Ras-related protein Rab-27A

Overview
NameRas-related protein Rab-27A
Smed IDSMED30022570
Length (bp)1157
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-27A (SMED30022570) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-27A (SMED30022570) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-27A (SMED30022570) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-27A (SMED30022570) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022570

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022570SMESG000014812.1 dd_Smed_v4_3594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022570SMESG000014812.1 dd_Smed_v4_3594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022570SMESG000014812.1 dd_Smed_v4_3594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30022570SMESG000014812.1 dd_Smed_v4_3594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022570SMESG000014812.1 dd_Smed_v4_3594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022570SMESG000014812.1 dd_Smed_v4_3594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 242.662 bits (618), Expect = 1.280e-78
Identity = 109/204 (53.43%), Postives = 154/204 (75.49%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ ++  +G  G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA  LAE  GIPY ETSA +  N+ +A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 242.662 bits (618), Expect = 1.280e-78
Identity = 109/204 (53.43%), Postives = 154/204 (75.49%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ ++  +G  G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA  LAE  GIPY ETSA +  N+ +A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 242.662 bits (618), Expect = 1.280e-78
Identity = 109/204 (53.43%), Postives = 154/204 (75.49%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ ++  +G  G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA  LAE  GIPY ETSA +  N+ +A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 242.662 bits (618), Expect = 1.280e-78
Identity = 109/204 (53.43%), Postives = 154/204 (75.49%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ ++  +G  G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA  LAE  GIPY ETSA +  N+ +A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27B (RAB27B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9767])

HSP 1 Score: 240.35 bits (612), Expect = 1.002e-77
Identity = 105/201 (52.24%), Postives = 155/201 (77.11%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+N+   NG  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A +LA+  GIPY ETSA + +NVEKA + ++ ++MKR+E+ ++K  +P     G S     E      C C
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: aex-6 (Rab27 [Source:UniProtKB/TrEMBL;Acc:G5EBS5])

HSP 1 Score: 232.646 bits (592), Expect = 3.875e-75
Identity = 111/200 (55.50%), Postives = 151/200 (75.50%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCA 754
            S VGKTS LHRYTD+ F+ +F+STVG+DFK+K++V+ S+         + L LQLWDTAGQERFRSL+ AFFRDAMGF+L+FD+TNEQSFL+IR+W++ L+ HAYC+ PD+I+ GNK DLE  RQVS   A+ LA+ LG+PY ETSA ++ NVEK+ D ++ +VM+RI++S++ + LP+    GVSL     S  +S CA
Sbjct:   16 SGVGKTSFLHRYTDNTFTGQFISTVGIDFKEKKVVYKSSRGGFGGRGQRVL-LQLWDTAGQERFRSLTTAFFRDAMGFILIFDITNEQSFLNIRDWLSQLKVHAYCEQPDIIICGNKADLENRRQVSTARAKQLADQLGLPYFETSACTSTNVEKSVDCLLDLVMQRIQQSVETSSLPLSECRGVSL-DGDPSAASSYCA 213          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 161.384 bits (407), Expect = 1.726e-47
Identity = 78/202 (38.61%), Postives = 130/202 (64.36%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLK-QKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K +              ++++LQ+WDTAGQER+R+++ A++R AMGF+L++D+TNE+SF  +++W T ++++++ +   ++LVGNK D++  R VS      LA+ LG+ + ETSA    NV+  F+++V ++  ++  S+DK+  P ++P G  L+   ++      C C
Sbjct:   31 SSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGD----------KRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSW-ENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKD--PQQQPKGQKLEANPTQKPAQQQCNC 219          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 161.77 bits (408), Expect = 2.053e-47
Identity = 78/202 (38.61%), Postives = 130/202 (64.36%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLK-QKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K +              ++++LQ+WDTAGQER+R+++ A++R AMGF+L++D+TNE+SF  +++W T ++++++ +   ++LVGNK D++  R VS      LA+ LG+ + ETSA    NV+  F+++V ++  ++  S+DK+  P ++P G  L+   ++      C C
Sbjct:   45 SSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGD----------KRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSW-ENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKD--PQQQPKGQKLEANPTQKPAQQQCNC 233          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 151.369 bits (381), Expect = 8.768e-44
Identity = 73/171 (42.69%), Postives = 114/171 (66.67%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERS 667
            S VGKT +L R++DD F+  F+ST+G+DFK + I  +           +K++LQ+WDTAGQERFR+++ A++R AMG +LV+D+TNE+SF +I+NW+  +  HA  D   MI +GNK D+EE R+VS    E LA   G  ++ETSA +  N+++AF  +   +  ++E++
Sbjct:   17 SGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDG----------KKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMI-IGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKMEQN 176          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 151.369 bits (381), Expect = 8.768e-44
Identity = 73/171 (42.69%), Postives = 114/171 (66.67%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERS 667
            S VGKT +L R++DD F+  F+ST+G+DFK + I  +           +K++LQ+WDTAGQERFR+++ A++R AMG +LV+D+TNE+SF +I+NW+  +  HA  D   MI +GNK D+EE R+VS    E LA   G  ++ETSA +  N+++AF  +   +  ++E++
Sbjct:   17 SGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDG----------KKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMI-IGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKMEQN 176          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab27 (gene:FBgn0025382 transcript:FBtr0070294)

HSP 1 Score: 193.356 bits (490), Expect = 1.484e-59
Identity = 89/169 (52.66%), Postives = 124/169 (73.37%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIE 661
            S VGKT LL++YTD  F  +F+STVG+DF++KR+++NS       G+  ++ LQ+WDTAGQERFRSL+ AF+RDAMGFLL+FD+T+E+SFL   NW++ LR+HAY + PD++L GNK DL + R VS  +   L     +PYIETSA +  NV++A + +V  VM+RIE
Sbjct:   20 SGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSR------GRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIE 182          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab27 (gene:FBgn0025382 transcript:FBtr0070293)

HSP 1 Score: 192.971 bits (489), Expect = 2.260e-59
Identity = 89/169 (52.66%), Postives = 124/169 (73.37%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIE 661
            S VGKT LL++YTD  F  +F+STVG+DF++KR+++NS       G+  ++ LQ+WDTAGQERFRSL+ AF+RDAMGFLL+FD+T+E+SFL   NW++ LR+HAY + PD++L GNK DL + R VS  +   L     +PYIETSA +  NV++A + +V  VM+RIE
Sbjct:   26 SGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSR------GRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIE 188          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0473383)

HSP 1 Score: 168.318 bits (425), Expect = 5.471e-50
Identity = 82/202 (40.59%), Postives = 131/202 (64.85%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKN-ILPVRRPIGVSLKQKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K +  +           ++++LQ+WDTAGQER+R+++ A++R AMGF+L++DVTNE SF  +++WVT ++++++ D   +ILVGNK D+E+ R +SF+    LA+ LG+ + ETSA    NV+  F+++V ++  ++  S+D +  L      G  L  + +   N+ C C
Sbjct:   30 SSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHD----------KRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSW-DNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0088257)

HSP 1 Score: 168.318 bits (425), Expect = 5.471e-50
Identity = 82/202 (40.59%), Postives = 131/202 (64.85%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKN-ILPVRRPIGVSLKQKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K +  +           ++++LQ+WDTAGQER+R+++ A++R AMGF+L++DVTNE SF  +++WVT ++++++ D   +ILVGNK D+E+ R +SF+    LA+ LG+ + ETSA    NV+  F+++V ++  ++  S+D +  L      G  L  + +   N+ C C
Sbjct:   30 SSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHD----------KRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSW-DNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 150.214 bits (378), Expect = 2.861e-43
Identity = 74/178 (41.57%), Postives = 118/178 (66.29%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP 688
            S VGKT +L R+++D F+  F+ST+G+DFK + I  ++          +K++LQ+WDTAGQERFR+++ A++R AMG +LV+D+T E+SF +I+NW+  +  +A  D   M+L GNK +L + RQVS +  E LA   GI ++ETSA ++ NVE+AF  +   +  + E+ ++ N  P
Sbjct:   17 SGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDN----------KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLL-GNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPP 183          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 241.891 bits (616), Expect = 1.981e-78
Identity = 110/205 (53.66%), Postives = 155/205 (75.61%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP--VRRPIGVSLKQKSESE--KNSGCAC 757
            S VGKTS L++YTD +F+ KF++TVG+DF++KR+V+ S+  +G  G+ Q++ +QLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L++HAYC+ PD++L GNK DLEE R V  + A +LAE  G+PY ETSA + ENV +A + ++ ++MKR+ER +DK+ +P    R  G S    +E    + S CAC
Sbjct:   18 SGVGKTSFLYQYTDSKFNSKFITTVGIDFREKRVVYKSSGPDGTAGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQTHAYCENPDIVLCGNKSDLEEQRAVKAENARELAEKYGVPYFETSAANGENVSRAVEVLLDLIMKRMERCVDKSWIPDGTVRSNGHSTADLTEPHDPEQSKCAC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27b (RAB27B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-120215-85])

HSP 1 Score: 237.269 bits (604), Expect = 1.217e-76
Identity = 106/201 (52.74%), Postives = 154/201 (76.62%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+ +N+ NG  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++LVGNK DL + R+V  K+A++LA+  GIPY ETSA +   V+KA   ++ +VMKR+E+ ++K         G S K  +   +   CAC
Sbjct:   25 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYTTNSPNGTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGSEVDKAVVTLLDLVMKRMEQCVEKPSADANTSDGSS-KLSAAPAQQKKCAC 224          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27b (RAB27B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-120215-85])

HSP 1 Score: 237.269 bits (604), Expect = 1.284e-76
Identity = 106/201 (52.74%), Postives = 154/201 (76.62%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+ +N+ NG  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++LVGNK DL + R+V  K+A++LA+  GIPY ETSA +   V+KA   ++ +VMKR+E+ ++K         G S K  +   +   CAC
Sbjct:   25 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYTTNSPNGTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGSEVDKAVVTLLDLVMKRMEQCVEKPSADANTSDGSS-KLSAAPAQQKKCAC 224          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab3da (RAB3D, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-080722-14])

HSP 1 Score: 168.318 bits (425), Expect = 6.214e-50
Identity = 80/201 (39.80%), Postives = 130/201 (64.68%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K +  N           ++++LQ+WDTAGQER+R+++ A++R AMGFLL++D+TN+ SF  +++W T ++++++ D   +ILVGNK DLE+ R V+ ++ + LA  LG  + E SA    NV++ F+++V ++  ++  S+D +   +    G SL+      ++ GC C
Sbjct:   34 SSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNE----------KRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDITNQDSFYAVQDWATQIKTYSW-DNAQVILVGNKCDLEDDRLVAREDGQRLANELGFQFFEASAKDNINVKQVFERLVDIICDKMNESLDTDPSILTNQKGPSLQDTPPDGQSGGCGC 223          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab3db (RAB3D, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-040718-428])

HSP 1 Score: 166.392 bits (420), Expect = 3.716e-49
Identity = 84/201 (41.79%), Postives = 131/201 (65.17%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K +  N+          ++++LQ+WDTAGQER+R+++ A++R AMGFLL+FD+TN  SF  +R+W T ++++++ D   +ILVGNK DLE+ R +  ++++ LA  LG  + E SA  + NV++ F+ +V ++  ++  S+D +   V      SL Q +  E +S CAC
Sbjct:   33 SSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNN----------KRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMFDITNRDSFNAVRDWATQIKTYSW-DNAQVILVGNKCDLEDERLIPTEDSQRLAHELGFQFFEASAKDSINVKQVFECLVDVICDKMTESLDGDA-AVSNHKDCSL-QDAADEGHSACAC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: lemd3 (LEM domain containing 3 [Source:Xenbase;Acc:XB-GENE-486033])

HSP 1 Score: 240.35 bits (612), Expect = 7.804e-78
Identity = 104/201 (51.74%), Postives = 157/201 (78.11%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+++++    G  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A++LA+  GIPY ETSA S ++VEK+ D ++ ++MKR+E+ +DK  +P     G S K      +   CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVIYSNAGPGGTHGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQAKELADKYGIPYFETSAASGQDVEKSVDTLLDLIMKRMEQCVDKTQVPDAVNGGTSGKLDEAKPEGRKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: lemd3 (LEM domain containing 3 [Source:Xenbase;Acc:XB-GENE-486033])

HSP 1 Score: 239.58 bits (610), Expect = 3.289e-76
Identity = 104/201 (51.74%), Postives = 157/201 (78.11%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+++++    G  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A++LA+  GIPY ETSA S ++VEK+ D ++ ++MKR+E+ +DK  +P     G S K      +   CAC
Sbjct:  108 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVIYSNAGPGGTHGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQAKELADKYGIPYFETSAASGQDVEKSVDTLLDLIMKRMEQCVDKTQVPDAVNGGTSGKLDEAKPEGRKCAC 308          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:493339])

HSP 1 Score: 233.417 bits (594), Expect = 5.082e-75
Identity = 112/204 (54.90%), Postives = 156/204 (76.47%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP--VRRPIGVSLKQKSESEKNSG-CAC 757
            S VGKTS L++YTD +F+ KF++TVG+DF++KR+V+ SN  +G+ G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DL+E R V  +EA++ AE  GIPY ETSA    NV KA + ++ ++MKR+ER +DK+ +P  V +  G S  ++   EK+ G C C
Sbjct:   18 SGVGKTSFLYQYTDAKFNSKFITTVGIDFREKRVVYRSNGPDGISGRGQRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQVHAYCENPDIVLCGNKCDLDEQRAVKEEEAKEFAEKYGIPYFETSAAIGTNVNKAVETLLDLIMKRMERCVDKSWIPQGVVQSNGHSSTEQLTEEKDKGKCGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:493339])

HSP 1 Score: 222.246 bits (565), Expect = 7.232e-71
Identity = 101/174 (58.05%), Postives = 141/174 (81.03%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDK 676
            S VGKTS L++YTD +F+ KF++TVG+DF++KR+V+ SN  +G+ G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DL+E R V  +EA++ AE  GIPY ETSA    NV KA + ++ ++MKR+ER++ +
Sbjct:   18 SGVGKTSFLYQYTDAKFNSKFITTVGIDFREKRVVYRSNGPDGISGRGQRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQVHAYCENPDIVLCGNKCDLDEQRAVKEEEAKEFAEKYGIPYFETSAAIGTNVNKAVETLLDLIMKRMERNLGQ 191          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 164.081 bits (414), Expect = 2.756e-48
Identity = 83/194 (42.78%), Postives = 129/194 (66.49%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP-VRRPIGVSLKQKSES 733
            S VGKT LL R+++D F+  F+ST+G+DFK + I  +           +K++LQ+WDTAGQERFR+++ A++R AMG +LV+D+TNE+SF +I+NW+  +  HA  D   MIL GNK D+ + RQVS ++ E LA   GI ++ETSA S+ NVE+AF  +   +M ++ R ++++I P    P+ ++ K   +S
Sbjct:   17 SGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDG----------KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMIL-GNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEAFFTLARDIMTKLNRKMNESISPGGGGPVKITEKSSKKS 199          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27a (RAB27A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1861441])

HSP 1 Score: 246.128 bits (627), Expect = 4.042e-80
Identity = 110/204 (53.92%), Postives = 155/204 (75.98%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ +N  +G +G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA +LAE  GIPY ETSA +  N+  A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27a (RAB27A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1861441])

HSP 1 Score: 246.128 bits (627), Expect = 4.042e-80
Identity = 110/204 (53.92%), Postives = 155/204 (75.98%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ +N  +G +G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA +LAE  GIPY ETSA +  N+  A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 241.891 bits (616), Expect = 1.476e-78
Identity = 105/201 (52.24%), Postives = 157/201 (78.11%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+++   +G  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A +LAE  GIPY ETSA + +NVEK+ + ++ ++MKR+E+ ++K  +P     G S K   E      CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 241.891 bits (616), Expect = 1.476e-78
Identity = 105/201 (52.24%), Postives = 157/201 (78.11%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+++   +G  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A +LAE  GIPY ETSA + +NVEK+ + ++ ++MKR+E+ ++K  +P     G S K   E      CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 241.891 bits (616), Expect = 1.476e-78
Identity = 105/201 (52.24%), Postives = 157/201 (78.11%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+++   +G  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A +LAE  GIPY ETSA + +NVEK+ + ++ ++MKR+E+ ++K  +P     G S K   E      CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|P23640|RB27A_RAT (Ras-related protein Rab-27A OS=Rattus norvegicus OX=10116 GN=Rab27a PE=1 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.397e-79
Identity = 110/204 (53.92%), Postives = 156/204 (76.47%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ +N  +G +G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA +LAE  GIPY ETSA +  N+ +A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGTVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSTDQLSEEKEKGLCGC 221          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q9ERI2|RB27A_MOUSE (Ras-related protein Rab-27A OS=Mus musculus OX=10090 GN=Rab27a PE=1 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 2.827e-79
Identity = 110/204 (53.92%), Postives = 155/204 (75.98%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ +N  +G +G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA +LAE  GIPY ETSA +  N+  A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC 221          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|P51159|RB27A_HUMAN (Ras-related protein Rab-27A OS=Homo sapiens OX=9606 GN=RAB27A PE=1 SV=3)

HSP 1 Score: 242.662 bits (618), Expect = 6.145e-78
Identity = 109/204 (53.43%), Postives = 154/204 (75.49%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ ++  +G  G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R V  +EA  LAE  GIPY ETSA +  N+ +A + ++ ++MKR+ER +DK+ +P   VR     S  Q SE ++   C C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q8HZJ5|RB27B_BOVIN (Ras-related protein Rab-27B OS=Bos taurus OX=9913 GN=RAB27B PE=2 SV=3)

HSP 1 Score: 241.891 bits (616), Expect = 1.010e-77
Identity = 106/201 (52.74%), Postives = 154/201 (76.62%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+ +N+   NG  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A DLAE   IPY ETSA + +NVEKA + ++ ++MKR+E+ ++K  +P       S K   E      CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVAYNTQGPNGPTGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARDLAEKYSIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTHIPDTVNGSSSGKLDGEKSAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q99P58|RB27B_MOUSE (Ras-related protein Rab-27B OS=Mus musculus OX=10090 GN=Rab27b PE=1 SV=3)

HSP 1 Score: 241.891 bits (616), Expect = 1.033e-77
Identity = 105/201 (52.24%), Postives = 157/201 (78.11%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+++   +G  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A +LAE  GIPY ETSA + +NVEK+ + ++ ++MKR+E+ ++K  +P     G S K   E      CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: A0A267EWZ8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023845g1 PE=4 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 9.487e-83
Identity = 122/201 (60.70%), Postives = 161/201 (80.10%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+LL++YTD  F+PKFVSTVG+DF+QKR++H S   +GV+G+SQ++ LQLWDTAGQERFRSLS AFFRDAMGFLLVFD+T+ QSF+ IRNW+T+L+++AYC+ PD+ILVGNK DLE  R VS +EA+ LA+ L IPY+ETSA +   V  A ++++ +VM RIE+S+DK+ LP++R    S K+   S K SGCAC
Sbjct:   45 SGVGKTALLYQYTDGTFNPKFVSTVGIDFRQKRVIHRSQVSDGVIGESQRVHLQLWDTAGQERFRSLSTAFFRDAMGFLLVFDLTSNQSFMDIRNWLTLLQTNAYCERPDIILVGNKRDLESQRVVSSEEAQKLADELNIPYVETSAATGYKVTDAVEKLLDLVMLRIEQSVDKSQLPIKR----SNKRNVGSGKQSGCAC 241          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: A0A1I8H4D7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.096e-82
Identity = 122/201 (60.70%), Postives = 161/201 (80.10%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+LL++YTD  F+PKFVSTVG+DF+QKR++H S   +GV+G+SQ++ LQLWDTAGQERFRSLS AFFRDAMGFLLVFD+T+ QSF+ IRNW+T+L+++AYC+ PD+ILVGNK DLE  R VS +EA+ LA+ L IPY+ETSA +   V  A ++++ +VM RIE+S+DK+ LP++R    S K+   S K SGCAC
Sbjct:   34 SGVGKTALLYQYTDGTFNPKFVSTVGIDFRQKRVIHRSQVSDGVIGESQRVHLQLWDTAGQERFRSLSTAFFRDAMGFLLVFDLTSNQSFMDIRNWLTLLQTNAYCERPDIILVGNKRDLESQRVVSSEEAQKLADELNIPYVETSAATGYKVTDAVEKLLDLVMLRIEQSVDKSQLPIKR----SNKRNVGSGKQSGCAC 230          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: G5B2P7 (Ras-related protein Rab-27A OS=Heterocephalus glaber OX=10181 GN=GW7_05492 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 6.354e-79
Identity = 111/203 (54.68%), Postives = 157/203 (77.34%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP--VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ ++  +G LG+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW+T L+ HAYCD PD++L GNK DLE+ R V  +EA  LAE  G+PY ETSA +  N+  A + ++ ++MKR+ER +DK+ +P  V R  G+    +   E+N+GC+C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGLDGALGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWITQLQMHAYCDNPDIVLCGNKSDLEDQRVVKEEEARALAEKYGVPYFETSAANGTNISPAIEGLLDLIMKRMERCVDKSWVPEGVVRSNGLPFADRPGEERNAGCSC 220          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: F6RY29 (RAB27B, member RAS oncogene family OS=Ornithorhynchus anatinus OX=9258 GN=RAB27B PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.371e-78
Identity = 110/201 (54.73%), Postives = 157/201 (78.11%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+NS   NG  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++L+GNK DL + R+V+ ++A DLA+  G+PY ETSA + +NVEKA D ++ ++MKR+E+ +DK  +P     G S K   E      CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNSRGPNGSPGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQARDLADKYGLPYFETSAATGQNVEKAVDTLLDLIMKRMEQCVDKTQVPDAANGGNSGKLDGEKPAAKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: L5K264 (Ras-related protein Rab-27A OS=Pteropus alecto OX=9402 GN=PAL_GLEAN10023451 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.944e-78
Identity = 112/204 (54.90%), Postives = 157/204 (76.96%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP---VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS+L++YTD +F+ KF++TVG+DF++KR+V+ +N  +G +G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DLEE R V  +EA  LAE  GIPY ETSA +  N+ +A + ++ ++MKR++R +DK+ +P   VR     S  Q SE +K S C+C
Sbjct:   18 SGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAIGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQVHAYCENPDIVLCGNKSDLEEQRVVKEEEARGLAEKYGIPYFETSAANGTNISEAIEMLLDLIMKRMQRCVDKSWIPEGVVRSNGHTSTDQLSEGKKKSSCSC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:103047190])

HSP 1 Score: 239.965 bits (611), Expect = 9.102e-78
Identity = 110/205 (53.66%), Postives = 157/205 (76.59%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP--VRRPIGVSLKQKSE--SEKNSGCAC 757
            S VGKTS L++YTD +F+ KF++TVG+DF++KR+V+ S+  +G  G+ Q++ +QLWDTAGQERFRSL+ AFFRDAMGFLL+FD++NEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R VS +EA +LAE  GIPY ETSA + ENV +A + ++ ++MKR+ER +D++ +P    R  G S  +  E  + + S CAC
Sbjct:   18 SGVGKTSFLYQYTDGKFNSKFITTVGIDFREKRVVYKSSGPDGTPGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLSNEQSFLNVRNWMSQLQMHAYCENPDIVLCGNKCDLEDQRAVSEEEARELAEKYGIPYFETSAANGENVSRAVEVLLDLIMKRMERCVDRSWIPDGTMRSNGHSGSELVEPPTPEKSKCAC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:103047190])

HSP 1 Score: 239.965 bits (611), Expect = 9.102e-78
Identity = 110/205 (53.66%), Postives = 157/205 (76.59%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP--VRRPIGVSLKQKSE--SEKNSGCAC 757
            S VGKTS L++YTD +F+ KF++TVG+DF++KR+V+ S+  +G  G+ Q++ +QLWDTAGQERFRSL+ AFFRDAMGFLL+FD++NEQSFL++RNW++ L+ HAYC+ PD++L GNK DLE+ R VS +EA +LAE  GIPY ETSA + ENV +A + ++ ++MKR+ER +D++ +P    R  G S  +  E  + + S CAC
Sbjct:   18 SGVGKTSFLYQYTDGKFNSKFITTVGIDFREKRVVYKSSGPDGTPGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLSNEQSFLNVRNWMSQLQMHAYCENPDIVLCGNKCDLEDQRAVSEEEARELAEKYGIPYFETSAANGENVSRAVEVLLDLIMKRMERCVDRSWIPDGTMRSNGHSGSELVEPPTPEKSKCAC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27b (RAB27B, member RAS oncogene family [Source:NCBI gene;Acc:103022885])

HSP 1 Score: 236.884 bits (603), Expect = 1.098e-76
Identity = 107/202 (52.97%), Postives = 156/202 (77.23%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVS-LKQKSESEKNSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+++N+ NG  GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++LVGNK DL + R+V  K+A++LA+  GIPY ETSA +   V+KA   ++ +VMKR+E+ ++K     +     S L     +EK   CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYSTNSPNGTTGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGAQVDKAVVTLLDLVMKRMEQCVEKPTADAQNTDAASKLTAAPAAEKK--CAC 217          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: pld6 (GTP-binding protein Rab-3D-like [Source:NCBI gene;Acc:103040938])

HSP 1 Score: 167.548 bits (423), Expect = 1.350e-49
Identity = 82/201 (40.80%), Postives = 131/201 (65.17%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K +  N           ++++LQ+WDTAGQER+R+++ A++R AMGFLL++D+TN++SF  +++W T ++++++ D   +ILVGNK DLE+ R V+ ++ + LA  LG  + E SA    NV++ F+++V ++  ++  S+D     +    G SL Q +     SGC+C
Sbjct:   34 SSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNE----------KRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDITNQESFYAVQDWATQIKTYSW-DNAQVILVGNKCDLEDDRLVATEDGQRLANELGFQFFEASAKDNINVKQVFERLVDVICDKMNESMDGEPSQMTNHKGPSL-QDTPPAGQSGCSC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 164.081 bits (414), Expect = 2.049e-48
Identity = 79/201 (39.30%), Postives = 127/201 (63.18%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S+VGKTSLL R+ DD F+P FVSTVG+DFK K +  N+          ++++LQ+WDTAGQER+R+++ A++R AMGF+L++D+TNE+SF  +++W T ++++++ +   +ILVGNK D+EE R VS      LAE LG  + ETSA    N+ + F ++V ++  ++  ++D +           L  +      S C+C
Sbjct:   28 SSVGKTSLLFRFADDAFTPAFVSTVGIDFKIKTLYKNN----------KRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSW-ENAQVILVGNKCDMEEERIVSVDSGRLLAEQLGFEFYETSAKDNINITQTFQRLVDIICDKMPDTLDSDPAGPTGSATTKLTDQPAPPPQSDCSC 217          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 210.305 bits (534), Expect = 5.372e-67
Identity = 91/178 (51.12%), Postives = 138/178 (77.53%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP 688
            S VGK+SLL +YT+  F  K+++TVG+DF++KR+ + +   +G   +++++ LQLWDTAGQERFRSL+ AFFRDAMGFL++FD+T+EQ+FL++RNW+  L+ HAYC++PD++L GNK DL E   ++ K+A++ AE  G+PY ETSA +  NV  A + ++ ++MKR+ER IDK+ +P
Sbjct:   18 SGVGKSSLLCQYTEGRFHDKYITTVGIDFREKRVTYTNEGADGTAKQTKRVHLQLWDTAGQERFRSLTTAFFRDAMGFLVIFDLTSEQTFLNVRNWLNQLQMHAYCESPDIVLCGNKSDLSE-HNITQKQAKEFAEKHGMPYFETSARTGNNVVPAVETLLGLIMKRMERCIDKSWIP 194          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 161.384 bits (407), Expect = 1.147e-48
Identity = 76/174 (43.68%), Postives = 107/174 (61.49%), Query Frame = 2
Query:  257 VHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP-------VRRPIGVSLKQKSESEKNSGCAC 757
            + N   + G  G   K+ LQLWDTAGQ RFRSL+ AFFRDAMGF + FD+T+EQSF+++R+W+ VL+ HAYC +PD++L GNK DL E R V   +A  LA   G+PY+ETSA + ENV +A + ++  VM+R++   +   +P         +P         E   +S C C
Sbjct:    1 IFNPGGKEGPAGDGLKIHLQLWDTAGQRRFRSLTNAFFRDAMGFFVFFDITDEQSFVNVRHWMVVLQHHAYCPSPDVVLCGNKADLTEQRAVGEDDALSLASEYGMPYVETSAATGENVARAVELLLERVMRRVQLGHEHAWIPDWAVGAAPPKPRRSLSHDGGEGAGSSSCGC 174          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 159.073 bits (401), Expect = 3.145e-47
Identity = 81/201 (40.30%), Postives = 128/201 (63.68%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKT +L R+++D F+  F+ST+G+DFK + I  +           +K++LQ+WDTAGQERFR+++ A++R AMG +LV+D+TNE+SF +I+NW+  +  HA  D   MIL GNK D+ E RQV+ +  E LA   GI ++ETSA ++ NVE+AF  +   +  +++R ++ N  P    + ++    S+ +K S   C
Sbjct:   17 SGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDG----------KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMIL-GNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLEGNNTPDSNAVRIT--APSQGKKTSFFRC 204          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 156.377 bits (394), Expect = 5.297e-46
Identity = 72/172 (41.86%), Postives = 118/172 (68.60%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSI 670
            S+VGKTS L RY D+ F+  FVSTVG+DFK K +  N           ++++LQ+WDTAGQER+R+++ A++R AMGF+L++D+TNE SF  + +W T ++++++ D   ++LVGNK D+E+ R V  ++   LAE LG  + ETSA    NV++ F+++V ++ +++  S+
Sbjct:   38 SSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNE----------KRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYSW-DNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVDVICEKMSESL 198          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 150.599 bits (379), Expect = 4.255e-45
Identity = 64/98 (65.31%), Postives = 86/98 (87.76%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVT 448
            S VGKTSLL+ YTD +F+ KFV+TVG+DF++KR+V+ S   +G+ G+ Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T+EQSFL++RNW++
Sbjct:   31 SGVGKTSLLYNYTDGKFNSKFVTTVGIDFREKRVVYRSENADGITGRGQRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSEQSFLNVRNWMS 128          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 152.525 bits (384), Expect = 7.166e-45
Identity = 78/177 (44.07%), Postives = 118/177 (66.67%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNIL 685
            S VGK+ LL R+ +D+F+P F++T+G+DFK K +  N           +K++LQLWDTAGQERFR+++ A++R AMG +LV+DVT+E++F +I+ W   +  HA  D   ++LVGNK D+ E R V+  + E LA+ LGIP+IE+SA + +NV    ++I   + K I+  ID N L
Sbjct:   29 SGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDING----------KKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN-DEAQLLLVGNKSDM-ETRVVTADQGEALAKELGIPFIESSAKNDDNV----NEIFFTLAKLIQEKIDSNKL 189          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 134.42 bits (337), Expect = 4.087e-38
Identity = 79/206 (38.35%), Postives = 126/206 (61.17%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPD---MILVGNKIDLEEARQ-VSFKEAEDLAETLG-IPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTSL+HRY +D++S ++ +T+G DF  K +  + +         +   +Q+WDTAGQERF+SL +AF+R A   +LV+DVTN  SF +I++W      HA  ++P+    +++GNKID EE+++ VS K A++LA++LG IP   TSA +A NV+ AF++I    +++ +   +         I + L    + E NS C+C
Sbjct:   17 SGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGD---------KVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEAFEDDYNDAINIRL----DGENNS-CSC 208          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 133.265 bits (334), Expect = 1.153e-37
Identity = 69/201 (34.33%), Postives = 124/201 (61.69%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRI-ERSIDKNILPVRRPIGVSLKQKSESEKNSGCA 754
            S VGK+ LL R++DD ++  ++ST+GVDFK K +  +  T          ++LQ+WDTAGQERFR+++ +++R + G ++V+DVT+++SF  ++ W+  +  +A   T   +LVGNK DL++ R V +  A++ A+   +P++ETSAL + NVE AF  +   + + + ++++++          V+LK +S +    GC 
Sbjct:   17 SGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKT----------VKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA-TSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC 206          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 127.872 bits (320), Expect = 1.975e-35
Identity = 73/212 (34.43%), Postives = 124/212 (58.49%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIER-----------SIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S VGK++LL R+T DEF+ +  ST+GV+F  + I      EN      +K++ Q+WDTAGQER+R+++ A++R A+G L+V+D++   S+ +  +W+T LR +A  D   + L+GNK DL   R V   EA++ A    + + ETSAL+++NV+KAF +++V + + + +           ++  N  P    I ++   K + +K S   C
Sbjct:   22 SGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTI----EVEN------KKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNCC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 124.02 bits (310), Expect = 5.402e-34
Identity = 69/212 (32.55%), Postives = 127/212 (59.91%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIER--------SIDKNILPVRRPIGVSLK---QKSESEKNSGCAC 757
            S VGK++LL R+T +EF+    ST+GV+F  + +         + GK  +++ Q+WDTAGQER+R+++ A++R A+G L+V+D++   S+ +  +W++ LR +A  D   + L+GNK DL   R V  +E++  A+   + + ETSAL++ENV+KAF++++  + +++ +        S + N      P G ++      +E++K +G  C
Sbjct:   22 SGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLE--------IDGK--RIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO49958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER3])

HSP 1 Score: 231.876 bits (590), Expect = 4.919e-75
Identity = 113/208 (54.33%), Postives = 157/208 (75.48%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLG-KSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP----VRRPIGVS-LKQKSE-SEKNSGCAC 757
            S VGKTS+L++YTD+ F+PKF+STVG+DF++KR+VH+    +G    + Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLLVFD+T+EQSF++IRNW++ L++HAYC+ PD++L+GNK DLE+ R V   EA  LA+ LG+ Y ETSA + +NV K+ + ++  VM R+E  +D+  LP       P  VS LK+  E SE++SGC+C
Sbjct:   20 SGVGKTSILYQYTDESFNPKFISTVGIDFREKRVVHHPLNPDGERSTRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHAYCENPDIVLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNVTKSVEALLDQVMVRMENCVDRATLPNNVFNNNPSRVSKLKEVDEASEESSGCSC 227          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO28309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6U5])

HSP 1 Score: 208.764 bits (530), Expect = 1.497e-66
Identity = 95/165 (57.58%), Postives = 132/165 (80.00%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLG-KSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMV 646
            S VGKTS+L++YTD+ F+PKF+STVG+DF++KR+VH+    +G    + Q++ LQLWDTAGQERFRSL+ AFFRDAMGFLLVFD+T+EQSF++IRNW++ L++HAYC+ PD++L+GNK DLE+ R V   EA  LA+ LG+ Y ETSA + +NV K+ + ++  V
Sbjct:   20 SGVGKTSILYQYTDESFNPKFISTVGIDFREKRVVHHPLNPDGERSTRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHAYCENPDIVLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNVTKSVEALLDQV 184          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO34944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW8])

HSP 1 Score: 176.022 bits (445), Expect = 2.230e-53
Identity = 83/203 (40.89%), Postives = 135/203 (66.50%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKN--ILPVRRPIGVSLKQKSESEKNSGCAC 757
            SAVGKTS L RY DD F+  FVSTVG+DFK K +  N           ++++LQ+WDTAGQER+R+++ A++R AMGF+L++D+TNE+SF  +++W T ++++++ +   +ILVGNK D+EE R VS+   + LA+ LG+ + ETSA    NV+K F+++V ++  ++ +S+D +  I+  ++P    L  +   +    CAC
Sbjct:   30 SAVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRND----------KRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFQAVQDWSTQVKTYSWANAQ-VILVGNKCDMEEERVVSYDRGKQLADQLGLEFYETSAKDNTNVKKVFERLVDIICDKMSQSLDTDPTIVSGQKPGTTKLTAERPKQNQDNCAC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 152.91 bits (385), Expect = 1.027e-44
Identity = 73/157 (46.50%), Postives = 110/157 (70.06%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAF 625
            S VGKT +L R+++D F+  F+ST+G+DFK + I  +           +K++LQ+WDTAGQERFR+++ A++R AMG +LV+D+TN++SF +I+NW+  +  HA  D   M+L GNK D+E+ RQVS +  E LA   GI ++ETSA ++ NVE+AF
Sbjct:   17 SGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDG----------KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVL-GNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAF 162          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 150.984 bits (380), Expect = 2.808e-44
Identity = 76/157 (48.41%), Postives = 107/157 (68.15%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAF 625
            S VGKT ++ R+ D+ F+P F+ST+G+DFK K +          LG  +K++LQ+WDTAGQERF +++ A++R AMG +LV+DVTNE+SF +I  W+  +  HA  D   M LVGNK D+ + R +S  + E LA + GI +IETSALS  NVEK+F
Sbjct:   18 SGVGKTCIIFRFADNTFNPSFISTIGIDFKIKTLE---------LG-GKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKIDDHANEDVKRM-LVGNKCDMYDKRVISQTKGEQLASSYGISFIETSALSNINVEKSF 163          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27b (RAB27B, member RAS oncogene family [Source:NCBI gene;Acc:101161176])

HSP 1 Score: 231.491 bits (589), Expect = 1.753e-74
Identity = 106/203 (52.22%), Postives = 156/203 (76.85%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVL-GKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEK-NSGCAC 757
            S VGKT+ L+RYTD++F+PKF++TVG+DF++KR+V+ ++  NG   GK+ K+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+T++QSFL++RNW++ L+++AYC+ PD++LVGNK+DL + R+V  K+A++LA+  GIPY ETSA +   V+KA   ++ +VMKR+E+ +DK   P     G    + S+++     CAC
Sbjct:   18 SGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYTASNPNGTTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKVDLADQREVQEKQAKELADKYGIPYFETSAATGAEVDKAVITLLDLVMKRMEQCVDKP--PADSANGNGATKLSDAQPIEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:101164788])

HSP 1 Score: 229.18 bits (583), Expect = 1.140e-73
Identity = 105/203 (51.72%), Postives = 146/203 (71.92%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILP--VRRPIGVSLKQKSESEKNSGCAC 757
            S VGKTS L++YTD +F+ KF++TVG+DF++K ++       G   K QK+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DL + R +S  EA +LAE  GIPY ETSA + +NV +A   ++ ++M+R+E  +DK+ +P    RP G + +   E+     CAC
Sbjct:   18 SGVGKTSFLYQYTDGKFNSKFITTVGIDFREKTVLFPPTGSGGTSSKGQKIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQMHAYCENPDVVLCGNKCDLMDQRAISEDEARELAEKYGIPYFETSAANGQNVTEAVRILLDLIMRRMEHCVDKSWIPDGTVRPNGPNHQDIPEAPDRGKCAC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: ENSORLT00000000515.2 (ras-related protein Rab-27B [Source:NCBI gene;Acc:101172416])

HSP 1 Score: 213.772 bits (543), Expect = 1.649e-64
Identity = 93/171 (54.39%), Postives = 135/171 (78.95%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERS 667
            S  GKT+ LHRYTD++F  +F +TVG+DF++KR+V+     +G   +S ++ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TN+QSF+++RNW++ L+++AYCD+PD++LVG K DL++ R V  ++A +LAE  GIPY ETSAL+   V++A   ++ +VMKR+E+ 
Sbjct:  270 SGAGKTTFLHRYTDNKFHRRFTTTVGIDFREKRVVYVGTGADGASERSFRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTNQQSFVNVRNWMSQLQANAYCDSPDVVLVGTKADLKDMRNVHARQARELAERYGIPYFETSALTGAGVDQAVTTLLNLVMKRMEQG 440          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:101164788])

HSP 1 Score: 185.267 bits (469), Expect = 1.349e-56
Identity = 82/139 (58.99%), Postives = 108/139 (77.70%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLG 571
            S VGKTS L++YTD +F+ KF++TVG+DF++K ++       G   K QK+ LQLWDTAGQERFRSL+ AFFRDAMGFLL+FD+TNEQSFL++RNW++ L+ HAYC+ PD++L GNK DL + R +S  EA +LAE  G
Sbjct:   18 SGVGKTSFLYQYTDGKFNSKFITTVGIDFREKTVLFPPTGSGGTSSKGQKIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQMHAYCENPDVVLCGNKCDLMDQRAISEDEARELAEKYG 156          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab3c (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:101166306])

HSP 1 Score: 165.236 bits (417), Expect = 6.980e-49
Identity = 79/201 (39.30%), Postives = 126/201 (62.69%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K +  N           ++++LQ+WDTAGQER+R+++ A++R AMGF+L++D+TNE+SF  +++W T ++++++ D   ++L GNK D+EE R VS +    LAE LG  + ETSA    NV++ F+++V ++  ++  S+D +           L   +   +  GC C
Sbjct:   30 SSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKND----------KRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSW-DNAQVVLAGNKCDMEEERVVSVESGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSESLDTDPAVTTGAPTAKLTDSAPPLQQQGCNC 219          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000014812.1 (SMESG000014812.1)

HSP 1 Score: 420.239 bits (1079), Expect = 9.221e-149
Identity = 218/218 (100.00%), Postives = 218/218 (100.00%), Query Frame = 2
Query:  104 TQCXXXXXXXXXXXXXXSAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 757
            TQCDDYDYLLKLLALGDSAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC
Sbjct:    7 TQCDDYDYLLKLLALGDSAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSGCAC 224          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000023446.1 (SMESG000023446.1)

HSP 1 Score: 225.328 bits (573), Expect = 4.457e-72
Identity = 112/204 (54.90%), Postives = 143/204 (70.10%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTE-NGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNIL----PVRRPIGVSLKQKSESEKNSGC 751
            S VGKTSLL++YTD  F+P+F STVGVDF+QKRIV  S  + +G+LG+ QKL LQLWDTAGQERFRSL   F RDAMGFLLVFD+TNE+S  + R W+ +L +HAYC+ PD++LVGNK DL   R VS ++AE +A+ LG+ Y+ETSA +  NVE     ++ MVM RIE+S+ KN L     VR        +  + EK  GC
Sbjct:   29 SNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 232          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000044557.1 (SMESG000044557.1)

HSP 1 Score: 223.016 bits (567), Expect = 2.464e-71
Identity = 103/203 (50.74%), Postives = 150/203 (73.89%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRPIGVSLKQKSESEKNSG--CAC 757
            S+VGKT +L RY D+ ++  F +TVGVDFKQKR+++     NG++ K  +L LQLWDTAGQERF+SL+++FFRDAMGFLLVFD+T+E SF++IR+W+ +L+ ++Y + PD++LVGNK DL   R +S + A +LA+   +PY+ETSA S ENVEKAF  ++ +VM+RI + +DK++LPV++      K+ S  EK     C+C
Sbjct:   24 SSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLDKSLLPVKKKT----KKPSPVEKKEANKCSC 222          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000077907.1 (SMESG000077907.1)

HSP 1 Score: 209.534 bits (532), Expect = 4.760e-66
Identity = 100/171 (58.48%), Postives = 130/171 (76.02%), Query Frame = 2
Query:  161 VGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNS-NTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSI 670
            VGKT+ L+ YTD +F P F ST+GVDF+QKRI+H S +  +  LG+ Q L LQLWDTAGQERFRSL   FFRDAMGF+L+FD+TNE+S L+IR W+ +L+++AYCD PD+ILVGNK DL   R V+ + A+ +A+   +PYIETS L+   VE+A D++V MVM RIE SI
Sbjct:   21 VGKTTFLYYYTDGKFDPGFTSTIGVDFRQKRIIHRSVDKTDSCLGEEQILHLQLWDTAGQERFRSLCSIFFRDAMGFVLMFDLTNEESLLNIREWMNILKANAYCDNPDIILVGNKADL--PRTVTEEAAKKVAQEFNLPYIETSGLNGIRVEEAMDKLVNMVMTRIENSI 189          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000034019.1 (SMESG000034019.1)

HSP 1 Score: 165.622 bits (418), Expect = 3.788e-49
Identity = 81/202 (40.10%), Postives = 130/202 (64.36%), Query Frame = 2
Query:  155 SAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNILPVRRP-IGVSLKQKSESEKNSGCAC 757
            S+VGKTS L RY DD F+  FVSTVG+DFK K IV           + +K++LQ+WDTAGQER+R+++ A++R AMGF+L++D+TNE+SF  +++WVT ++++++ D   ++LVGNK+DL+  R +S      LA  LG+ + ETSA    +V+  F+++V ++  ++  S+D +   V  P  G  L  ++     + C C
Sbjct:   24 SSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVR----------RDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSW-DNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRLADETNKALPNDCQC 214          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB27A1.280e-7853.43RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A1.280e-7853.43RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A1.280e-7853.43RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A1.280e-7853.43RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27B1.002e-7752.24RAB27B, member RAS oncogene family [Source:HGNC Sy... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aex-63.875e-7555.50Rab27 [Source:UniProtKB/TrEMBL;Acc:G5EBS5][more]
rab-31.726e-4738.61Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-32.053e-4738.61Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-88.768e-4442.69RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-88.768e-4442.69RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab271.484e-5952.66gene:FBgn0025382 transcript:FBtr0070294[more]
Rab272.260e-5952.66gene:FBgn0025382 transcript:FBtr0070293[more]
Rab35.471e-5040.59gene:FBgn0005586 transcript:FBtr0473383[more]
Rab35.471e-5040.59gene:FBgn0005586 transcript:FBtr0088257[more]
Rab82.861e-4341.57gene:FBgn0262518 transcript:FBtr0308833[more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27a1.981e-7853.66RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27b1.217e-7652.74RAB27B, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27b1.284e-7652.74RAB27B, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab3da6.214e-5039.80RAB3D, member RAS oncogene family, a [Source:ZFIN;... [more]
rab3db3.716e-4941.79RAB3D, member RAS oncogene family, b [Source:ZFIN;... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lemd37.804e-7851.74LEM domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
lemd33.289e-7651.74LEM domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
rab27a5.082e-7554.90RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a7.232e-7158.05RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
pknox22.756e-4842.78PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab27a4.042e-8053.92RAB27A, member RAS oncogene family [Source:MGI Sym... [more]
Rab27a4.042e-8053.92RAB27A, member RAS oncogene family [Source:MGI Sym... [more]
Rab27b1.476e-7852.24RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
Rab27b1.476e-7852.24RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
Rab27b1.476e-7852.24RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23640|RB27A_RAT1.397e-7953.92Ras-related protein Rab-27A OS=Rattus norvegicus O... [more]
sp|Q9ERI2|RB27A_MOUSE2.827e-7953.92Ras-related protein Rab-27A OS=Mus musculus OX=100... [more]
sp|P51159|RB27A_HUMAN6.145e-7853.43Ras-related protein Rab-27A OS=Homo sapiens OX=960... [more]
sp|Q8HZJ5|RB27B_BOVIN1.010e-7752.74Ras-related protein Rab-27B OS=Bos taurus OX=9913 ... [more]
sp|Q99P58|RB27B_MOUSE1.033e-7752.24Ras-related protein Rab-27B OS=Mus musculus OX=100... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EWZ89.487e-8360.70Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8H4D71.096e-8260.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
G5B2P76.354e-7954.68Ras-related protein Rab-27A OS=Heterocephalus glab... [more]
F6RY291.371e-7854.73RAB27B, member RAS oncogene family OS=Ornithorhync... [more]
L5K2641.944e-7854.90Ras-related protein Rab-27A OS=Pteropus alecto OX=... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27a9.102e-7853.66RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a9.102e-7853.66RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27b1.098e-7652.97RAB27B, member RAS oncogene family [Source:NCBI ge... [more]
pld61.350e-4940.80GTP-binding protein Rab-3D-like [Source:NCBI gene;... [more]
rab3c2.049e-4839.30RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27a5.372e-6751.12RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27a1.147e-4843.68RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab8a3.145e-4740.30RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab3c5.297e-4641.86RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab27a4.255e-4565.31RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC47.166e-4544.07Rab family GTPase; essential for vesicle-mediated ... [more]
YPT74.087e-3838.35Rab family GTPase; GTP-binding protein of the rab ... [more]
YPT11.153e-3734.33Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT321.975e-3534.43Rab family GTPase involved in the exocytic pathway... [more]
YPT315.402e-3432.55Rab family GTPase; involved in the exocytic pathwa... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499584.919e-7554.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283091.497e-6657.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349442.230e-5340.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410181.027e-4446.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408452.808e-4448.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27b1.753e-7452.22RAB27B, member RAS oncogene family [Source:NCBI ge... [more]
rab27a1.140e-7351.72RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
ENSORLT00000000515.21.649e-6454.39ras-related protein Rab-27B [Source:NCBI gene;Acc:... [more]
rab27a1.349e-5658.99RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab3c6.980e-4939.30RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014812.19.221e-149100.00SMESG000014812.1[more]
SMESG000023446.14.457e-7254.90SMESG000023446.1[more]
SMESG000044557.12.464e-7150.74SMESG000044557.1[more]
SMESG000077907.14.760e-6658.48SMESG000077907.1[more]
SMESG000034019.13.788e-4940.10SMESG000034019.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022570 ID=SMED30022570|Name=Ras-related protein Rab-27A|organism=Schmidtea mediterranea sexual|type=transcript|length=1157bp
ATTTATCGCTTTCAGCAAAGTTAACTGGCGGATATTTAAGTGAAAAGTGT
TTTTATTGCTAATAATTAATTTGATTATTATATAAATGGAAGAAATCAAC
AACACGCAATGCGATGATTACGACTACCTGTTGAAGCTGTTAGCACTAGG
TGACAGCGCAGTTGGGAAAACCAGTTTGCTCCATCGCTACACAGATGATG
AATTCAGCCCCAAATTCGTATCAACAGTTGGTGTGGATTTCAAGCAGAAA
CGGATCGTTCACAATTCTAATACTGAGAACGGAGTTCTTGGTAAATCCCA
GAAGTTACAGCTGCAATTATGGGATACAGCTGGCCAGGAAAGATTTCGAA
GTCTCAGTATGGCTTTTTTTCGAGACGCGATGGGATTTCTTTTAGTTTTT
GATGTTACAAATGAACAATCCTTTCTTCATATCAGGAACTGGGTAACCGT
ACTTCGATCTCATGCGTATTGCGATACGCCCGACATGATCCTCGTTGGAA
ATAAAATTGATCTCGAAGAAGCTCGACAAGTAAGCTTTAAAGAAGCGGAA
GATCTTGCAGAAACACTCGGGATTCCCTACATTGAGACGAGCGCATTGTC
AGCGGAAAATGTCGAGAAGGCATTCGATCAAATCGTTGTCATGGTGATGA
AACGAATAGAGAGGTCAATCGATAAAAATATTTTGCCAGTCCGAAGACCG
ATCGGAGTTTCATTGAAACAGAAATCAGAATCGGAGAAAAATTCCGGTTG
TGCGTGCTAGATCGATTGGGATTGGTTGAAATGAGCAATCGATGAAAACT
AGAAACGATCTGTGATATCCTCCCTAGTGGTGTGTGGCGGTGTGGAACAT
TATTGATTTCGTGTGCTGCTGATGCTGCTGTCGTGTGTGTGTGTTGTTTG
TGCTATTTTTGAAATTGTGTGCCGATTGTGTGACTGTATGTACTTTCTGT
GAATTTATTAACAGTAAACAACAACAGCTCTGAATCTTACAATTATTGAT
CATGCGAATATTATTATTATTATTACACAGTGCTTGTGCTTATATAATCA
ATAGCCGCAATTTCAAAACTATAATATTTATTTTCAATAATATATACCAT
GTAGCTCTGCTAATACTCAATTGGCTATTTTTAGTTTTATTATTATTTTT
ATAACTG
back to top

protein sequence of SMED30022570-orf-1

>SMED30022570-orf-1 ID=SMED30022570-orf-1|Name=SMED30022570-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=225bp
MEEINNTQCDDYDYLLKLLALGDSAVGKTSLLHRYTDDEFSPKFVSTVGV
DFKQKRIVHNSNTENGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMG
FLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVS
FKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNIL
PVRRPIGVSLKQKSESEKNSGCAC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0005515protein binding
GO:0019003GDP binding
GO:0019904protein domain specific binding
GO:0031489myosin V binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006605protein targeting
GO:0006887exocytosis
GO:0007596blood coagulation
GO:0010628positive regulation of gene expression
GO:0016192vesicle-mediated transport
GO:0019882antigen processing and presentation
GO:0030318melanocyte differentiation
GO:0032400melanosome localization
GO:0032402melanosome transport
GO:0036257multivesicular body organization
GO:0043316cytotoxic T cell degranulation
GO:0043320natural killer cell degranulation
GO:0043473pigmentation
GO:0045921positive regulation of exocytosis
GO:0050766positive regulation of phagocytosis
GO:0051875pigment granule localization
GO:0051904pigment granule transport
GO:0071985multivesicular body sorting pathway
GO:0097278complement-dependent cytotoxicity
GO:1903307positive regulation of regulated secretory pathway
GO:1903428positive regulation of reactive oxygen species biosynthetic process
GO:1903435positive regulation of constitutive secretory pathway
GO:1990182exosomal secretion
Vocabulary: cellular component
TermDefinition
GO:0001750photoreceptor outer segment
GO:0005764lysosome
GO:0005768endosome
GO:0005770late endosome
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030141secretory granule
GO:0030425dendrite
GO:0030667secretory granule membrane
GO:0032585multivesicular body membrane
GO:0033093Weibel-Palade body
GO:0042470melanosome
GO:0070062extracellular exosome
GO:0070382exocytic vesicle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 130..143
score: 49.21
coord: 165..187
score: 38.63
coord: 39..55
score: 32.34
coord: 67..89
score: 45.07
coord: 16..37
score: 47.28
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 21..222
e-value: 4.8E-4
score: 9.0
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 18..190
e-value: 1.1E-13
score: 55.0
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 16..190
e-value: 9.0E-81
score: 284.3
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 13..190
e-value: 1.7E-27
score: 107.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 11..200
e-value: 9.2E-68
score: 229.4
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 12..224
NoneNo IPR availablePANTHERPTHR24073:SF587RAS-RELATED PROTEIN RAB-27Bcoord: 12..224
NoneNo IPR availablePROSITEPS51419RABcoord: 11..224
score: 33.211
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 16..183
e-value: 7.0E-27
score: 92.2
IPR001806Small GTPasePFAMPF00071Rascoord: 17..187
e-value: 1.2E-55
score: 187.5
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 11..223