Ribosomal_L28e domain-containing protein

Overview
NameRibosomal_L28e domain-containing protein
Smed IDSMED30022560
Length (bp)567
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosomal_L28e domain-containing protein (SMED30022560) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosomal_L28e domain-containing protein (SMED30022560) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosomal_L28e domain-containing protein (SMED30022560) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosomal_L28e domain-containing protein (SMED30022560) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022560

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022560SMESG000026745.1 SmedASXL_006429SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022560SMESG000026745.1 dd_Smed_v4_221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022560SMESG000026220.1 Contig810GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022560SMESG000026745.1 Contig810GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30022560SMESG000026745.1 dd_Smed_v6_221_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Human
Match: RPL28 (ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC:10330])

HSP 1 Score: 83.9593 bits (206), Expect = 2.252e-20
Identity = 44/121 (36.36%), Postives = 71/121 (58.68%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-IKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Human
Match: RPL28 (ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC:10330])

HSP 1 Score: 83.9593 bits (206), Expect = 2.252e-20
Identity = 44/121 (36.36%), Postives = 71/121 (58.68%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-IKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Human
Match: RPL28 (ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC:10330])

HSP 1 Score: 74.3294 bits (181), Expect = 2.073e-16
Identity = 41/113 (36.28%), Postives = 64/113 (56.64%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALR 407
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L MLA R
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-IKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMLAGR 112          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Human
Match: RPL28 (ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC:10330])

HSP 1 Score: 69.707 bits (169), Expect = 1.038e-14
Identity = 38/109 (34.86%), Postives = 61/109 (55.96%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTM 395
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-IKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRM 108          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Human
Match: RPL28 (ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC:10330])

HSP 1 Score: 69.3218 bits (168), Expect = 1.245e-14
Identity = 38/112 (33.93%), Postives = 63/112 (56.25%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLAL 404
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M++ 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-IKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMVSW 111          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Celegans
Match: rpl-28 (60S ribosomal protein L28 [Source:UniProtKB/Swiss-Prot;Acc:Q21930])

HSP 1 Score: 54.299 bits (129), Expect = 1.188e-9
Identity = 37/124 (29.84%), Postives = 66/124 (53.23%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMT--ISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPST-LIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS AL+W++ +NN+ +L+TQRG+    S +  N+   N  +YSGL +K AI+V       V++ +K +K +  +  +T  + KT     +R         ++ N    +   LA R+A+A++R 
Sbjct:    1 MSDALVWQVIRNNSAFLRTQRGIGKRFSTEKFNLKKVNSPKYSGLANKHAIDVSAAAKG-VVVSTKNEKGRPAKAVTTSTLSKTPVASVRR---------LAKNAGFNKFNKLAQRRAAAIVRS 114          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Celegans
Match: rpl-28 (60S ribosomal protein L28 [Source:UniProtKB/Swiss-Prot;Acc:Q21930])

HSP 1 Score: 54.299 bits (129), Expect = 1.188e-9
Identity = 37/124 (29.84%), Postives = 66/124 (53.23%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMT--ISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPST-LIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS AL+W++ +NN+ +L+TQRG+    S +  N+   N  +YSGL +K AI+V       V++ +K +K +  +  +T  + KT     +R         ++ N    +   LA R+A+A++R 
Sbjct:    1 MSDALVWQVIRNNSAFLRTQRGIGKRFSTEKFNLKKVNSPKYSGLANKHAIDVSAAAKG-VVVSTKNEKGRPAKAVTTSTLSKTPVASVRR---------LAKNAGFNKFNKLAQRRAAAIVRS 114          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Fly
Match: RpL28 (gene:FBgn0035422 transcript:FBtr0302300)

HSP 1 Score: 75.8702 bits (185), Expect = 1.388e-17
Identity = 43/121 (35.54%), Postives = 72/121 (59.50%), Query Frame = 3
Query:   72 SSALLWEITKNNNCYLKTQRGM--TISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMR 428
            SS L W I +NNN +L  +R +    S +P N+   + +RYSG++HKK + VV   + K    +  +K K  ++P+    +  FK G RR+L  +++ +  +K R++LT  ALR+ASA++R
Sbjct:    4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKG-FTAVLKKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLR 123          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Fly
Match: RpL28 (gene:FBgn0035422 transcript:FBtr0073097)

HSP 1 Score: 75.8702 bits (185), Expect = 1.388e-17
Identity = 43/121 (35.54%), Postives = 72/121 (59.50%), Query Frame = 3
Query:   72 SSALLWEITKNNNCYLKTQRGM--TISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMR 428
            SS L W I +NNN +L  +R +    S +P N+   + +RYSG++HKK + VV   + K    +  +K K  ++P+    +  FK G RR+L  +++ +  +K R++LT  ALR+ASA++R
Sbjct:    4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKG-FTAVLKKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLR 123          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Fly
Match: RpL28 (gene:FBgn0035422 transcript:FBtr0073095)

HSP 1 Score: 75.8702 bits (185), Expect = 1.388e-17
Identity = 43/121 (35.54%), Postives = 72/121 (59.50%), Query Frame = 3
Query:   72 SSALLWEITKNNNCYLKTQRGM--TISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMR 428
            SS L W I +NNN +L  +R +    S +P N+   + +RYSG++HKK + VV   + K    +  +K K  ++P+    +  FK G RR+L  +++ +  +K R++LT  ALR+ASA++R
Sbjct:    4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKG-FTAVLKKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLR 123          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Fly
Match: RpL28 (gene:FBgn0035422 transcript:FBtr0073098)

HSP 1 Score: 75.8702 bits (185), Expect = 1.388e-17
Identity = 43/121 (35.54%), Postives = 72/121 (59.50%), Query Frame = 3
Query:   72 SSALLWEITKNNNCYLKTQRGM--TISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMR 428
            SS L W I +NNN +L  +R +    S +P N+   + +RYSG++HKK + VV   + K    +  +K K  ++P+    +  FK G RR+L  +++ +  +K R++LT  ALR+ASA++R
Sbjct:    4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKG-FTAVLKKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLR 123          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Fly
Match: RpL28 (gene:FBgn0035422 transcript:FBtr0306567)

HSP 1 Score: 75.8702 bits (185), Expect = 1.388e-17
Identity = 43/121 (35.54%), Postives = 72/121 (59.50%), Query Frame = 3
Query:   72 SSALLWEITKNNNCYLKTQRGM--TISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMR 428
            SS L W I +NNN +L  +R +    S +P N+   + +RYSG++HKK + VV   + K    +  +K K  ++P+    +  FK G RR+L  +++ +  +K R++LT  ALR+ASA++R
Sbjct:    4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKG-FTAVLKKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLR 123          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Zebrafish
Match: rpl28 (ribosomal protein L28 [Source:ZFIN;Acc:ZDB-GENE-040930-10])

HSP 1 Score: 74.7146 bits (182), Expect = 4.424e-17
Identity = 40/118 (33.90%), Postives = 67/118 (56.78%), Query Frame = 3
Query:   72 SSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALM 425
            S  L W + +N++ +L  +   T S +P N+  +N FR++GLIH+K I +    + K +++   +K+  QRKP++   K       R TL  +R+ I  NK R +L M ALR+ SA++
Sbjct:    3 SPHLQWMVIRNSSSFLIKRNKQTYSTEPNNLKARNAFRFNGLIHRKTIGIEPAADGKGVVVV-LKKRSGQRKPASSYGKITINKNSRATLASVRNIIRKNKYRRDLRMAALRRVSAIL 119          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Zebrafish
Match: rpl28 (ribosomal protein L28 [Source:ZFIN;Acc:ZDB-GENE-040930-10])

HSP 1 Score: 74.7146 bits (182), Expect = 4.424e-17
Identity = 40/118 (33.90%), Postives = 67/118 (56.78%), Query Frame = 3
Query:   72 SSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALM 425
            S  L W + +N++ +L  +   T S +P N+  +N FR++GLIH+K I +    + K +++   +K+  QRKP++   K       R TL  +R+ I  NK R +L M ALR+ SA++
Sbjct:    3 SPHLQWMVIRNSSSFLIKRNKQTYSTEPNNLKARNAFRFNGLIHRKTIGIEPAADGKGVVVV-LKKRSGQRKPASSYGKITINKNSRATLASVRNIIRKNKYRRDLRMAALRRVSAIL 119          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Zebrafish
Match: rpl28 (ribosomal protein L28 [Source:ZFIN;Acc:ZDB-GENE-040930-10])

HSP 1 Score: 74.7146 bits (182), Expect = 6.527e-17
Identity = 40/118 (33.90%), Postives = 67/118 (56.78%), Query Frame = 3
Query:   72 SSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALM 425
            S  L W + +N++ +L  +   T S +P N+  +N FR++GLIH+K I +    + K +++   +K+  QRKP++   K       R TL  +R+ I  NK R +L M ALR+ SA++
Sbjct:   16 SPHLQWMVIRNSSSFLIKRNKQTYSTEPNNLKARNAFRFNGLIHRKTIGIEPAADGKGVVVV-LKKRSGQRKPASSYGKITINKNSRATLASVRNIIRKNKYRRDLRMAALRRVSAIL 132          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Xenopus
Match: col6a2 (collagen, type VI, alpha 2 [Source:Xenbase;Acc:XB-GENE-6085118])

HSP 1 Score: 80.8777 bits (198), Expect = 2.979e-19
Identity = 43/121 (35.54%), Postives = 70/121 (57.85%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +     S +P N+  +N FRY+GLIHKK + V    + K +++   +K+  QRKP+T  +K       R TL+ +R  I  N  R++L M ALR+ASA+++ 
Sbjct:    1 MSAHLQWMVIRNCSSFLVKRNHRIFSTEPNNLKARNSFRYNGLIHKKTVGVEPAADGKGVIVV-LKKRAGQRKPATSYEKITINKNSRSTLSSVRHIIRKNNYRKDLRMAALRRASAILKS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Mouse
Match: Rpl28 (ribosomal protein L28 [Source:MGI Symbol;Acc:MGI:101839])

HSP 1 Score: 83.5741 bits (205), Expect = 1.758e-20
Identity = 44/121 (36.36%), Postives = 71/121 (58.68%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-MKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Mouse
Match: Rpl28 (ribosomal protein L28 [Source:MGI Symbol;Acc:MGI:101839])

HSP 1 Score: 83.5741 bits (205), Expect = 1.758e-20
Identity = 44/121 (36.36%), Postives = 71/121 (58.68%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-MKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Mouse
Match: Rpl28 (ribosomal protein L28 [Source:MGI Symbol;Acc:MGI:101839])

HSP 1 Score: 43.5134 bits (101), Expect = 8.907e-6
Identity = 23/51 (45.10%), Postives = 31/51 (60.78%), Query Frame = 3
Query:  279 QRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:   18 QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 68          
BLAST of Ribosomal_L28e domain-containing protein vs. UniProt/SwissProt
Match: sp|P17702|RL28_RAT (60S ribosomal protein L28 OS=Rattus norvegicus OX=10116 GN=Rpl28 PE=1 SV=4)

HSP 1 Score: 86.2705 bits (212), Expect = 1.050e-20
Identity = 45/121 (37.19%), Postives = 72/121 (59.50%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V   P+ K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEAWPDGKGVVVV-MKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. UniProt/SwissProt
Match: sp|Q962T2|RL28_SPOFR (60S ribosomal protein L28 OS=Spodoptera frugiperda OX=7108 GN=RpL28 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.716e-20
Identity = 49/123 (39.84%), Postives = 73/123 (59.35%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGM--TISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MSS L W I +NNN +L  +R +    SK+P N+T  N +RY+GLI KKA+ VV+ P+ K   +   +K K   KP+    + QFK G RR+L  ++  +  N  R +L+   LR+ASA++R 
Sbjct:    1 MSSHLNWMIIRNNNAFLVKKRNIKKPFSKEPNNVTNLNSYRYNGLIQKKAVGVVENPDRKGFTVV-YKKAKATNKPAKNAVRRQFKAGARRSLYKVKRLLKANHYRTDLSKATLRRASAILRS 122          
BLAST of Ribosomal_L28e domain-containing protein vs. UniProt/SwissProt
Match: sp|P46779|RL28_HUMAN (60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3)

HSP 1 Score: 83.9593 bits (206), Expect = 1.082e-19
Identity = 44/121 (36.36%), Postives = 71/121 (58.68%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-IKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. UniProt/SwissProt
Match: sp|P41105|RL28_MOUSE (60S ribosomal protein L28 OS=Mus musculus OX=10090 GN=Rpl28 PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.230e-19
Identity = 44/121 (36.36%), Postives = 71/121 (58.68%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-MKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3T0L7|RL28_BOVIN (60S ribosomal protein L28 OS=Bos taurus OX=9913 GN=RPL28 PE=2 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 1.354e-19
Identity = 44/121 (36.36%), Postives = 71/121 (58.68%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  +   T S +P N+  +N FRY+GLIH+K + V    + K +++   +++  QRKP+T   +T      R TL+ IR  I  NK R +L M A+R+ASA++R 
Sbjct:    1 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV-MKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. TrEMBL
Match: A0A2H1C365 (Ribosomal L28e protein OS=Fasciola hepatica OX=6192 GN=D915_007092 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.616e-30
Identity = 59/119 (49.58%), Postives = 78/119 (65.55%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALM 425
            MSS LLW++ K NNC+L  + G   S+DP+N+ GKNCF YSGL+HKKAI +      K +++  T+K     KPS  + +T F  G+RR L  IR+NI   K R EL MLALR+ASAL+
Sbjct:    1 MSSYLLWDLVKKNNCFLMKRGGEQFSRDPLNLKGKNCFMYSGLVHKKAIGIKPEKYGKGVVMI-TKKAGYDHKPSKAVVRTSFIRGRRRALQKIRNNICRQKYRRELKMLALRRASALL 118          
BLAST of Ribosomal_L28e domain-containing protein vs. TrEMBL
Match: A0A504YF44 (Ribosomal protein L28e OS=Fasciola gigantica OX=46835 GN=FGIG_01964 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 6.910e-30
Identity = 58/119 (48.74%), Postives = 78/119 (65.55%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALM 425
            MS+ LLW++ K NNC+L  + G   S+DP+N+ GKNCF YSGL+HKKAI +      K +++  T+K     KPS  + +T F  G+RR L  IR+NI   K R EL MLALR+ASAL+
Sbjct:    1 MSNYLLWDLVKKNNCFLMKRGGEQFSRDPLNLKGKNCFMYSGLVHKKAIGIKPDKYGKGVVMI-TKKTGYDHKPSKAVVRTSFIRGRRRALQKIRNNICRQKYRRELKMLALRRASALL 118          
BLAST of Ribosomal_L28e domain-containing protein vs. TrEMBL
Match: A0A0R3SRX6 (Ribosomal_L28e domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7981 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 5.598e-29
Identity = 57/122 (46.72%), Postives = 77/122 (63.11%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRDN 434
            M+S L W + KN +CYL  + G   S+DP+NI GKNCF+YSGL+HKKAI + +    K +    T++     KP   I +T+F  G RRTL  IR+ +  NK R EL MLALR ASA+++ N
Sbjct:    1 MASHLHWMLVKNTHCYLMKRNGEQFSRDPLNIKGKNCFKYSGLVHKKAIGIKQEKGGKGVYFL-TKRAGYDHKPRQAIVRTKFVRGNRRTLQKIRNFVVGNKYRRELKMLALRHASAVLQSN 121          
BLAST of Ribosomal_L28e domain-containing protein vs. TrEMBL
Match: A0A5J4NLR8 (Large subunit ribosomal protein L28e (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0011480 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.406e-28
Identity = 57/119 (47.90%), Postives = 79/119 (66.39%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALM 425
            M++ L+WE+ K NNC+L  ++    S+DP+N+ GKNCF YSGL+HKKAI + +    K ILL  T+K     KP+  + +T++  G+RR L  IR+ I   K R EL MLALR+ASALM
Sbjct:    1 MANHLVWELVKRNNCFLMKRKNEQFSRDPLNLKGKNCFIYSGLVHKKAIGIKQEKYGKGILLI-TKKAGYDHKPTKAVVRTKYVRGRRRALQKIRNMICRQKYRRELKMLALRRASALM 118          
BLAST of Ribosomal_L28e domain-containing protein vs. TrEMBL
Match: A0A1S8WMG6 (Ribosomal L28e protein OS=Opisthorchis viverrini OX=6198 GN=X801_08612 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.550e-28
Identity = 58/119 (48.74%), Postives = 78/119 (65.55%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALM 425
            MSS L+W++ K NNC+L  +     S+DP+N+ GKNCF YSGL+HKKAI +      K I+L  T+K     KP+  + +T++  G+RRTL  IR+ I   K R EL MLALR+ASALM
Sbjct:    1 MSSHLVWDLVKRNNCFLMKRGNEQFSRDPLNMKGKNCFMYSGLVHKKAIGIKPEKYGKGIVLI-TKKPGYDHKPAKAVVRTKYVRGRRRTLQKIRNMICRQKYRRELKMLALRRASALM 118          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Cavefish
Match: rpl28 (ribosomal protein L28 [Source:NCBI gene;Acc:103040066])

HSP 1 Score: 86.6557 bits (213), Expect = 1.081e-21
Identity = 45/121 (37.19%), Postives = 73/121 (60.33%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MSS L W + +NN+ +L  + G T S +P N+  +N FR++GL+H+K + + +  + K I++   +K+   RKP  L +K       R TLN +R+ I  N  R++L M ALR+ASA++R 
Sbjct:    1 MSSHLQWMVIRNNSSFLIKRNGQTYSTEPNNLKARNAFRFNGLVHRKTVGIEQAADGKGIVVI-LKKRAGHRKPVKLYEKITINKNSRTTLNRLRNIIRKNNYRKDLRMAALRRASAILRS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Cavefish
Match: rpl28 (ribosomal protein L28 [Source:NCBI gene;Acc:103040066])

HSP 1 Score: 86.6557 bits (213), Expect = 1.606e-21
Identity = 45/121 (37.19%), Postives = 73/121 (60.33%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MSS L W + +NN+ +L  + G T S +P N+  +N FR++GL+H+K + + +  + K I++   +K+   RKP  L +K       R TLN +R+ I  N  R++L M ALR+ASA++R 
Sbjct:   17 MSSHLQWMVIRNNSSFLIKRNGQTYSTEPNNLKARNAFRFNGLVHRKTVGIEQAADGKGIVVI-LKKRAGHRKPVKLYEKITINKNSRTTLNRLRNIIRKNNYRKDLRMAALRRASAILRS 136          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Sea Lamprey
Match: rpl28 (ribosomal protein L28 [Source:ZFIN;Acc:ZDB-GENE-040930-10])

HSP 1 Score: 92.4337 bits (228), Expect = 1.100e-24
Identity = 50/121 (41.32%), Postives = 73/121 (60.33%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W I +NN+ +L  +   T S +P N+  +N FRY+GLIHKK + V   P+ K ++L  T+K+  QRKP +   +T      R TL+ IR  I  NK R +L M ALR+ASA+++ 
Sbjct:    1 MSAHLQWMIIRNNSSFLIKRNKQTFSTEPNNLKARNSFRYNGLIHKKTVGVEANPSGKGVVLV-TKKRTNQRKPGSSYVRTVINKDARSTLSSIRHVIRKNKYRPDLRMAALRRASAILKS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Nematostella
Match: EDO43416 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYT2])

HSP 1 Score: 89.3521 bits (220), Expect = 3.046e-23
Identity = 46/120 (38.33%), Postives = 72/120 (60.00%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMR 428
            MSS L W I +NN+C+L   +G T++K+P N+TG N F+Y+GL++KK + V   P+ K ++++ T+K K   KP  ++ K       RRTL  I      N  R +L   A+R+A A++R
Sbjct:    1 MSSDLQWSIIRNNSCFLVRSQGKTLTKEPNNVTGLNAFKYNGLVNKKVVGVDAAPSGKGVVIT-TRKNKAANKPGKIMNKITISRDSRRTLKTIEGVCDKNYYRMDLKDPAMRRACAILR 119          
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Medaka
Match: rpl28 (ribosomal protein L28 [Source:NCBI gene;Acc:101170942])

HSP 1 Score: 80.1073 bits (196), Expect = 2.815e-19
Identity = 43/121 (35.54%), Postives = 70/121 (57.85%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRD 431
            MS+ L W + +N + +L  + G T S +P N+  +N FR++GL+HKK + V    + K I++   +K+  Q KP++   K       R TLN +R  I  N  R++L M ALR+ASA+++ 
Sbjct:    1 MSAHLQWMVIRNCSSFLIKRNGQTYSTEPNNLKARNSFRFNGLVHKKTVGVQPAADGKGIVVV-LKKRAGQNKPASSYNKITINKNSRATLNSLRHIIRKNSYRKDLRMAALRRASAILKS 120          
BLAST of Ribosomal_L28e domain-containing protein vs. Planmine SMEST
Match: SMESG000026745.1 (SMESG000026745.1)

HSP 1 Score: 250.751 bits (639), Expect = 1.488e-86
Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 3
Query:   69 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRDNT 437
            MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRDNT
Sbjct:    1 MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAINVVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISNNKMREELTMLALRKASALMRDNT 123          
The following BLAST results are available for this feature:
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL282.252e-2036.36ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL282.252e-2036.36ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL282.073e-1636.28ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL281.038e-1434.86ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL281.245e-1433.93ribosomal protein L28 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl-281.188e-929.8460S ribosomal protein L28 [Source:UniProtKB/Swiss... [more]
rpl-281.188e-929.8460S ribosomal protein L28 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpL281.388e-1735.54gene:FBgn0035422 transcript:FBtr0302300[more]
RpL281.388e-1735.54gene:FBgn0035422 transcript:FBtr0073097[more]
RpL281.388e-1735.54gene:FBgn0035422 transcript:FBtr0073095[more]
RpL281.388e-1735.54gene:FBgn0035422 transcript:FBtr0073098[more]
RpL281.388e-1735.54gene:FBgn0035422 transcript:FBtr0306567[more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl284.424e-1733.90ribosomal protein L28 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
rpl284.424e-1733.90ribosomal protein L28 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
rpl286.527e-1733.90ribosomal protein L28 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
col6a22.979e-1935.54collagen, type VI, alpha 2 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rpl281.758e-2036.36ribosomal protein L28 [Source:MGI Symbol;Acc:MGI:1... [more]
Rpl281.758e-2036.36ribosomal protein L28 [Source:MGI Symbol;Acc:MGI:1... [more]
Rpl288.907e-645.10ribosomal protein L28 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17702|RL28_RAT1.050e-2037.1960S ribosomal protein L28 OS=Rattus norvegicus OX=... [more]
sp|Q962T2|RL28_SPOFR2.716e-2039.8460S ribosomal protein L28 OS=Spodoptera frugiperda... [more]
sp|P46779|RL28_HUMAN1.082e-1936.3660S ribosomal protein L28 OS=Homo sapiens OX=9606 ... [more]
sp|P41105|RL28_MOUSE1.230e-1936.3660S ribosomal protein L28 OS=Mus musculus OX=10090... [more]
sp|Q3T0L7|RL28_BOVIN1.354e-1936.3660S ribosomal protein L28 OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1C3651.616e-3049.58Ribosomal L28e protein OS=Fasciola hepatica OX=619... [more]
A0A504YF446.910e-3048.74Ribosomal protein L28e OS=Fasciola gigantica OX=46... [more]
A0A0R3SRX65.598e-2946.72Ribosomal_L28e domain-containing protein OS=Hymeno... [more]
A0A5J4NLR81.406e-2847.90Large subunit ribosomal protein L28e (Fragment) OS... [more]
A0A1S8WMG61.550e-2848.74Ribosomal L28e protein OS=Opisthorchis viverrini O... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl281.081e-2137.19ribosomal protein L28 [Source:NCBI gene;Acc:103040... [more]
rpl281.606e-2137.19ribosomal protein L28 [Source:NCBI gene;Acc:103040... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl281.100e-2441.32ribosomal protein L28 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO434163.046e-2338.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl282.815e-1935.54ribosomal protein L28 [Source:NCBI gene;Acc:101170... [more]
back to top
BLAST of Ribosomal_L28e domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026745.11.488e-86100.00SMESG000026745.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022560 ID=SMED30022560|Name=Ribosomal_L28e domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=567bp
TTTTAATTAAAGTATTAAAAGATTTGTTTTAAAAAGTAGTTGAAATCCAA
AATAAAAGTTTCAAAAAAATGTCTAGTGCTCTTCTTTGGGAAATTACAAA
AAATAACAACTGTTATTTAAAAACTCAACGTGGTATGACCATCTCAAAAG
ACCCCATGAATATTACTGGCAAAAATTGCTTTCGTTATTCTGGTCTCATC
CACAAAAAAGCAATAAATGTTGTTAAAGGTCCTAATAACAAAGTCATTCT
TTTGAGTAAAACCCAAAAACAAAAGCAACAAAGAAAACCATCTACTCTTA
TCAAGAAAACTCAATTTAAAGATGGAAAGAGAAGAACCTTGAACGGAATT
CGATCCAACATTTCAAATAATAAAATGAGAGAAGAATTGACAATGTTGGC
TTTGAGAAAGGCTAGTGCTTTGATGAGAGATAATACCAAGAAAGTTGAAA
AGAAAAAATTGTAAATTGTTAAATAAACAGTTTTGGATTTATGTTTTAAT
TTGTCTTTTCTATTTTAATAGAAATGTATAAAATGGATTTATTATTGTTG
GTGCTAAATCTCTTTTC
back to top

protein sequence of SMED30022560-orf-1

>SMED30022560-orf-1 ID=SMED30022560-orf-1|Name=SMED30022560-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MSSALLWEITKNNNCYLKTQRGMTISKDPMNITGKNCFRYSGLIHKKAIN
VVKGPNNKVILLSKTQKQKQQRKPSTLIKKTQFKDGKRRTLNGIRSNISN
NKMREELTMLALRKASALMRDNTKKVEKKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002672Ribosomal_L28e
IPR029004L28e/Mak16
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.390.110coord: 2..126
e-value: 8.7E-35
score: 121.7
NoneNo IPR availablePANTHERPTHR10544:SF060S RIBOSOMAL PROTEIN L28coord: 1..129
IPR029004Ribosomal L28e/Mak16PFAMPF01778Ribosomal_L28ecoord: 5..120
e-value: 7.7E-28
score: 97.5
IPR002672Ribosomal protein L28ePANTHERPTHR1054460S RIBOSOMAL PROTEIN L28coord: 1..129