Nuclear pore complex protein Nup98-Nup96

Overview
NameNuclear pore complex protein Nup98-Nup96
Smed IDSMED30022556
Length (bp)894
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Human
Match: NUP98 (nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068])

HSP 1 Score: 53.1434 bits (126), Expect = 3.674e-7
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Human
Match: NUP98 (nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068])

HSP 1 Score: 52.7582 bits (125), Expect = 4.038e-7
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Human
Match: NUP98 (nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068])

HSP 1 Score: 51.9878 bits (123), Expect = 9.489e-7
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Human
Match: NUP98 (nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068])

HSP 1 Score: 50.447 bits (119), Expect = 2.428e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Human
Match: NUP98 (nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068])

HSP 1 Score: 50.447 bits (119), Expect = 2.716e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Celegans
Match: npp-10 (Nuclear pore complex protein Nup98-Nup96 Nuclear pore complex protein Nup98 Nuclear pore complex protein Nup96 [Source:UniProtKB/Swiss-Prot;Acc:G5EEH9])

HSP 1 Score: 48.1358 bits (113), Expect = 4.640e-6
Identity = 24/56 (42.86%), Postives = 30/56 (53.57%), Query Frame = 3
Query:   24 IIGTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            + GT VKF   +  D + +N    TI T     S M +Y+ KS EELR EDY  NR
Sbjct:  142 VSGTTVKFEPPISSDTMMRNGTTQTISTKHMCISAMSKYDGKSIEELRVEDYIANR 197          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Celegans
Match: npp-10 (Nuclear pore complex protein Nup98-Nup96 Nuclear pore complex protein Nup98 Nuclear pore complex protein Nup96 [Source:UniProtKB/Swiss-Prot;Acc:G5EEH9])

HSP 1 Score: 48.1358 bits (113), Expect = 4.642e-6
Identity = 24/56 (42.86%), Postives = 30/56 (53.57%), Query Frame = 3
Query:   24 IIGTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            + GT VKF   +  D + +N    TI T     S M +Y+ KS EELR EDY  NR
Sbjct:  144 VSGTTVKFEPPISSDTMMRNGTTQTISTKHMCISAMSKYDGKSIEELRVEDYIANR 199          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Fly
Match: Nup98-96 (gene:FBgn0039120 transcript:FBtr0304567)

HSP 1 Score: 50.447 bits (119), Expect = 1.361e-6
Identity = 37/122 (30.33%), Postives = 54/122 (44.26%), Query Frame = 3
Query:   39 VKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNRMSVTL-NSTNGIQNNSQIXXXXXXXXXXXXXTINKQSNNLFGAN---STGAFGSPVNTNQSNNLFGSNSTG 392
             K+   +G D + K+    ++ T  +  + MKE+E KS EELR EDY C R      N+       +Q+                  S  LFG+    STG FG  V  N+S  +FG+ + G
Sbjct:  202 AKYQPTIGTDTLMKSGQANSVNTKQHCITAMKEFEGKSLEELRLEDYMCGRKGPQAGNAPGAFGFGAQV-----------TQPAQPASGGLFGSTAQPSTGLFGQTVTENKS--MFGTTAFG 310          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Zebrafish
Match: nup98 (nucleoporin 98 [Source:ZFIN;Acc:ZDB-GENE-040426-1180])

HSP 1 Score: 55.0694 bits (131), Expect = 3.371e-8
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T+I T     + MKEYENKS EELR EDY+  R
Sbjct:  161 GTTIKFNPPTGSDTMVKGGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGR 214          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Zebrafish
Match: nup98 (nucleoporin 98 [Source:ZFIN;Acc:ZDB-GENE-040426-1180])

HSP 1 Score: 50.8322 bits (120), Expect = 1.497e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T+I T     + MKEYENKS EELR EDY+  R
Sbjct:  161 GTTIKFNPPTGSDTMVKGGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGR 214          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Zebrafish
Match: nup98 (nucleoporin 98 [Source:ZFIN;Acc:ZDB-GENE-040426-1180])

HSP 1 Score: 50.8322 bits (120), Expect = 1.498e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T+I T     + MKEYENKS EELR EDY+  R
Sbjct:  161 GTTIKFNPPTGSDTMVKGGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGR 214          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Zebrafish
Match: nup98 (nucleoporin 98 [Source:ZFIN;Acc:ZDB-GENE-040426-1180])

HSP 1 Score: 50.8322 bits (120), Expect = 1.524e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T+I T     + MKEYENKS EELR EDY+  R
Sbjct:  161 GTTIKFNPPTGSDTMVKGGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGR 214          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Xenopus
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:100145055])

HSP 1 Score: 50.0618 bits (118), Expect = 3.328e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPSGTDTMAKGGVTTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Xenopus
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:100145055])

HSP 1 Score: 50.0618 bits (118), Expect = 3.727e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPSGTDTMAKGGVTTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Xenopus
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:100145055])

HSP 1 Score: 49.2914 bits (116), Expect = 5.413e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  183 GTTIKFNPPSGTDTMAKGGVTTNISTKHQCITAMKEYESKSLEELRLEDYQANR 236          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Xenopus
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:100145055])

HSP 1 Score: 49.2914 bits (116), Expect = 5.859e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  183 GTTIKFNPPSGTDTMAKGGVTTNISTKHQCITAMKEYESKSLEELRLEDYQANR 236          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Mouse
Match: Nup98 (nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404])

HSP 1 Score: 52.373 bits (124), Expect = 3.679e-7
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Mouse
Match: Nup98 (nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404])

HSP 1 Score: 52.373 bits (124), Expect = 3.766e-7
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Mouse
Match: Nup98 (nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404])

HSP 1 Score: 52.373 bits (124), Expect = 4.051e-7
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Mouse
Match: Nup98 (nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404])

HSP 1 Score: 52.373 bits (124), Expect = 4.115e-7
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Mouse
Match: Nup98 (nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404])

HSP 1 Score: 50.447 bits (119), Expect = 2.056e-6
Identity = 26/54 (48.15%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K    T I T     + MKEYE+KS EELR EDY+ NR
Sbjct:  159 GTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANR 212          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. TrEMBL
Match: A0A2J7PID8 (Uncharacterized protein (Fragment) OS=Cryptotermes secundus OX=105785 GN=B7P43_G03271 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.569e-9
Identity = 31/60 (51.67%), Postives = 37/60 (61.67%), Query Frame = 3
Query:   12 TTQNIIGTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            TT   +GTP+KF  + G D V KN    TI T  +  + MKEYE+KS EELR EDY  NR
Sbjct:  176 TTAAAVGTPIKFTPVTGSDTVVKNGVTQTISTRHHCITCMKEYESKSLEELRLEDYVANR 235          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. TrEMBL
Match: A0A1B6F308 (Uncharacterized protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.27333 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.099e-8
Identity = 29/51 (56.86%), Postives = 34/51 (66.67%), Query Frame = 3
Query:   39 VKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            VKFVA+ G D + KN   TTI T  +  + MKEYE+KS EELR EDY  NR
Sbjct:  172 VKFVAVTGTDTMVKNGVSTTISTRHHCITCMKEYESKSLEELRLEDYVANR 222          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. TrEMBL
Match: A0A1B6MB10 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.39189 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.171e-8
Identity = 29/51 (56.86%), Postives = 34/51 (66.67%), Query Frame = 3
Query:   39 VKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            VKFVA+ G D + KN   TTI T  +  + MKEYE+KS EELR EDY  NR
Sbjct:  172 VKFVAVTGTDTMAKNGVSTTISTRHHCITCMKEYESKSLEELRLEDYVANR 222          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. TrEMBL
Match: A0A1B6M0Q2 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.39194 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.238e-8
Identity = 29/51 (56.86%), Postives = 34/51 (66.67%), Query Frame = 3
Query:   39 VKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            VKFVA+ G D + KN   TTI T  +  + MKEYE+KS EELR EDY  NR
Sbjct:  172 VKFVAVTGTDTMAKNGVSTTISTRHHCITCMKEYESKSLEELRLEDYVANR 222          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. TrEMBL
Match: A0A1B6J241 (Uncharacterized protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.37450 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.354e-8
Identity = 29/51 (56.86%), Postives = 34/51 (66.67%), Query Frame = 3
Query:   39 VKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            VKFVA+ G D + KN   TTI T  +  + MKEYE+KS EELR EDY  NR
Sbjct:  172 VKFVAVTGTDTMVKNGVSTTISTRHHCITCMKEYESKSLEELRLEDYVANR 222          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Cavefish
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:103032416])

HSP 1 Score: 51.2174 bits (121), Expect = 7.340e-7
Identity = 26/54 (48.15%), Postives = 32/54 (59.26%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K+   T+I T     + MKEYENKS EELR EDY+  R
Sbjct:  130 GTAIKFNPPTGSDTMVKSGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGR 183          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Cavefish
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:103032416])

HSP 1 Score: 51.2174 bits (121), Expect = 7.365e-7
Identity = 26/54 (48.15%), Postives = 32/54 (59.26%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K+   T+I T     + MKEYENKS EELR EDY+  R
Sbjct:  162 GTAIKFNPPTGSDTMVKSGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGR 215          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Cavefish
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:103032416])

HSP 1 Score: 51.2174 bits (121), Expect = 7.756e-7
Identity = 26/54 (48.15%), Postives = 32/54 (59.26%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT +KF    G D + K+   T+I T     + MKEYENKS EELR EDY+  R
Sbjct:  130 GTAIKFNPPTGSDTMVKSGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGR 183          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002346.1 (pep scaffold:Pmarinus_7.0:GL477945:9692:37886:-1 gene:ENSPMAG00000002110.1 transcript:ENSPMAT00000002346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 8.790e-9
Identity = 29/60 (48.33%), Postives = 36/60 (60.00%), Query Frame = 3
Query:   12 TTQNIIGTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            + Q   GT +KF+ + G D + KN   TTI+T     + MKEYE KS EELR EDY  NR
Sbjct:  155 SAQATKGTTIKFIPVEGTDTMMKNGASTTIRTKHQCITAMKEYETKSLEELRLEDYTDNR 214          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Medaka
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:101172463])

HSP 1 Score: 53.1434 bits (126), Expect = 1.912e-7
Identity = 28/58 (48.28%), Postives = 32/58 (55.17%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNRMSVT 203
            GT VKF    G D + K    T+I T     + MKEYENKS EELR EDY+  R   T
Sbjct:  161 GTTVKFNPPSGTDTMVKAGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGRKGPT 218          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Medaka
Match: nup98 (nucleoporin 98 [Source:NCBI gene;Acc:101172463])

HSP 1 Score: 50.447 bits (119), Expect = 1.343e-6
Identity = 27/54 (50.00%), Postives = 31/54 (57.41%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNR 191
            GT VKF    G D + K    T+I T     + MKEYENKS EELR EDY+  R
Sbjct:  161 GTTVKFNPPSGTDTMVKAGVTTSINTKHQCITAMKEYENKSLEELRLEDYQAGR 214          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Planmine SMEST
Match: SMESG000022300.1 (SMESG000022300.1)

HSP 1 Score: 449.899 bits (1156), Expect = 5.105e-152
Identity = 296/297 (99.66%), Postives = 296/297 (99.66%), Query Frame = 3
Query:    3 SIGTTQNIIGTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNRMSVTLNSTNGIQNNSQIXXXXXXXXXXXXXTINKQSNNLFGANSTGAFGSPVNTNQSNNLFGSNSTGAFGSPVXXXXXXXXXXXXXXXXXXXXXLFGAQANNAQPNNTFGNNANKSLFGNNTNSQSHXXXXXXXXXXXXXXXXXVNSTIAPNNLFGNHNSTNNTATFQGTGLFGAANASTNQFGNPQIELNQKTTLDFNNNSVGNSNTFGQSNQNSIFNNQPSLQNSQAKAPGG 893
            SIGTTQNIIGTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNRMSVTLNSTNGIQNNSQISGFNPNSNNSFGSTINKQSNNLFGANSTGAFGSPVNTNQSNNLFGSNSTGAFGSPVNANQSNNNQGSN FGNNNSSNLFGAQANNAQPNNTFGNNANKSLFGNNTNSQSHNTNFGQNTFTATNTNQQVNSTIAPNNLFGNHNSTNNTATFQGTGLFGAANASTNQFGNPQIELNQKTTLDFNNNSVGNSNTFGQSNQNSIFNNQPSLQNSQAKAPGG
Sbjct:   24 SIGTTQNIIGTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNRMSVTLNSTNGIQNNSQISGFNPNSNNSFGSTINKQSNNLFGANSTGAFGSPVNTNQSNNLFGSNSTGAFGSPVNANQSNNNQGSNLFGNNNSSNLFGAQANNAQPNNTFGNNANKSLFGNNTNSQSHNTNFGQNTFTATNTNQQVNSTIAPNNLFGNHNSTNNTATFQGTGLFGAANASTNQFGNPQIELNQKTTLDFNNNSVGNSNTFGQSNQNSIFNNQPSLQNSQAKAPGG 320          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Planmine SMEST
Match: SMESG000022283.1 (SMESG000022283.1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.653e-12
Identity = 80/250 (32.00%), Postives = 107/250 (42.80%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNRMSVTLNSTNGIQNNSQIXXXXXXXXXXXXXTINKQSNN---------LFGANST---GAFGSPVNTNQSNNLFGSNS--TGAFGSPVXXXXXXXXXXXXXXXXXXXXXLFGAQANNAQPNNTFGNNANKSLFGNNTNSQSHXXXXXXXXXXXXXXXXXVNSTIAPNNLFGNHNSTNNTATFQG---TGLFGAANAS 728
            GT +K+V L G D ++KNN    + T LN  S MKEYE KS EELR EDY  NR  +T  S   I NNS        +  +   +    SNN         LFG   T    AFGS  N  +   LFG+++     FG+                    S++LFG+Q   +  ++ FGN     LFG   + Q                         PN LF N N++ ++  FQ    TG FGA+NA+
Sbjct:   42 GTTIKYVPLNGTDTIQKNNQTVNVSTKLNCISAMKEYEMKSLEELRLEDYTANR--ITPKSNTAILNNSPFGSSQQTTLGTTTQSTLFGSNNQTSAFGSKTLFGNTPTSTNSAFGSFNNQTKPGALFGTSTQNKPLFGT---------------TQPTQSTSLFGSQQQTST-SSLFGNQTQTGLFGGLQSQQQ------------------------PNQLF-NTNTSTSSFGFQSQPTTGFFGASNAA 248          
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Planmine SMEST
Match: SMESG000022283.1 (SMESG000022283.1)

HSP 1 Score: 66.2402 bits (160), Expect = 6.962e-12
Identity = 80/250 (32.00%), Postives = 107/250 (42.80%), Query Frame = 3
Query:   30 GTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKSSEELRFEDYKCNRMSVTLNSTNGIQNNSQIXXXXXXXXXXXXXTINKQSNN---------LFGANST---GAFGSPVNTNQSNNLFGSNS--TGAFGSPVXXXXXXXXXXXXXXXXXXXXXLFGAQANNAQPNNTFGNNANKSLFGNNTNSQSHXXXXXXXXXXXXXXXXXVNSTIAPNNLFGNHNSTNNTATFQG---TGLFGAANAS 728
            GT +K+V L G D ++KNN    + T LN  S MKEYE KS EELR EDY  NR  +T  S   I NNS        +  +   +    SNN         LFG   T    AFGS  N  +   LFG+++     FG+                    S++LFG+Q   +  ++ FGN     LFG   + Q                         PN LF N N++ ++  FQ    TG FGA+NA+
Sbjct:   42 GTTIKYVPLNGTDTIQKNNQTVNVSTKLNCISAMKEYEMKSLEELRLEDYTANR--ITPKSNTAILNNSPFGSSQQTTLGTTTQSTLFGSNNQTSAFGSKTLFGNTPTSTNSAFGSFNNQTKPGALFGTSTQNKPLFGT---------------TQPTQSTSLFGSQQQTST-SSLFGNQTQTGLFGGLQSQQQ------------------------PNQLF-NTNTSTSSFGFQSQPTTGFFGASNAA 248          
The following BLAST results are available for this feature:
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NUP983.674e-748.15nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068][more]
NUP984.038e-748.15nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068][more]
NUP989.489e-748.15nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068][more]
NUP982.428e-648.15nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068][more]
NUP982.716e-648.15nucleoporin 98 [Source:HGNC Symbol;Acc:HGNC:8068][more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
npp-104.640e-642.86Nuclear pore complex protein Nup98-Nup96 Nuclear p... [more]
npp-104.642e-642.86Nuclear pore complex protein Nup98-Nup96 Nuclear p... [more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nup98-961.361e-630.33gene:FBgn0039120 transcript:FBtr0304567[more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nup983.371e-848.15nucleoporin 98 [Source:ZFIN;Acc:ZDB-GENE-040426-11... [more]
nup981.497e-648.15nucleoporin 98 [Source:ZFIN;Acc:ZDB-GENE-040426-11... [more]
nup981.498e-648.15nucleoporin 98 [Source:ZFIN;Acc:ZDB-GENE-040426-11... [more]
nup981.524e-648.15nucleoporin 98 [Source:ZFIN;Acc:ZDB-GENE-040426-11... [more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nup983.328e-648.15nucleoporin 98 [Source:NCBI gene;Acc:100145055][more]
nup983.727e-648.15nucleoporin 98 [Source:NCBI gene;Acc:100145055][more]
nup985.413e-648.15nucleoporin 98 [Source:NCBI gene;Acc:100145055][more]
nup985.859e-648.15nucleoporin 98 [Source:NCBI gene;Acc:100145055][more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nup983.679e-748.15nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404][more]
Nup983.766e-748.15nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404][more]
Nup984.051e-748.15nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404][more]
Nup984.115e-748.15nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404][more]
Nup982.056e-648.15nucleoporin 98 [Source:MGI Symbol;Acc:MGI:109404][more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2J7PID81.569e-951.67Uncharacterized protein (Fragment) OS=Cryptotermes... [more]
A0A1B6F3082.099e-856.86Uncharacterized protein (Fragment) OS=Cuerna arida... [more]
A0A1B6MB102.171e-856.86Uncharacterized protein (Fragment) OS=Graphocephal... [more]
A0A1B6M0Q22.238e-856.86Uncharacterized protein (Fragment) OS=Graphocephal... [more]
A0A1B6J2412.354e-856.86Uncharacterized protein (Fragment) OS=Homalodisca ... [more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nup987.340e-748.15nucleoporin 98 [Source:NCBI gene;Acc:103032416][more]
nup987.365e-748.15nucleoporin 98 [Source:NCBI gene;Acc:103032416][more]
nup987.756e-748.15nucleoporin 98 [Source:NCBI gene;Acc:103032416][more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002346.18.790e-948.33pep scaffold:Pmarinus_7.0:GL477945:9692:37886:-1 g... [more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nup981.912e-748.28nucleoporin 98 [Source:NCBI gene;Acc:101172463][more]
nup981.343e-650.00nucleoporin 98 [Source:NCBI gene;Acc:101172463][more]
back to top
BLAST of Nuclear pore complex protein Nup98-Nup96 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000022300.15.105e-15299.66SMESG000022300.1[more]
SMESG000022283.16.653e-1232.00SMESG000022283.1[more]
SMESG000022283.16.962e-1232.00SMESG000022283.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022556 ID=SMED30022556|Name=Nuclear pore complex protein Nup98-Nup96|organism=Schmidtea mediterranea sexual|type=transcript|length=894bp
CATCGATTGGCACTACACAAAATATAATTGGAACTCCTGTCAAATTTGTT
GCTCTTTTAGGTCAAGATGTAGTTAAAAAAAATAACTTTGACACCACCAT
TAAAACTCTGTTAAATCATACATCAGGAATGAAAGAATATGAAAACAAAT
CCTCCGAGGAATTGAGATTTGAAGATTATAAATGCAATAGAATGAGTGTG
ACATTAAATTCTACAAATGGAATCCAGAATAACAGTCAAATTAGCGGCTT
CAATCCAAATTCAAACAACTCATTCGGATCGACTATTAACAAACAATCGA
ATAATTTATTCGGTGCTAATTCAACTGGTGCATTTGGATCACCAGTGAAT
ACTAACCAATCAAATAATTTATTCGGTTCTAATTCTACTGGTGCATTTGG
ATCACCGGTAAATGCTAACCAATCAAATAACAATCAAGGGAGTAATCGTT
TTGGAAATAACAATTCTTCAAATTTATTTGGTGCACAAGCTAATAATGCA
CAACCTAACAATACCTTTGGTAATAATGCAAATAAAAGCTTATTTGGAAA
TAATACGAACAGCCAATCTCATAATACAAACTTCGGTCAAAACACGTTTA
CTGCAACAAATACCAATCAACAAGTTAATTCCACAATAGCACCCAACAAT
TTATTTGGTAACCATAATTCTACAAACAATACGGCAACATTTCAAGGAAC
TGGGTTATTTGGAGCTGCAAATGCTTCTACCAATCAATTTGGAAATCCAC
AAATTGAATTAAATCAAAAGACAACTCTCGATTTCAATAATAACTCAGTC
GGAAATTCGAATACTTTTGGCCAGAGTAATCAGAATAGTATTTTTAACAA
TCAACCATCATTACAAAATAGTCAAGCTAAAGCTCCTGGTGGTC
back to top

protein sequence of SMED30022556-orf-1

>SMED30022556-orf-1 ID=SMED30022556-orf-1|Name=SMED30022556-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=297bp
SIGTTQNIIGTPVKFVALLGQDVVKKNNFDTTIKTLLNHTSGMKEYENKS
SEELRFEDYKCNRMSVTLNSTNGIQNNSQISGFNPNSNNSFGSTINKQSN
NLFGANSTGAFGSPVNTNQSNNLFGSNSTGAFGSPVNANQSNNNQGSNRF
GNNNSSNLFGAQANNAQPNNTFGNNANKSLFGNNTNSQSHNTNFGQNTFT
ATNTNQQVNSTIAPNNLFGNHNSTNNTATFQGTGLFGAANASTNQFGNPQ
IELNQKTTLDFNNNSVGNSNTFGQSNQNSIFNNQPSLQNSQAKAPGG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006913nucleocytoplasmic transport
GO:0006810transport
Vocabulary: molecular function
TermDefinition
GO:0017056structural constituent of nuclear pore
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR037665Nucleoporin_S59-like
Vocabulary: cellular component
TermDefinition
GO:0005643nuclear pore
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.10.2360coord: 9..64
e-value: 3.5E-16
score: 60.9
IPR037665Nucleoporin peptidase S59-likePANTHERPTHR23198NUCLEOPORINcoord: 30..289