSLPKWVVNKASQVLAPKVLRSAHKAGQNYPAWKAANSPDHKPW 229          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard10 (StAR-related lipid transfer (START) domain containing 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1797])

HSP 1 Score: 181.415 bits (459), Expect = 1.799e-54
Identity = 84/216 (38.89%), Postives = 127/216 (58.80%), Query Frame = 2
Query:  101 EVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSY-SSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW 742
            EV  P D  F  F   C+    +   +NK+++ V+++      S    K R   K + A  MY+ LHD +YR  WD N++E F I ++  N+D+GYY+ K P   KNRD +T R W    N++ I N+SV H  YPPKK  VRA+S  TGYL++    ++  +TY+ Q +P+GS+P W +NK+++ + PK + R  KA   YP WK++++P F PW
Sbjct:    9 EVLIPDDRAFSRFKHECEAEAGWTVTHNKSNICVWIQLLEEDKSLHKIKCRMTCKDIPAETMYDVLHDIEYRRKWDANVIETFDIGKLTVNADVGYYSWKCPKPLKNRDVITLRSWLPMGNDYIIMNYSVKHSKYPPKKDLVRAVSIQTGYLIQRTGPSSCTLTYLAQVDPKGSLPKWVVNKSSQLLAPKAMKRISKACARYPEWKQKHSPGFKPW 224          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000038456.1 (uncharacterized LOC100145115 [Source:NCBI gene;Acc:100145115])

HSP 1 Score: 204.527 bits (519), Expect = 3.157e-63
Identity = 101/257 (39.30%), Postives = 154/257 (59.92%), Query Frame = 2
Query:   92 EIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK---VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTENG 853
            EI +V  P DS F++F + C+  + +   YNK D+ V++K ++  +  +  V+G +    V+A  +Y+ LHD +YR  WD N++E   I  + +N+D+GYY+ K P   KNRD VT R W V  + F I N SV HK YPP+K  VRA+S V GY +     NT  +TY+ Q +PRGS+P W +NK++K++ PKI+ +  KA + YP+WK +N P F PW N    T P ++ N++  Q   D    V+E+++ E  
Sbjct:    4 EIPQV--PDDSVFLSFREQCESTDGWVCSYNKADIGVWMKPSAGKTSLVHTVKGRMTFPDVSADTVYDVLHDTEYRKKWDINMIETKDIALLSANADVGYYSWKCPKPLKNRDVVTLRSWLVLPDSFMIINFSVKHKLYPPRKDLVRAVSLVAGYYIHSTGSNTCTLTYLAQVDPRGSLPKWVVNKSSKYLAPKILRKLHKACLQYPSWKNKNQPAFKPWLNPEQNTLPRMSLNELTLQ-RADSLELVDESNLCEGA 257          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: nr2f6 (nuclear receptor subfamily 2 group F member 6 [Source:Xenbase;Acc:XB-GENE-480818])

HSP 1 Score: 201.83 bits (512), Expect = 2.606e-62
Identity = 101/250 (40.40%), Postives = 153/250 (61.20%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKST-SYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTE 847
            V  P D+DF +F + C+++E +   YNK  V+V+ +   S  + K  K+    K V A ++Y+ LHD  YR  WD N++E + I R+  N+DIGYY+ K P   KNRDFVT R W    N++ I N+SV H  +PP+K +VRA+S  TGYL++    N+  + Y+TQ +PRGS+P W +NK ++FV PK + +  KA I YP WK++++P++ PW      T P +N  D+  Q   D   N++E+ V+E
Sbjct:    2 VHIPDDADFNSFREQCENHEGWHCQYNKGGVTVWSEEQDSTKAVKKLKMCITCKDVPAEILYDVLHDTSYRKKWDSNMIETYDIGRLTVNADIGYYSWKCPSPLKNRDFVTLRSWLPLGNDYMIINYSVKHPKHPPRKDYVRAVSLQTGYLIKANGSNSCSLYYLTQVDPRGSLPKWVVNKVSQFVAPKAMKKIYKAGIKYPEWKRKHDPDYKPWVYPEQNTLPTVNLADLSIQ-RADELENIDESGVSE 250          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: stard10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:100145047])

HSP 1 Score: 193.356 bits (490), Expect = 7.923e-59
Identity = 96/254 (37.80%), Postives = 149/254 (58.66%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK---VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTENGN 856
            V+ P D DF TF   C  +  +   Y+K+ ++V+++        + K++  ++   V+A V+Y+ LHD +YR  WD N++E F I ++  N+DIGYYA K P   KNRD +T R W    N++ I N+SV H  YPPKK  VRA+S  TGYL++     +  + Y+ Q +PRGS+P W +NK+++F+ PK + +  KA + YP WKK++NP+  PW      T P I+  D+  Q   D   N++E+  TE  +
Sbjct:   17 VQIPDDRDFQTFRTECYSDAGWTMTYSKSGITVWIQILE-EERALHKIKCKMECKDVSAEVLYDVLHDIEYRKKWDSNVIETFDIGKLTVNADIGYYAWKCPKPLKNRDVITLRSWLPFGNDYIIMNYSVKHAKYPPKKDLVRAVSIQTGYLIQSGGPKSATLIYLAQVDPRGSLPKWVVNKSSQFLAPKAMKKMYKACVKYPEWKKKHNPHHKPWLYPEQSTLPTISLADVSIQ-HADSLENIDESSATETKD 268          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: stard7 (StAR related lipid transfer domain containing 7 [Source:NCBI gene;Acc:100158578])

HSP 1 Score: 50.0618 bits (118), Expect = 3.025e-6
Identity = 43/214 (20.09%), Postives = 91/214 (42.52%), Query Frame = 2
Query:   77 EMKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICR-VESNSDIGYYAMKSPLAFKNRDFVTQRCWRV--SDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRP---IDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIH 697
            +MK   +G  R      F   T   ++++ ++ V +  +  ++ +    +    ++V G  + V     +N   D +YR  WD  +++   I R   S S+I ++    P    +RD+V  R + +   +N   + + +V H + P    +VR  +Y +  +++P    DEN  +       NP+   P + +N      +P  + +   A + 
Sbjct:   85 DMKRMRLGVER------FQGQTSTYNEDQGWELVIDNKEFKLWRRPIEGTHLYQYRVFGCYRDVTPRQFFNVQLDTEYRKKWDALVIKLDIIERDALSGSEIIHWVTHFPYPMYSRDYVYVRKYHIDQENNIMVLVSRAVEHPSVPESPDYVRVRNYQSQMVIQPHTTFDENGFDYLLTYSDNPQTVFPRYCVNWMVSSGMPDFLEKLHMATVQ 292          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 188.734 bits (478), Expect = 5.378e-57
Identity = 92/251 (36.65%), Postives = 146/251 (58.17%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V+ P D DF +F   C+    ++  Y+K  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA I YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ VTE+
Sbjct:   22 VQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVTES 271          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 188.734 bits (478), Expect = 5.378e-57
Identity = 92/251 (36.65%), Postives = 146/251 (58.17%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V+ P D DF +F   C+    ++  Y+K  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA I YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ VTE+
Sbjct:   22 VQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVTES 271          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 188.734 bits (478), Expect = 5.378e-57
Identity = 92/251 (36.65%), Postives = 146/251 (58.17%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V+ P D DF +F   C+    ++  Y+K  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA I YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ VTE+
Sbjct:   22 VQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVTES 271          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 189.504 bits (480), Expect = 2.215e-56
Identity = 92/251 (36.65%), Postives = 146/251 (58.17%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V+ P D DF +F   C+    ++  Y+K  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA I YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ VTE+
Sbjct:   95 VQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVTES 344          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 172.17 bits (435), Expect = 1.009e-50
Identity = 77/196 (39.29%), Postives = 121/196 (61.73%), Query Frame = 2
Query:  263 VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA I YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ VTE+
Sbjct:   69 VPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVTES 263          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JMD3|STA10_MOUSE (START domain-containing protein 10 OS=Mus musculus OX=10090 GN=Stard10 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.762e-56
Identity = 92/251 (36.65%), Postives = 146/251 (58.17%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V+ P D DF +F   C+    ++  Y+K  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA I YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ VTE+
Sbjct:   22 VQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVTES 271          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y365|STA10_HUMAN (START domain-containing protein 10 OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 2.165e-54
Identity = 89/251 (35.46%), Postives = 145/251 (57.77%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V+ P D DF +F   C+    ++  Y++  VSV+V++     +    K R     V A  +Y+ LHD +YR  WD N++E F I R+  N+D+GYY+ + P   KNRD +T R W     ++ I N+SV H  YPP+K  VRA+S  TGYL++     +  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA + YP WK+++ P+F PW +      P +  +++  Q   D   N++E+ V E+
Sbjct:   22 VQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDESAVAES 271          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|P53808|PPCT_MOUSE (Phosphatidylcholine transfer protein OS=Mus musculus OX=10090 GN=Pctp PE=1 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 1.073e-10
Identity = 48/187 (25.67%), Postives = 81/187 (43.32%), Query Frame = 2
Query:  164 DFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSD---IGYYAMKSPLAFKNRDFVTQRCWRVSDNE----FAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHY 700
            D+  +   + ++++      S    +KV G+L+  +  ++ +   D DYR  WD+ + E +     E  SD   + Y+ +K P    NRD+V  R  R  D +    + +   S+    +P K   +R   Y     +    +  + +      NP G IPSW IN AAK  VP  +    KA  +Y
Sbjct:   29 DWQLLVEASGITIYRLLDQPSGLYEYKVFGVLEGCSPALLTDVYMDLDYRKQWDQYVKELY-----EKESDEQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDRRKIYVVLAQSISAPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNY 210          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UKL6|PPCT_HUMAN (Phosphatidylcholine transfer protein OS=Homo sapiens OX=9606 GN=PCTP PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 8.260e-9
Identity = 47/185 (25.41%), Postives = 80/185 (43.24%), Query Frame = 2
Query:  164 DFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGF-QICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNE----FAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHY 700
            D+  +   + +S++      +    +KV G+L+  +  ++ +   D+DYR  WD+ + E + Q C  E+   + Y+ +K P    NRD+V  R  R  D E      I   S        +   +R   Y     +    +  +++      NP G IPSW IN AAK  VP  +    +A  +Y
Sbjct:   29 DWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGET---VVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNY 210          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|P53809|PPCT_RAT (Phosphatidylcholine transfer protein OS=Rattus norvegicus OX=10116 GN=Pctp PE=2 SV=2)

HSP 1 Score: 58.5362 bits (140), Expect = 1.096e-8
Identity = 43/186 (23.12%), Postives = 79/186 (42.47%), Query Frame = 2
Query:  158 NEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNE----FAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHY 700
              D+  +   + ++++      +    +KV G+L+     ++ +   D DYR  WD+ + E ++  +      + Y+ +K P    NRD+V  R  R  D +    + +   ++    +P K   +R   Y     +    +  + +      NP G IPSW IN AAK  VP  +    KA  +Y
Sbjct:   27 GADWQLLVEASGITIYRLLDQSTGLYEYKVFGVLESCIPSLLADVYMDLDYRKKWDQYVKELYE--KSFDGQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQNISVPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPSFLKDMVKACQNY 210          
BLAST of START domain-containing protein vs. TrEMBL
Match: H2KSW8 (PCTP-like protein OS=Clonorchis sinensis OX=79923 GN=CLF_110624 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 8.731e-81
Identity = 125/259 (48.26%), Postives = 173/259 (66.80%), Query Frame = 2
Query:   80 MKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGIL-KVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW--SNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTE 847
            M  FE+GEVR P D DF  F  +  D   + + ++K  V VF +STS SSFKM KV   L  V+A VMY+TLHD+ YR +WDK + EG +ICR+  NS I Y+A+K+P AF NRDFV  R WR+S +EF IFN SVFHK  PPKK+++R I ++TGYL+R     + +  Y+TQ++PRG IP+WAIN   K + P I+    +AA+ YPAWK Q++P+FMPW  +N     +P ++ NDIL +PD      ++E++V+E
Sbjct:    1 MPFFELGEVRLPTDDDFDYFKSMVLDTSQWKKHHSKKKVQVFTRSTSVSSFKMIKVIASLPDVSADVMYDTLHDSIYRGSWDKTMKEGHEICRISPNSVIDYHAIKAPFAFSNRDFVMNRVWRISGDEFIIFNRSVFHKKAPPKKEYIRGICFLTGYLIRRTGPRSCDFYYITQNDPRGIIPAWAINLGTKSLAPSIMRSLHRAALSYPAWKDQHDPDFMPWRYTNQQSGLSPPLDMNDILKEPDF-CRTEIDESNVSE 258          
BLAST of START domain-containing protein vs. TrEMBL
Match: A0A4S2MEF2 (START domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001558 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.145e-80
Identity = 125/259 (48.26%), Postives = 173/259 (66.80%), Query Frame = 2
Query:   80 MKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGIL-KVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW--SNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTE 847
            M  FE+GEVR P D DF  F  +  D   + + ++K  V VF +STS SSFKM KV   L  V+A VMY+TLHD+ YR +WDK + EG +ICR+  NS I Y+A+K+P AF NRDFV  R WR+S +EF IFN SVFHK  PPKK+++R I ++TGYL+R     + +  Y+TQ++PRG IP+WAIN   K + P I+    +AA+ YPAWK Q++P+FMPW  +N     +P ++ NDIL +PD      ++E++V+E
Sbjct:    1 MPFFELGEVRLPTDDDFDYFKSMVLDTSQWKKHHSKKKVQVFTRSTSVSSFKMIKVIASLPDVSADVMYDTLHDSIYRGSWDKTMKEGHEICRISPNSVIDYHAIKAPFAFSNRDFVMNRVWRISGDEFIIFNRSVFHKKAPPKKEYIRGICFLTGYLIRRTGPRSCDFYYITQNDPRGIIPAWAINLGTKSLAPSIMKSLHRAALDYPAWKDQHDPDFMPWRYTNQQSGLSPPLDMNDILKEPDF-CRTEIDESNVSE 258          
BLAST of START domain-containing protein vs. TrEMBL
Match: A0A504YIN5 (Putative Phosphatidylcholine transfer protein OS=Fasciola gigantica OX=46835 GN=FGIG_03335 PE=4 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.459e-76
Identity = 116/261 (44.44%), Postives = 168/261 (64.37%), Query Frame = 2
Query:   80 MKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWT--TPMINWNDILFQPDVDIAVNVEENHVTENG 853
            M+ +++GEVR P+D DF+ F ++  D   + + + +  + VF + T  S+ KM KV   L+ ++A V+Y+TLHD  YRS WD  + EGFQIC+V  +S I YY +K+P  FKNRDFV  R WR   +E+ IFN SVFHK  PPK  +VRA++Y+TGY++     ++ EM Y+TQ++PRG+IP+WAIN  A  V P I+    +AA HYPAWK Q++P FMPW +    +   P ++  DIL +PD      ++E +V EN 
Sbjct:    1 MRFYQLGEVRPPRDDDFMYFKEMAQDESHWKKSHIRKKIKVFTRVTEASNIKMIKVVANLQDISADVLYDTLHDPIYRSEWDATMKEGFQICQVAQDSVIEYYGLKAPFTFKNRDFVLHRSWRKFGSEYIIFNRSVFHKKVPPKPDYVRALTYLTGYVITSTGPSSCEMIYITQNDPRGTIPAWAINLVATSVAPSIMKSLHRAASHYPAWKAQHDPQFMPWRHQSQQSGLLPAVDMTDILSEPDY-ARTTIDETNVDENA 260          
BLAST of START domain-containing protein vs. TrEMBL
Match: A0A4E0RF40 (Putative Phosphatidylcholine transfer protein OS=Fasciola hepatica OX=6192 GN=D915_004236 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 2.299e-76
Identity = 116/261 (44.44%), Postives = 168/261 (64.37%), Query Frame = 2
Query:   80 MKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWT--TPMINWNDILFQPDVDIAVNVEENHVTENG 853
            M+ +++GEVR P+D DF+ F ++  D   + + + +  + VF + T  S+ KM KV   L+ ++A V+Y+TLHD  YRS WD  + EGFQIC+V  +S I YY +K+P  FKNRDFV  R WR   +E+ IFN SVFHK  PPK  +VRA++Y+TGY++     ++ EM Y+TQ++PRG+IP+WAIN  A  V P I+    +AA HYPAWK Q++P FMPW +    +   P ++  DIL +PD      ++E +V EN 
Sbjct:    1 MRFYQLGEVRPPRDDDFMYFKEMAQDESHWKKSHIRKKIKVFTRVTEASNIKMIKVVANLQDISADVLYDTLHDPIYRSEWDATMKEGFQICQVAQDSVIEYYGLKAPFTFKNRDFVLHRSWRKFGSEYIIFNRSVFHKKVPPKPDYVRALTYLTGYVITSTGPSSCEMIYITQNDPRGTIPAWAINLVATSVAPSIMKSLHRAASHYPAWKAQHDPQFMPWRHQSQQSGLLPAVDMADILSEPDY-ARTTIDETNVDENA 260          
BLAST of START domain-containing protein vs. TrEMBL
Match: A0A4S2L658 (START domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010254 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 9.214e-76
Identity = 111/252 (44.05%), Postives = 169/252 (67.06%), Query Frame = 2
Query:  113 PKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENH---VTENGN 856
            P D+       LC +N  +  VY+K++++VF + T  S  KMFK+  ILK V+A  +++TL D++YR  WDKN++E +++C +  N+DIGYYA++S  A ++RDFV QR W  + +E+ I N S+FHKA PP+KQ++RAIS++T Y++RP   N  E+ Y+TQ +PRG +P+WA+NKA ++V P+++ +  KA   Y AWK+++ P F PW        P INW+DIL  PDV   V V+E++   + ENGN
Sbjct:   12 PDDAYMQNIRNLCTENPSWCRVYSKHNITVFSRLTEASDIKMFKLVAILKGVSADTLFDTLMDSEYRKLWDKNMLESYELCSINPNNDIGYYALRSFPAIRDRDFVLQRSWLQAHSEYMIANRSIFHKALPPRKQYIRAISHLTSYIIRPCGSNECELIYITQCDPRGKLPAWAVNKATQYVAPRVIKQLIKACQQYAAWKRKHQPEFKPWIYPEQCKLPAINWDDILSTPDVAGDVTVDESNAMDMAENGN 263          
BLAST of START domain-containing protein vs. Ensembl Cavefish
Match: stard15 (START domain-containing protein 10-like [Source:NCBI gene;Acc:103033714])

HSP 1 Score: 210.305 bits (534), Expect = 7.557e-66
Identity = 100/252 (39.68%), Postives = 152/252 (60.32%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTENGN 856
            V+ P D+DF +F   C++++ +   YNK  V+V+ +     + +  K+R + K V A  +Y+ LHD  YR  WD N+++ F I R+  N+D+GYY+ K P   KNRDFVT R W    N++ I N+SV H  YPPKK +VRA+S +TGYL++    N   + Y+TQ +PRGS+P W +N+ ++FV PK + +  KA + YP WK+++ PN  PW      T P IN  D+  Q   D   N++E+ ++E  N
Sbjct:    3 VQIPDDTDFASFKDQCENHDGWLARYNKGGVTVWCREEETKTVQKLKMRIVCKDVRAETLYDVLHDTSYRKKWDTNMIDTFDIGRLTVNADVGYYSWKCPSPLKNRDFVTMRSWLPLGNDYLIINYSVKHPQYPPKKDYVRAVSLLTGYLIQSNGPNCCTLYYLTQVDPRGSLPKWVVNRVSQFVAPKAMRKIYKACLKYPEWKRKHEPNLKPWMYPEQNTLPCINVADLTVQ-RADSLENIDESGLSEEKN 253          
BLAST of START domain-containing protein vs. Ensembl Cavefish
Match: stard14 (START domain-containing protein 10-like [Source:NCBI gene;Acc:103043036])

HSP 1 Score: 207.608 bits (527), Expect = 1.075e-64
Identity = 102/252 (40.48%), Postives = 150/252 (59.52%), Query Frame = 2
Query:  113 PKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVK----------STSYSSFKMFKVR-GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEEN 835
            P +S F    + C   E+++  Y+KN + V+V+           +SYS     K R  I  V+A  MY+ LHD  YR TWD  ++E F+I R+  N+D+ YY+   P   KNRD VT R W+ S++E+ I N+SV H  YPP+K  VRA+SY+TGYLL+P   N+   TY++Q++P+GS+P WA+NKA++ + PK++    KA  +YPAWK QN+P   PW        PM+N  ++  Q   D   NV+E+
Sbjct:    9 PDESVFADLRRQCSSTENWENKYSKNGMDVWVEVPSINSVQGNKSSYSKVHKIKCRIAISDVSAATMYDVLHDNKYRKTWDPAMLESFEIARLSPNADVSYYSWLCPKPLKNRDVVTLRSWQASEDEYIIVNYSVKHAKYPPRKDLVRAVSYLTGYLLKPTGPNSCSFTYLSQADPKGSLPKWAVNKASQVLAPKVMKSVHKAGQNYPAWKAQNSPEHKPWLYPIQSELPMMNPRELSIQRG-DSLENVDES 259          
BLAST of START domain-containing protein vs. Ensembl Cavefish
Match: stard10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:103028029])

HSP 1 Score: 185.652 bits (470), Expect = 3.584e-56
Identity = 87/216 (40.28%), Postives = 128/216 (59.26%), Query Frame = 2
Query:  101 EVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW 742
            EV  P D  F++F   C  +E +   YNK  ++V ++      S    K R + K V A  MY+ LHD +YR  WD N++E F I ++  N+DIGYY+ K P   KNRD +T R W     ++ I N+SV H  YPPKK  VRA+S  TGYL++    ++  +TY+ Q +PRGS+P W +NK+++F+ PK +    KA + Y  WK+++NP + PW
Sbjct:    5 EVLIPDDKAFISFKIECCSDEGWSLTYNKTGITVLIQILEEEKSLHKIKCRMVCKDVAAETMYDVLHDIEYRKKWDSNVIETFDIGKLTVNADIGYYSWKCPKPLKNRDVITLRSWLPMGKDYIIMNYSVKHPKYPPKKDMVRAVSIQTGYLIQSNGPSSCTLTYLAQVDPRGSLPKWVVNKSSQFLAPKAMKHICKACLKYAEWKQRHNPGYKPW 220          
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Match: stard10 (StAR-related lipid transfer (START) domain containing 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1797])

HSP 1 Score: 182.185 bits (461), Expect = 2.332e-55
Identity = 90/218 (41.28%), Postives = 132/218 (60.55%), Query Frame = 2
Query:   98 GE-VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSF-KMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPW 742
            GE V+ P D  F +F   C+  E +D  YNK  V V+ +     +F +  K R   K V+A  MY+ LHD DYR  WD N++E F I ++ +N+D+GYY+ K     KNRDF+T R W    + + I NHSV H  YP KK+ VRA+S +TGYL+     N+  +TY+ Q +P+GS+P W +NK+++F+ PK + +  KA + YP WK ++N +  PW
Sbjct:   21 GETVQIPDDEAFQSFRNDCESTEGWDVTYNKGAVVVWTQPLRNGTFVQKLKTRLECKDVSAETMYDVLHDIDYRKKWDSNVVETFDIGKLTANADVGYYSCKCK-PLKNRDFITLRSWLALPDSYMIINHSVKHPHYPAKKECVRAVSLMTGYLVHITGANSCSLTYLCQVDPKGSLPKWVVNKSSQFMAPKAMKKIYKACLKYPEWKSKHNCDHKPW 237          
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Match: dlc1 (DLC1 Rho GTPase activating protein [Source:ZFIN;Acc:ZDB-GENE-130206-12])

HSP 1 Score: 51.2174 bits (121), Expect = 2.284e-7
Identity = 28/109 (25.69%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  308 RSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWR--VSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSW 628
            R  WD++L++   +  ++ N+++ YY + S      RD++  R WR  +      +   SV H+  P   +  RA+   + YL+ P+  N + +T+V + + RG    W
Sbjct:  341 RHLWDEDLLQWKVVETLDPNTEVFYYVLNSMAPHPARDYLVLRSWRTDLPKGSCVLVATSVEHEEVPCVGE-ARAVVLASRYLIEPLGANRSRLTHVCRIDTRGRSLEW 448          
BLAST of START domain-containing protein vs. Ensembl Nematostella
Match: EDO39000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBA9])

HSP 1 Score: 209.534 bits (532), Expect = 3.658e-66
Identity = 96/235 (40.85%), Postives = 149/235 (63.40%), Query Frame = 2
Query:   89 FEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRG-ILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDI 790
             ++GEVR  K  DF  F +L +  E +   Y++    V+ K T  S+ KM KV      V  +V+Y+ LHD +YR +WD+N++E +++C+++ N+DIGYY++K P   KNRDFVTQR W+ SD++F I NH+V HKA  PKK F+R  S +TGY ++  +   T +TYVTQ +P+G++P W +N+ +  + PK+V +  KAAI Y +WK  + P++ PW      T P +  +D+
Sbjct:    1 MQVGEVRVAKAEDFEQFRRLSESAEKWALQYDRCGTKVYSKITDASTVKMIKVVAHFADVPFMVLYDVLHDPEYRRSWDENMIECYELCQLDCNNDIGYYSVKCPAPMKNRDFVTQRSWKCSDSDFVIINHTVHHKAAHPKKGFIRGTSILTGYHVKAKNSGCT-LTYVTQVDPKGTLPKWIVNRVSGKIAPKVVAKLHKAAIEYKSWKDLHQPSYKPWLKPEQNTLPFVRSDDV 234          
BLAST of START domain-containing protein vs. Ensembl Nematostella
Match: EDO42511 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1I0])

HSP 1 Score: 51.9878 bits (123), Expect = 8.017e-8
Identity = 54/198 (27.27%), Postives = 80/198 (40.40%), Query Frame = 2
Query:  152 DDNEDFDE-VYNKNDVSVFVKSTSYSSFKMFKVRG-ILKVNALVMYNTLHDADYRSTWDKNL--MEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYP-----PKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQ 718
            DD E F E   +K    ++ +    S    +K+ G ++ V          D DYR  WD  +  +E F+    ES     Y+ +  P    NRD+   R  R  D    I    V  +++P      K   VR   Y      +   +  T+       NP G IP+W IN AAK  VP  +   +KA + Y  +KK+
Sbjct:   20 DDFEFFTESAGDKVTCKIYRRYKEESGLYDYKILGDLVDVPTDTCKAVYMDLDYRKKWDSYVKALEEFE----ESGVKGIYWNVNYPFPMSNRDYTYIRELREFDIN-GIPTTVVIARSHPVASIPAKSGVVRVADYNQTLTFQSDGKQGTKAFMYYFDNPGGMIPTWLINWAAKTGVPSFMTSMRKACLGYEDYKKK 212          
BLAST of START domain-containing protein vs. Ensembl Nematostella
Match: EDO46303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQJ8])

HSP 1 Score: 49.6766 bits (117), Expect = 2.910e-7
Identity = 38/158 (24.05%), Postives = 71/158 (44.94%), Query Frame = 2
Query:  239 FKVRG-ILKVNALVMYNTLHDADYRSTWDKNLMEGFQICR-VESNSDIGYYAMKSPLAFKNRDFVTQRCWRV--SDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRP---IDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAA 691
            +KV G  L +NA   + T  D +YR  WD+  ++   I +    + ++ ++ MK P    +RD+V  R  ++    N+  + + +  H   P     VR   Y +  ++ P    DEN  +       NP+ +IP+   + A    +P  +++   AA
Sbjct:   26 YKVFGSFLDINARSFFFTQIDTNYRKQWDQYAIKLDVIDKDPAGDCEVLHWIMKYPYPLTSRDYVFVRKSKIDMQSNKMVLMSKATSHPKCPENNTHVRVTDYGSQMVILPHRTFDENGMDFVLSYYDNPKVTIPNVCTSYATSAGIPNFINKLHLAA 183          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard15 (START domain-containing protein 10 [Source:NCBI gene;Acc:101170411])

HSP 1 Score: 193.356 bits (490), Expect = 2.788e-59
Identity = 94/249 (37.75%), Postives = 147/249 (59.04%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTE 847
            V+ P DSDF +F       + +   YNK  V+V+ +    S+ +  K+R + K + A  +Y+ LHD +YR  WD N++E + I R+  N+D+GYY+ + P   KNRDFVT R W    N++ I N SV H  +PP+K +VRA+S  TGYL++      + + Y+TQ +PRGS+P W +N+ ++FV PK + +  KAA+ YP WK+++NP   PW        P IN  ++  Q   D   N++E+ ++E
Sbjct:    3 VQIPDDSDFSSFKDQVLSEDGWKSRYNKGGVTVWCREEESSAVQKLKMRIVCKDLPAETLYDVLHDINYRKKWDSNMIETYDIGRLTVNADVGYYSWRCPSPLKNRDFVTMRSWLPLGNDYLIINFSVKHPKHPPRKDYVRAVSLQTGYLIQSNGATGSTLYYLTQVDPRGSLPKWVVNRVSQFVAPKAMKKIYKAALKYPEWKRKHNPALKPWMFPEQNALPPINPAELTLQ-RADSLENIDESGLSE 250          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard15 (START domain-containing protein 10 [Source:NCBI gene;Acc:101170411])

HSP 1 Score: 193.356 bits (490), Expect = 6.355e-59
Identity = 94/249 (37.75%), Postives = 147/249 (59.04%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTE 847
            V+ P DSDF +F       + +   YNK  V+V+ +    S+ +  K+R + K + A  +Y+ LHD +YR  WD N++E + I R+  N+D+GYY+ + P   KNRDFVT R W    N++ I N SV H  +PP+K +VRA+S  TGYL++      + + Y+TQ +PRGS+P W +N+ ++FV PK + +  KAA+ YP WK+++NP   PW        P IN  ++  Q   D   N++E+ ++E
Sbjct:   34 VQIPDDSDFSSFKDQVLSEDGWKSRYNKGGVTVWCREEESSAVQKLKMRIVCKDLPAETLYDVLHDINYRKKWDSNMIETYDIGRLTVNADVGYYSWRCPSPLKNRDFVTMRSWLPLGNDYLIINFSVKHPKHPPRKDYVRAVSLQTGYLIQSNGATGSTLYYLTQVDPRGSLPKWVVNRVSQFVAPKAMKKIYKAALKYPEWKRKHNPALKPWMFPEQNALPPINPAELTLQ-RADSLENIDESGLSE 281          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard14 (START domain-containing protein 10 [Source:NCBI gene;Acc:101168965])

HSP 1 Score: 188.348 bits (477), Expect = 2.760e-57
Identity = 94/245 (38.37%), Postives = 145/245 (59.18%), Query Frame = 2
Query:  113 PKDSDFVTFTKLCDDNED-FDEVYNKNDVSVFVKSTSYSSF-KMFKVR---GILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEE 832
            P D  F  F + C   E+ +   YNKND+ V++++   +S  K+ K+R    I  V+A  MY+ +HD +YR TWD N+++ F I R+  N+D+GYY+   P   KNRD VT R W+V D+E+ I N SV H  YP +   VRA+S +TGY ++    N+    Y++Q++P+GS+P W +NKA++ + P+++    KA   YP WK+QN PN  PW +    + P +N  ++  Q   D   NV+E
Sbjct:    8 PDDEVFADFRRQCLSAENCWQSKYNKNDMQVWIENPPPNSAPKVHKIRCKMTIKDVSAATMYDVIHDGEYRKTWDPNMLDSFDIARLSDNADVGYYSWNCPKPLKNRDVVTLRSWQVKDDEYIIINFSVKHPKYPAQGNLVRAVSMLTGYYIKNTGPNSCTFIYLSQADPKGSLPKWVVNKASQVLAPRVLKSVHKAGQKYPEWKQQNKPNQKPWLHPEQSSLPTMNPAELSIQ-RADSLENVDE 251          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:101172673])

HSP 1 Score: 171.785 bits (434), Expect = 7.034e-51
Identity = 87/251 (34.66%), Postives = 139/251 (55.38%), Query Frame = 2
Query:  104 VRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYS-SFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V  P D+ F  F   C  ++ +   YN+  ++V  +      S    K R + + V A  MY+ LHD +YR  WD N+++ F I ++  N+D+GYY+ K P   + RD VT R W    N++ I N+SV H  YPP+K  VRAIS  TGY+++    N   + Y+ Q +PRGS+P W +NK+++ + P+++ +  KA++ Y  WKK++NP F PW      T P I  +++  Q   +    ++E+ V E 
Sbjct:    7 VTIPDDAAFAKFKAECLCDDGWSLTYNRGGITVRTQVLEEGKSIHRVKCRMVCEDVPAETMYDVLHDTEYRWRWDTNVIDTFDIGKLTVNADVGYYSWKCPRPLRYRDVVTLRSWLPMGNDYIIMNYSVKHSKYPPRKDMVRAISIQTGYMIQSQGPNRCTLVYLAQVDPRGSLPKWVVNKSSQLLAPRVLKKIHKASLKYSDWKKKHNPCFKPWLFPEQNTLPSIPLSELSIQ-RAESLEKIDESDVIEQ 256          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:101172673])

HSP 1 Score: 160.999 bits (406), Expect = 2.100e-47
Identity = 75/196 (38.27%), Postives = 117/196 (59.69%), Query Frame = 2
Query:  263 VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTEN 850
            V A  MY+ LHD +YR  WD N+++ F I ++  N+D+GYY+ K P   + RD VT R W    N++ I N+SV H  YPP+K  VRAIS  TGY+++    N   + Y+ Q +PRGS+P W +NK+++ + P+++ +  KA++ Y  WKK++NP F PW      T P I  +++  Q   +    ++E+ V E 
Sbjct:   12 VPAETMYDVLHDTEYRWRWDTNVIDTFDIGKLTVNADVGYYSWKCPRPLRYRDVVTLRSWLPMGNDYIIMNYSVKHSKYPPRKDMVRAISIQTGYMIQSQGPNRCTLVYLAQVDPRGSLPKWVVNKSSQLLAPRVLKKIHKASLKYSDWKKKHNPCFKPWLFPEQNTLPSIPLSELSIQ-RAESLEKIDESDVIEQ 206          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000046413.1 (SMESG000046413.1)

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 257/259 (99.23%), Postives = 259/259 (100.00%), Query Frame = 2
Query:   80 MKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTENGN 856
            MKHFEIGEVRSPKDSDFVTFTKLCDDNE+FDEVYNKNDVSVFVKSTSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEE+HVTENGN
Sbjct:    1 MKHFEIGEVRSPKDSDFVTFTKLCDDNENFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEEDHVTENGN 259          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000028630.1 (SMESG000028630.1)

HSP 1 Score: 282.722 bits (722), Expect = 2.856e-94
Identity = 133/254 (52.36%), Postives = 171/254 (67.32%), Query Frame = 2
Query:   89 FEIGEVRSPKDSDFVTFTKLCDDNE-DFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTE 847
             ++GE++ P D  F    KL  DN  D++  YNK ++ + VK+TSYS FK+ K     ++ A  +Y+ LHD +YR  WD+N++EGFQI  V  NSDI YYA+KSP  FKNRDF+TQRCWRV  NEF IFNHSVFHK YPPKK FVR +SYVTGYL++ I EN +E TY+TQS+PRG IP+WAINK A+  +PK+  R  KA   YP WKK +NP++ PW N         +  DIL QPD D+A  ++E    E
Sbjct:    3 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKE 256          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000037645.1 (SMESG000037645.1)

HSP 1 Score: 259.61 bits (662), Expect = 2.293e-86
Identity = 134/186 (72.04%), Postives = 144/186 (77.42%), Query Frame = 2
Query:  299 ADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTENGN 856
             + RS  D + +   ++C    N D  Y          N++ V+      S + F +F      KAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTENGN
Sbjct:    7 GEVRSPKDSDFVTFTKLCDDNENFDEVY----------NKNDVSVFVKSTSYSSFKMF------KAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTENGN 176          

HSP 2 Score: 112.079 bits (279), Expect = 2.830e-29
Identity = 54/55 (98.18%), Postives = 55/55 (100.00%), Query Frame = 2
Query:   80 MKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFK 244
            MKHFEIGEVRSPKDSDFVTFTKLCDDNE+FDEVYNKNDVSVFVKSTSYSSFKMFK
Sbjct:    1 MKHFEIGEVRSPKDSDFVTFTKLCDDNENFDEVYNKNDVSVFVKSTSYSSFKMFK 55          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000048192.1 (SMESG000048192.1)

HSP 1 Score: 258.07 bits (658), Expect = 2.560e-84
Identity = 122/257 (47.47%), Postives = 171/257 (66.54%), Query Frame = 2
Query:   80 MKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILK-VNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEENHVTE 847
            M  F +G+VR   DSD   F  +CD++E +    NK D+ ++ K    S FK+ K++  LK V A VMY+ LHD DYR  WD+ +++   IC +  N+DIGYYA+KSP  FKNRDFVTQR W  +  E+ IFNHSVFHK  PP+K F+RAIS++TGYL++P+ +N   +TYV Q +PRG +P+WA+NKA ++V PK++ R  KAA+ YPAWKK++NP+  PW        P IN++ I+  PD      ++E+ VTE
Sbjct:    1 MPFFGVGDVRVADDSDMKYFMSICDNHEGWTLEVNKPDLQIWCKPAPESDFKIVKLKANLKDVAANVMYDVLHDPDYRRIWDRGMIKSKDICMINPNNDIGYYALKSPPPFKNRDFVTQRSWLQTSTEYVIFNHSVFHKEMPPQKSFIRAISHLTGYLIKPLPDNGCVLTYVAQCDPRGKLPAWAVNKATQYVAPKVITRLLKAAVKYPAWKKKHNPDLKPWLYPEQLKIPRINFDHIIATPDFQDNT-LDESGVTE 256          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000061896.1 (SMESG000061896.1)

HSP 1 Score: 58.9214 bits (141), Expect = 3.211e-9
Identity = 42/159 (26.42%), Postives = 80/159 (50.31%), Query Frame = 2
Query:  233 KMFKVRGILKVNALVMY-NTLHDADYRSTWDKNLMEGFQICRVESNSDIGY----YAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAI 694
            KM+K+   L V A V+Y + ++ A+   +W+  +    +I ++  N+DI Y     AMK  ++   RDFV  R W  S N++ I+  S  H+  PP+   VR    +   LL   + + T+  ++   + + +I    ++K  K V+ +++H  ++  I
Sbjct:  371 KMYKIECFLNVAADVIYKDMVYHAENTPSWNPQVRTVKKIEKISENADIIYNVSNEAMKGYIS--ARDFVLLRVWGSSLNKYHIYTTSFTHQDCPPQPNIVRGDYGIGIILLEKTEGDLTKCIWIINYDIKVNIYRAILDKVMKSVLLEMIHNLKQHCI 527          
The following BLAST results are available for this feature:
BLAST of START domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STARD104.509e-5535.46StAR related lipid transfer domain containing 10 [... [more]
STARD104.509e-5535.46StAR related lipid transfer domain containing 10 [... [more]
STARD101.081e-5338.14StAR related lipid transfer domain containing 10 [... [more]
STARD101.368e-4938.27StAR related lipid transfer domain containing 10 [... [more]
STARD102.129e-4938.27StAR related lipid transfer domain containing 10 [... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
T28D6.71.276e-5336.94pep chromosome:WBcel235:III:11344255:11346789:-1 g... [more]
strl-17.802e-828.75Steroidogenic acute regulatory-like protein 1 [So... [more]
strl-17.802e-828.75Steroidogenic acute regulatory-like protein 1 [So... [more]
strl-19.933e-828.75Steroidogenic acute regulatory-like protein 1 [So... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG65654.800e-627.46gene:FBgn0032513 transcript:FBtr0342631[more]
CG65654.800e-627.46gene:FBgn0032513 transcript:FBtr0080468[more]
CG65654.800e-627.46gene:FBgn0032513 transcript:FBtr0346420[more]
back to top
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stard151.790e-6640.56StAR-related lipid transfer (START) domain contain... [more]
stard143.023e-6141.63START domain containing 14 [Source:ZFIN;Acc:ZDB-GE... [more]
stard143.440e-6141.63START domain containing 14 [Source:ZFIN;Acc:ZDB-GE... [more]
stard143.440e-6141.63START domain containing 14 [Source:ZFIN;Acc:ZDB-GE... [more]
stard101.799e-5438.89StAR-related lipid transfer (START) domain contain... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000038456.13.157e-6339.30uncharacterized LOC100145115 [Source:NCBI gene;Acc... [more]
nr2f62.606e-6240.40nuclear receptor subfamily 2 group F member 6 [Sou... [more]
stard107.923e-5937.80StAR related lipid transfer domain containing 10 [... [more]
stard73.025e-620.09StAR related lipid transfer domain containing 7 [S... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stard105.378e-5736.65START domain containing 10 [Source:MGI Symbol;Acc:... [more]
Stard105.378e-5736.65START domain containing 10 [Source:MGI Symbol;Acc:... [more]
Stard105.378e-5736.65START domain containing 10 [Source:MGI Symbol;Acc:... [more]
Stard102.215e-5636.65START domain containing 10 [Source:MGI Symbol;Acc:... [more]
Stard101.009e-5039.29START domain containing 10 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of START domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JMD3|STA10_MOUSE3.762e-5636.65START domain-containing protein 10 OS=Mus musculus... [more]
sp|Q9Y365|STA10_HUMAN2.165e-5435.46START domain-containing protein 10 OS=Homo sapiens... [more]
sp|P53808|PPCT_MOUSE1.073e-1025.67Phosphatidylcholine transfer protein OS=Mus muscul... [more]
sp|Q9UKL6|PPCT_HUMAN8.260e-925.41Phosphatidylcholine transfer protein OS=Homo sapie... [more]
sp|P53809|PPCT_RAT1.096e-823.12Phosphatidylcholine transfer protein OS=Rattus nor... [more]
back to top
BLAST of START domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KSW88.731e-8148.26PCTP-like protein OS=Clonorchis sinensis OX=79923 ... [more]
A0A4S2MEF21.145e-8048.26START domain-containing protein OS=Opisthorchis fe... [more]
A0A504YIN51.459e-7644.44Putative Phosphatidylcholine transfer protein OS=F... [more]
A0A4E0RF402.299e-7644.44Putative Phosphatidylcholine transfer protein OS=F... [more]
A0A4S2L6589.214e-7644.05START domain-containing protein OS=Opisthorchis fe... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
stard157.557e-6639.68START domain-containing protein 10-like [Source:NC... [more]
stard141.075e-6440.48START domain-containing protein 10-like [Source:NC... [more]
stard103.584e-5640.28StAR related lipid transfer domain containing 10 [... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stard102.332e-5541.28StAR-related lipid transfer (START) domain contain... [more]
dlc12.284e-725.69DLC1 Rho GTPase activating protein [Source:ZFIN;Ac... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of START domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO390003.658e-6640.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425118.017e-827.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463032.910e-724.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stard152.788e-5937.75START domain-containing protein 10 [Source:NCBI ge... [more]
stard156.355e-5937.75START domain-containing protein 10 [Source:NCBI ge... [more]
stard142.760e-5738.37START domain-containing protein 10 [Source:NCBI ge... [more]
stard107.034e-5134.66StAR related lipid transfer domain containing 10 [... [more]
stard102.100e-4738.27StAR related lipid transfer domain containing 10 [... [more]
back to top
BLAST of START domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046413.10.000e+099.23SMESG000046413.1[more]
SMESG000028630.12.856e-9452.36SMESG000028630.1[more]
SMESG000037645.12.293e-8672.04SMESG000037645.1[more]
SMESG000048192.12.560e-8447.47SMESG000048192.1[more]
SMESG000061896.13.211e-926.42SMESG000061896.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022574 ID=SMED30022574|Name=START domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1122bp
ATTTGTTTAAGCACTTCAACATTGCAATAATTACTAATAACACTATTTAA
ATTAGAAACCAAAATTAATCAGTTGAGAAATGAAACATTTCGAAATCGGT
GAAGTGAGAAGTCCGAAAGACTCAGATTTTGTCACATTTACCAAACTTTG
CGACGACAACGAAGATTTCGATGAAGTTTATAACAAAAATGATGTTTCAG
TTTTCGTCAAATCGACCAGTTATAGTTCTTTTAAAATGTTTAAGGTGCGC
GGAATATTGAAAGTGAACGCGTTGGTTATGTATAACACTCTTCATGATGC
GGACTATCGAAGCACTTGGGACAAGAATTTAATGGAGGGATTTCAGATTT
GTAGAGTGGAATCGAACAGCGATATCGGATATTATGCAATGAAATCTCCG
TTGGCCTTCAAGAATAGAGATTTTGTCACTCAGAGGTGTTGGAGAGTTAG
CGACAATGAATTCGCAATTTTCAATCACTCAGTATTTCATAAGGCATATC
CTCCTAAAAAACAATTCGTGAGAGCTATTTCCTACGTTACTGGATATTTA
TTACGACCTATAGACGAAAATACAACTGAAATGACTTATGTCACCCAGTC
CAATCCTAGAGGTTCAATTCCATCTTGGGCTATAAATAAAGCTGCCAAAT
TTGTGGTCCCAAAAATTGTACATCGATTTCAGAAGGCTGCTATACATTAT
CCTGCTTGGAAAAAGCAAAACAATCCGAATTTTATGCCTTGGAGCAATAT
GGGAGTTTGGACAACGCCAATGATCAATTGGAACGACATCCTATTTCAAC
CGGATGTAGATATAGCAGTGAATGTTGAAGAAAACCATGTCACAGAAAAT
GGAAACGATATAGATGATTTAGACATAGATTAATACTCATAGCTTATCCG
ATAAATTATCGTGATTTTAAGACTAGATGATAGAGCCTTTTGAGAATTTT
TTATATTTATTTTAAATTATCATATGTACAAAAGTAATACTTTTTGACAT
TTTACTGATAAGTATTGCTTTTGTATGTATGTTCACAGACTTGTCAATGC
AATAAAATACACGATCCATCTATAAATAGTAACTTACAATTTATATGCAA
TAAGCAAGCGATTCAAGTGAAA
back to top

protein sequence of SMED30022574-orf-1

>SMED30022574-orf-1 ID=SMED30022574-orf-1|Name=SMED30022574-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=268bp
MKHFEIGEVRSPKDSDFVTFTKLCDDNEDFDEVYNKNDVSVFVKSTSYSS
FKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIG
YYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAI
SYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRF
QKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVE
ENHVTENGNDIDDLDID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR041951STARD10_START
IPR002913START_lipid-bd_dom
IPR023393START-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0008289lipid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002913START domainSMARTSM00234START_1coord: 8..211
e-value: 1.9E-15
score: 67.3
IPR002913START domainPFAMPF01852STARTcoord: 27..202
e-value: 1.4E-27
score: 96.5
IPR002913START domainPROSITEPS50848STARTcoord: 54..209
score: 30.215
IPR023393START-like domain superfamilyGENE3DG3DSA:3.30.530.20coord: 7..212
e-value: 3.8E-47
score: 162.6
NoneNo IPR availablePANTHERPTHR19308PHOSPHATIDYLCHOLINE TRANSFER PROTEINcoord: 9..263
NoneNo IPR availablePANTHERPTHR19308:SF2SI:DKEYP-110E4.11coord: 9..263
NoneNo IPR availableSUPERFAMILYSSF55961Bet v1-likecoord: 12..204
IPR041951STARD10, START domainCDDcd08871START_STARD10-likecoord: 6..223
e-value: 6.60768E-113
score: 322.283