Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30022545
Length (bp)1948
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30022545) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30022545) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30022545) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30022545) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022545

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022545SMESG000057044.1 dd_Smed_v4_9098_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022545SMESG000057044.1 dd_Smed_v4_9098_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022545SMESG000057044.1 dd_Smed_v6_9098_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022545SMESG000057044.1 dd_Smed_v4_9098_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022545SMESG000057044.1 dd_Smed_v4_9098_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK11 (NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGNC:18593])

HSP 1 Score: 308.916 bits (790), Expect = 1.174e-97
Identity = 153/360 (42.50%), Postives = 232/360 (64.44%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETL-VNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQ 1200
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLSKL+H  IVKF  SF  ++N+CIITEYCEG DL   I++ K++G    E +II WFIQ++ G+DY+H+R+ILHRDLK  N+FLK + +KIGDFG+SR+L  + DLA+T  GTP+YMSPE LKH GY+T SDIWS   ILYEMC + HAF G N + +++ I+E   P +P  Y + L  ++E +L K+P  RP A EIL +P++  ++++      E     + L    E+  I N + K   L  + A S   ++TP++++ L+K   AD+KA + ++ +E+ ++ N +  ++L+   FQ
Sbjct:   26 ARRYVLQQKLGSGSFGTVYLVSDKKAKRGEE-LKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQ 384          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK11 (NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGNC:18593])

HSP 1 Score: 308.916 bits (790), Expect = 1.174e-97
Identity = 153/360 (42.50%), Postives = 232/360 (64.44%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETL-VNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQ 1200
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLSKL+H  IVKF  SF  ++N+CIITEYCEG DL   I++ K++G    E +II WFIQ++ G+DY+H+R+ILHRDLK  N+FLK + +KIGDFG+SR+L  + DLA+T  GTP+YMSPE LKH GY+T SDIWS   ILYEMC + HAF G N + +++ I+E   P +P  Y + L  ++E +L K+P  RP A EIL +P++  ++++      E     + L    E+  I N + K   L  + A S   ++TP++++ L+K   AD+KA + ++ +E+ ++ N +  ++L+   FQ
Sbjct:   26 ARRYVLQQKLGSGSFGTVYLVSDKKAKRGEE-LKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQ 384          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK11 (NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGNC:18593])

HSP 1 Score: 308.531 bits (789), Expect = 2.845e-97
Identity = 153/360 (42.50%), Postives = 232/360 (64.44%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETL-VNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQ 1200
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLSKL+H  IVKF  SF  ++N+CIITEYCEG DL   I++ K++G    E +II WFIQ++ G+DY+H+R+ILHRDLK  N+FLK + +KIGDFG+SR+L  + DLA+T  GTP+YMSPE LKH GY+T SDIWS   ILYEMC + HAF G N + +++ I+E   P +P  Y + L  ++E +L K+P  RP A EIL +P++  ++++      E     + L    E+  I N + K   L  + A S   ++TP++++ L+K   AD+KA + ++ +E+ ++ N +  ++L+   FQ
Sbjct:   26 ARRYVLQQKLGSGSFGTVYLVSDKKAKRGEE-LKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQ 384          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK11 (NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGNC:18593])

HSP 1 Score: 308.531 bits (789), Expect = 6.311e-96
Identity = 153/360 (42.50%), Postives = 232/360 (64.44%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETL-VNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQ 1200
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLSKL+H  IVKF  SF  ++N+CIITEYCEG DL   I++ K++G    E +II WFIQ++ G+DY+H+R+ILHRDLK  N+FLK + +KIGDFG+SR+L  + DLA+T  GTP+YMSPE LKH GY+T SDIWS   ILYEMC + HAF G N + +++ I+E   P +P  Y + L  ++E +L K+P  RP A EIL +P++  ++++      E     + L    E+  I N + K   L  + A S   ++TP++++ L+K   AD+KA + ++ +E+ ++ N +  ++L+   FQ
Sbjct:   26 ARRYVLQQKLGSGSFGTVYLVSDKKAKRGEE-LKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQ 384          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK11 (NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGNC:18593])

HSP 1 Score: 309.301 bits (791), Expect = 1.039e-95
Identity = 153/360 (42.50%), Postives = 232/360 (64.44%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETL-VNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQ 1200
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLSKL+H  IVKF  SF  ++N+CIITEYCEG DL   I++ K++G    E +II WFIQ++ G+DY+H+R+ILHRDLK  N+FLK + +KIGDFG+SR+L  + DLA+T  GTP+YMSPE LKH GY+T SDIWS   ILYEMC + HAF G N + +++ I+E   P +P  Y + L  ++E +L K+P  RP A EIL +P++  ++++      E     + L    E+  I N + K   L  + A S   ++TP++++ L+K   AD+KA + ++ +E+ ++ N +  ++L+   FQ
Sbjct:   26 ARRYVLQQKLGSGSFGTVYLVSDKKAKRGEE-LKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQ 384          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 174.096 bits (440), Expect = 3.845e-49
Identity = 93/263 (35.36%), Postives = 153/263 (58.17%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKV-LKEVNV-DTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS-VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGD--NLMRVMVTILESPCPRIPSN-YSENLQEVLECILVKDPDNRPKACEILDL 909
            +I    IGKG F  V     FR       + V LK++ V + +DQ   ++C +E  LL +LNH N+++++ SF   N   I+ E  E GD+ ++I+  K+ G  + E  I ++F+Q+   L ++H ++I+HRD+KP N+F+  +  VK+GD G+ R  +     A + +GTPYYMSPE ++  GYN  SD+WS+G +LYEM AL+  F GD  NL  +   I     P +P++ YS  L++++   ++ +   RP+  E+L +
Sbjct:   23 FIIEKKIGKGQFSEV-----FRAQCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQV 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 174.096 bits (440), Expect = 3.845e-49
Identity = 93/263 (35.36%), Postives = 153/263 (58.17%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKV-LKEVNV-DTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS-VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGD--NLMRVMVTILESPCPRIPSN-YSENLQEVLECILVKDPDNRPKACEILDL 909
            +I    IGKG F  V     FR       + V LK++ V + +DQ   ++C +E  LL +LNH N+++++ SF   N   I+ E  E GD+ ++I+  K+ G  + E  I ++F+Q+   L ++H ++I+HRD+KP N+F+  +  VK+GD G+ R  +     A + +GTPYYMSPE ++  GYN  SD+WS+G +LYEM AL+  F GD  NL  +   I     P +P++ YS  L++++   ++ +   RP+  E+L +
Sbjct:   23 FIIEKKIGKGQFSEV-----FRAQCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQV 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 185.267 bits (469), Expect = 4.346e-49
Identity = 105/265 (39.62%), Postives = 156/265 (58.87%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGT--VYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS-VKIGDFGISRILNFTNDLAS---TFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDL 909
            NRY  +  +GKG+FG+  +Y+ ++        S+ ++KE+N+  +D  Q      E  LLS++ H NI+ ++DSF  E    I  EY +GG L Q++ +T+   + L+E +I    IQ+   + Y+H+  +LHRDLK  N+FL  DS VKIGDFGIS+I+  T  LA    T +GTPYY+SPE+     YN  SD+W+ G ILYEMC LK AF GDNL  ++ +I+      +   YS  ++ V+  +L  DP  RP A + L +
Sbjct:  131 NRYERIRTVGKGAFGSAVLYRRRE------DSSLVIIKEINMYDLDSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLSRTQ---NLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMG-TETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPVKGPYSAEMKMVIRELLQLDPQKRPSAPQALKM 385          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 184.882 bits (468), Expect = 5.599e-49
Identity = 105/265 (39.62%), Postives = 156/265 (58.87%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGT--VYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS-VKIGDFGISRILNFTNDLAS---TFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDL 909
            NRY  +  +GKG+FG+  +Y+ ++        S+ ++KE+N+  +D  Q      E  LLS++ H NI+ ++DSF  E    I  EY +GG L Q++ +T+   + L+E +I    IQ+   + Y+H+  +LHRDLK  N+FL  DS VKIGDFGIS+I+  T  LA    T +GTPYY+SPE+     YN  SD+W+ G ILYEMC LK AF GDNL  ++ +I+      +   YS  ++ V+  +L  DP  RP A + L +
Sbjct:  169 NRYERIRTVGKGAFGSAVLYRRRE------DSSLVIIKEINMYDLDSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLSRTQ---NLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMG-TETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPVKGPYSAEMKMVIRELLQLDPQKRPSAPQALKM 423          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-2 (Serine/threonine-protein kinase nekl-2 [Source:UniProtKB/Swiss-Prot;Acc:O01775])

HSP 1 Score: 154.066 bits (388), Expect = 2.747e-41
Identity = 85/261 (32.57%), Postives = 145/261 (55.56%), Query Frame = 1
Query:  157 IGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIE-----KTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL--KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFI 918
            +G+G+FG  +  +       Q+ I  +K +N   M + +      E  LL K+ H  I+ + DSF ++N   I+ +Y EGG L+++I      K      +  E  ++ +F Q++  L+++H++ I+HRDLKP NI +  +   +K+ DFGIS+ L  T   AST +GTP Y+SPE+ +   YN  SD+WS G +LYE+  L+ AF G+NL  +++ I  S    +  + S +++ ++E +L    D RP   ++L  P +
Sbjct:   10 VGRGAFGVCWLCRGKNDASHQKVI--IKLINTHGMTEKEENSIQSEVNLLKKVQHPLIIGYIDSFIMDNQLGIVMQYAEGGTLERLINDQRAIKDSNMREYFPEKTVLDYFTQILIALNHMHQKNIVHRDLKPQNILMNRRKTVLKLSDFGISKELG-TKSAASTVIGTPNYLSPEICESRPYNQKSDMWSLGCVLYELLQLERAFDGENLPAIVMKITRSKQNPLGDHVSNDVKMLVENLLKTHTDKRPDVSQLLSDPLV 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 184.111 bits (466), Expect = 2.881e-49
Identity = 96/267 (35.96%), Postives = 149/267 (55.81%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSF--RLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKR----KILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFI 918
            Y  L+ +G GSFGT YKV+D    +    +   K +N D +D+ + +    E  +L +L H NIV+++     R   +  I+ E C GGDL Q++++ +      EE  I R   Q+   L   H +     ILHRD+KP NIFL    + K+GDFG++R+L      A++F+GTP+YMSPE++K   Y+  SD+W+ G ++YEMCAL+  F G    ++   I +    RIP+ YS +LQE++  +L  D + RP    I+  P +
Sbjct:   19 YEVLAVMGNGSFGTCYKVRD----KSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIRHPLV 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: niki (gene:FBgn0045980 transcript:FBtr0084737)

HSP 1 Score: 169.088 bits (427), Expect = 9.338e-44
Identity = 97/250 (38.80%), Postives = 139/250 (55.60%), Query Frame = 1
Query:  157 IGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEIL 903
            +G+GSFG     +  R  +G +   V K++N+  +     +    E  + SKL+H NIV +  SF  +N   I  EY +GG L Q+I + ++   H  E  II  F Q+   ++Y+H   ILHRDLK  N+FL +   VKIGDFGIS+I+N T   A T LGTPYY SPE+ +   Y+  SDIW+ G IL EMC LK  F   NL  ++  I+      +PS Y+  L+ ++  +L  +   RP A E+L
Sbjct:  111 VGQGSFGIAILYR--RKSDGHQ--IVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIAE-RQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIGDFGISKIMN-TKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 158.688 bits (400), Expect = 6.890e-41
Identity = 91/269 (33.83%), Postives = 158/269 (58.74%), Query Frame = 1
Query:  157 IGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPW-IDIVE 957
            IGKGSFG V+K  D R     + +  +K ++++  + D+I++  +E  +LS+ +   + K++ SF       II EY  GG    ++    ++GS  EE+ I     +V++GLDY+H  + LHRD+K  N+ L +   VK+ DFG++  L  T    +TF+GTP++M+PEV+K   Y+  +DIWS G+   E+   +      + MRV+  I ++  P++  +Y+++ ++ +E  L KDP+NRP A E+L  PFIK   ++ + ID+++
Sbjct:   19 IGKGSFGEVFKGIDNR----TQQVVAIKIIDLEEAE-DEIDDIQQEIMVLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLM----KAGS-FEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQLTGSYTKSFKDFVEACLNKDPENRPTAKELLKYPFIKKAKKNAYLIDLID 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Slik (gene:FBgn0035001 transcript:FBtr0290019)

HSP 1 Score: 144.821 bits (364), Expect = 1.772e-35
Identity = 82/266 (30.83%), Postives = 147/266 (55.26%), Query Frame = 1
Query:  145 FLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVL-----KHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRI--PSNYSENLQEVLECILVKDPDNRPKACEILDLPFI 918
             +  +G G+FG VYK +     + Q+     K   ++  D++ + +   E  +LS++ H NIV+ +++F +++   ++ EYC+GG L  ++ + ++    L E +I      + EGL ++H+ K++HRDLK  N+ L  +  VK+ DFG+S     T     TF+GTPY+M+PE++     + + Y+   DIWS G+ L E+  ++      + MRV++ I +S  P++  PS +S+   + L+  LVKDP  RP    ++   FI
Sbjct:   39 MVGELGDGAFGKVYKAQH----KEQKRFAAAKMCQLE--DEENLSDHMVEIDILSEIKHPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKP---LTEPQIAYVCKHMTEGLTFLHRNKVIHRDLKAGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGTPYWMAPELVLCETFRDNPYDHKVDIWSLGITLIELAQMEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLVKDPQVRPTTDVLMQHAFI 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Slik (gene:FBgn0035001 transcript:FBtr0100470)

HSP 1 Score: 144.436 bits (363), Expect = 1.916e-35
Identity = 82/266 (30.83%), Postives = 147/266 (55.26%), Query Frame = 1
Query:  145 FLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVL-----KHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRI--PSNYSENLQEVLECILVKDPDNRPKACEILDLPFI 918
             +  +G G+FG VYK +     + Q+     K   ++  D++ + +   E  +LS++ H NIV+ +++F +++   ++ EYC+GG L  ++ + ++    L E +I      + EGL ++H+ K++HRDLK  N+ L  +  VK+ DFG+S     T     TF+GTPY+M+PE++     + + Y+   DIWS G+ L E+  ++      + MRV++ I +S  P++  PS +S+   + L+  LVKDP  RP    ++   FI
Sbjct:   39 MVGELGDGAFGKVYKAQH----KEQKRFAAAKMCQLE--DEENLSDHMVEIDILSEIKHPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKP---LTEPQIAYVCKHMTEGLTFLHRNKVIHRDLKAGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGTPYWMAPELVLCETFRDNPYDHKVDIWSLGITLIELAQMEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLVKDPQVRPTTDVLMQHAFI 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek11 (NIMA-related kinase 11 [Source:ZFIN;Acc:ZDB-GENE-100922-73])

HSP 1 Score: 278.87 bits (712), Expect = 9.042e-85
Identity = 146/350 (41.71%), Postives = 214/350 (61.14%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRD--PWIDIVENDDMSETLVNNE--SKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSN 1161
             NRYI    +GKGSFGTVY VKD +    +E +KVLKE+ V  +  ++    T+E +LLS+L+H  I+KF+ SF   + +CIITE+CE  DL   +E+ K +G  L E ++  W  Q++ G+ YIH+R+ILHRDLK  NIFL+ + VKIGDFG+S  L  + DLA+TF GTPYYMSPE L H GY++ SDIWS G ILYEMC L HAF   N + V++ I+E P P +P  YS  L  +++ +L KD  +R  A + L   FI+  ++       I+   D S   +  E  +  I   L K   L  +   S   +++P++++ L+K   AD+KA + ++ +E+ ++ N
Sbjct:   28 ANRYIIQQRLGKGSFGTVYLVKDTKAV-AEERLKVLKEIPVGDLKPNETVHATQEAQLLSQLSHPAILKFYSSFLERDAFCIITEFCEDKDLDCKLEELKHTGKTLSEPQVCEWLCQLLLGVHYIHQRRILHRDLKAKNIFLRKNIVKIGDFGVSCFLMGSCDLATTFTGTPYYMSPEALSHKGYDSKSDIWSLGCILYEMCCLAHAFEAQNFLAVVLRIVEGPTPSLPETYSRQLNSLMQSMLEKDSSHRISAADALRNRFIEESLQSMKHKFSILSLRDKS---IGGERDASQILRALQKKVHLQTLQDRSEVQKMSPRERMRLRKLQAADEKARKLKQIVEEKYQEN 373          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 213.001 bits (541), Expect = 1.079e-63
Identity = 109/267 (40.82%), Postives = 167/267 (62.55%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            ++Y  L  IG+GSFG    VK     +G++   V+KE+ +  M   + +E  +E  +L+ ++H NIV++ +SF       I+ +YCEGGDL + I   +  GS   E +I+ WF+Q+   L ++H RKILHRD+K  NIFL  D +V++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYEMC LKHAF   N+  +++ I+    P +  +YS +L+ +L  +  ++P  RP    ILD PF+  +I
Sbjct:    2 DKYERLKKIGEGSFGKAILVKS--RTDGRQY--VIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEESGCLYIVMDYCEGGDLFKKINNQR--GSLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSIHYSPDLRSLLAQLFKRNPRERPSVSTILDKPFLARRI 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek4 (NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1392])

HSP 1 Score: 216.853 bits (551), Expect = 3.113e-60
Identity = 107/266 (40.23%), Postives = 166/266 (62.41%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLEN-NYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            Y+F+  +GKGS+G V  V+     +      V+K++N+ T  + +     +E +LLS+L H NIV + +S+  E+    I+  +CEGGDL   +++ K  G  L E +++ WF+Q+   L Y+H++ ILHRDLK  NIFL K + +K+GD GI+R+L   ND+AST +GTPYYMSPE+  +  YN  SD+W+ G  +YEM  LKHAF   ++  ++  I+E   P++PS Y   L E+++ +L K P++RP    IL  P+IK +I
Sbjct:    4 YLFVRVVGKGSYGEVNLVRH----KSDRKQYVIKKLNLRTSSRRERRAAEQEAQLLSQLKHPNIVMYRESWEGEDCQLYIVMGFCEGGDLYHRLKQQK--GELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIVEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPYIKHQI 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek4 (NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1392])

HSP 1 Score: 217.238 bits (552), Expect = 3.146e-60
Identity = 107/266 (40.23%), Postives = 166/266 (62.41%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLEN-NYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            Y+F+  +GKGS+G V  V+     +      V+K++N+ T  + +     +E +LLS+L H NIV + +S+  E+    I+  +CEGGDL   +++ K  G  L E +++ WF+Q+   L Y+H++ ILHRDLK  NIFL K + +K+GD GI+R+L   ND+AST +GTPYYMSPE+  +  YN  SD+W+ G  +YEM  LKHAF   ++  ++  I+E   P++PS Y   L E+++ +L K P++RP    IL  P+IK +I
Sbjct:    4 YLFVRVVGKGSYGEVNLVRH----KSDRKQYVIKKLNLRTSSRRERRAAEQEAQLLSQLKHPNIVMYRESWEGEDCQLYIVMGFCEGGDLYHRLKQQK--GELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIVEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPYIKHQI 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek12 (NIMA-related kinase 12 [Source:ZFIN;Acc:ZDB-GENE-050410-11])

HSP 1 Score: 196.823 bits (499), Expect = 2.315e-55
Identity = 105/285 (36.84%), Postives = 170/285 (59.65%), Query Frame = 1
Query:  157 IGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECT-REGKLLSKLNHSNIVKFFDSFRLENNYCI--ITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNESK 999
            +G+G  G V  +K        + +  +K ++VD+  + + ++   +E  +L  L H +I+ + D+F    N  I  + +YC+GG L   I K ++ G H  E  I+ WF+QV+  + YIH  KILHRD+KP+N+ L K   +K+GDFGIS+I+N T D+AST +GTP Y+SPE+ +   Y+T SDIW+ G +LYE+CALK AF   NL+ +   I++    ++P  YSE++  ++E +L   P+NRP A  IL + +++  +     + + N +   T VN ES+
Sbjct:   10 LGQGGAGVVSLMKHV----DTKKLCAVKRIHVDSSRKTKTKDVVLQEAIVLRSLKHPHIITWIDTFFDATNESIYIVMDYCDGGTLDDHI-KEQKCGEHFTESNIMDWFVQVVMAVSYIHSEKILHRDIKPSNVLLTKRGVIKLGDFGISKIMNHTLDMASTCVGTPSYLSPELCQDVPYSTKSDIWAVGCLLYELCALKPAFQAKNLLSLFYKIIKGEYIKVPEMYSEDIHTLIEKMLSLIPENRPSAASILSMTYVQEHLG----NFITNQEKELTKVNAESR 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: sult1c1 (sulfotransferase family, cytosolic, 1C, member 1 [Source:Xenbase;Acc:XB-GENE-6460751])

HSP 1 Score: 306.22 bits (783), Expect = 5.557e-95
Identity = 156/361 (43.21%), Postives = 233/361 (64.54%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDI--VENDDMSETLVNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQ 1200
              RY+    +GKGSFGTVY V D +  + QES+KVLKE+ V  ++ ++  +   E +LLSKL+H  IVKF  SF    ++CIITEYCEG DL   + + K++   + E +++ WFIQ++ G++Y+H R+ILHRDLK  NIFLK + +KIGDFG+SR+L  + DLA+TF GTPYYMSPE LKH GY++ SDIWS G IL+EMC L+HAFIG N + V+++I+E   P +P  YS +L  ++  +L KDP  RP A EIL  PFI  +++    ++   E  D + T+   E+  I N + +   L  +   S   ++TP++++ L+K   AD+KA   ++  E+ ++ N +  ++L+   FQ
Sbjct:   25 AKRYLLQQRLGKGSFGTVYLVIDKKAKDEQESLKVLKEIPVGELNPNETVQANVEAQLLSKLDHPAIVKFHASFLENESFCIITEYCEGRDLDFKVRECKKNEEKIAENQVVEWFIQLLLGVNYMHVRRILHRDLKAKNIFLKNNLLKIGDFGVSRLLMGSCDLATTFTGTPYYMSPEALKHQGYDSKSDIWSLGCILHEMCCLEHAFIGYNFLSVVISIVEGETPSLPDCYSSSLNLIMNRMLNKDPALRPSAGEILQDPFINEQLKQVKWEVYGAEVKDKT-TICKKEADQIRNVVQRKFHLQTLRELSEVQKMTPRERMRLRKLNAADEKARRLKQLAEEKYQENHKRMQELRSRNFQ 384          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000013864.1 (serine/threonine-protein kinase Nek11-like [Source:NCBI gene;Acc:100486125])

HSP 1 Score: 279.641 bits (714), Expect = 1.454e-85
Identity = 156/391 (39.90%), Postives = 225/391 (57.54%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFI--KSKIRDPWIDIVENDDMSETLVNNESKDISNF-LSKSTGLNI----ITAASVELTPKQKILLKKS------MEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQSSLPFTNQRNASTRSSISEYDE 1266
             RY     +G GSF T Y V D +    Q   KVLK +  + M  D      RE KLL  L H  IV+F  SF  + ++CIITE+CEGGDL+  I+K +       E  +I WFIQ++ G++Y+H+R ILHRDLK  NIFLK  +VKIGDFG+SRIL+  +D+A+TF GTP+YMSPEVL+H GYN  SDIWS G ILYE+CAL+HA+   N ++++  I+E PCP +PS YS  L ++L+ +L KDP  RP A EIL +P +    K+   W+     + + E   +  S+D +   +     L++    I     E+ P+Q+  ++K       M+  K+A + R Y E   KS    R ++  D+ ++     +    S + S S+ +E
Sbjct:   27 GRYNIHHTLGSGSFATAYLVTDAKDAGHQ---KVLKRIPCEGMKPDATLPSAREAKLLGSLRHPFIVRFLSSFLEKEDFCIITEFCEGGDLQNRIQKQREKSQLFPEEHVIEWFIQLLLGVNYLHERLILHRDLKSKNIFLKNGTVKIGDFGVSRILSMPSDMATTFTGTPHYMSPEVLEHYGYNAKSDIWSLGCILYEICALRHAYDSANWIKLVSQIVEGPCPSLPSQYSAELNDILKRVLNKDPQQRPSASEILHMPTVVDHEKVLSIWL----QEALHEGRQDCGSEDAARIAVEMQEKLHVDSLRIMRQVQEMAPRQRRRIRKEEQQETHMKKIKRAVD-RLYKEMHPKSGQNRRSEINGDEDETPADVIHISEGSCKDSCSDSEE 409          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: sez6l2 (seizure related 6 homolog like 2 [Source:Xenbase;Acc:XB-GENE-921456])

HSP 1 Score: 205.682 bits (522), Expect = 2.000e-60
Identity = 110/289 (38.06%), Postives = 170/289 (58.82%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS--VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNE 993
            ++Y  +  IG+G+FG  Y  K     +      V+KE+N+  M   + E   +E  LL+K+ H NIV FF S    N   I+ EYC+GGDL + + K +  G   EE +I+ WF+Q+  GL +IH RK+LHRD+K  NIFL  +    K+GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  +DIWS G +LYE+CALKH F   +L ++++ I       IP+ YS +L+ ++  +      +RP    IL  PF++ +I       +  ++ S T+++ +
Sbjct:    2 DKYDIVRMIGEGAFGKAYLAKG----KSDNMQCVIKEINLSKMPTKEKEASHKEVVLLAKMKHPNIVTFFSSIEERNKLYIVMEYCDGGDLMKRVNKQR--GVLFEEDQILSWFVQISLGLKHIHDRKVLHRDIKAQNIFLSNNGTLAKLGDFGIARMLNNTMELARTCVGTPYYLSPEICENKPYNNKTDIWSLGCVLYELCALKHPFEASSLRQLVLKICRGRYEPIPTKYSYDLRILVSQLFKISSRDRPSINSILKKPFLEKRINKHLSPELIEEEFSHTVIHRK 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 218.394 bits (555), Expect = 1.429e-59
Identity = 111/267 (41.57%), Postives = 168/267 (62.92%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            N+Y+ +S IG+GSFG    VK     +G++   V+KE+ +  M   + EE  RE  +L+ + H NIV++ +SF       I+ +YCEGGDL + I   K  G    E +I+ WF+Q+   L ++H RKILHRD+K  NIFL K  ++++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYEMC LKHAF   N+  +++ I+    P +  +YS +L+ +L  +  ++P +RP    IL+ PFI  +I
Sbjct:    2 NKYVRVSKIGEGSFGKAILVKSKD--DGKQY--VIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQK--GVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRI 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 218.009 bits (554), Expect = 1.485e-59
Identity = 111/267 (41.57%), Postives = 168/267 (62.92%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            N+Y+ +S IG+GSFG    VK     +G++   V+KE+ +  M   + EE  RE  +L+ + H NIV++ +SF       I+ +YCEGGDL + I   K  G    E +I+ WF+Q+   L ++H RKILHRD+K  NIFL K  ++++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYEMC LKHAF   N+  +++ I+    P +  +YS +L+ +L  +  ++P +RP    IL+ PFI  +I
Sbjct:    2 NKYVRVSKIGEGSFGKAILVKSKD--DGKQY--VIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQK--GVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRI 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek11 (NIMA (never in mitosis gene a)-related expressed kinase 11 [Source:MGI Symbol;Acc:MGI:2442276])

HSP 1 Score: 281.952 bits (720), Expect = 8.487e-89
Identity = 140/336 (41.67%), Postives = 212/336 (63.10%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMS----ETLVNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKA 1119
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLS+L+H  IV+F  SF  +  +CIITEYCEG DL   I++ K +G    E +I+ WFIQ++ G+DY+H+R+ILHRDLK  NIFLK + +KIGDFG+SR+L  + +LA+T  GTP+YMSPE LKH GY+  SDIWS   ILYEMC L HAF G + + V++ I+E   P +P  Y   L  ++E +L K P  RP A +IL  P+++ +++   + + +  +M+     ++   E+    N + K   L  + A S   + TP++++ L+K   AD++A
Sbjct:   27 ARRYVLQQKLGSGSFGTVYLVSDKKAKPGEE-LKVLKEISVGELNPNETVQANVEAQLLSRLHHPAIVRFHASFMEQETFCIITEYCEGRDLDYRIQEYKEAGKVFAENQIVEWFIQLLLGVDYMHERRILHRDLKSKNIFLKNNLLKIGDFGVSRLLMGSCELATTLTGTPHYMSPEALKHQGYDAKSDIWSLACILYEMCCLDHAFAGSSFLSVVLNIVEGKTPSLPDRYPRELNTIMERMLNKSPSLRPSAADILKAPYMEEQLQ---LLMCKYPEMTLEDKNSVCQKEAAHTINAVQKKLHLQTLQALSDTQKTTPRERMWLRKLQAADERA 358          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek11 (NIMA (never in mitosis gene a)-related expressed kinase 11 [Source:MGI Symbol;Acc:MGI:2442276])

HSP 1 Score: 288.115 bits (736), Expect = 6.123e-88
Identity = 144/358 (40.22%), Postives = 223/358 (62.29%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMS----ETLVNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLK 1185
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLS+L+H  IV+F  SF  +  +CIITEYCEG DL   I++ K +G    E +I+ WFIQ++ G+DY+H+R+ILHRDLK  NIFLK + +KIGDFG+SR+L  + +LA+T  GTP+YMSPE LKH GY+  SDIWS   ILYEMC L HAF G + + V++ I+E   P +P  Y   L  ++E +L K P  RP A +IL  P+++ +++   + + +  +M+     ++   E+    N + K   L  + A S   + TP++++ L+K   AD++A   ++  E+ +K N +  + L+
Sbjct:   27 ARRYVLQQKLGSGSFGTVYLVSDKKAKPGEE-LKVLKEISVGELNPNETVQANVEAQLLSRLHHPAIVRFHASFMEQETFCIITEYCEGRDLDYRIQEYKEAGKVFAENQIVEWFIQLLLGVDYMHERRILHRDLKSKNIFLKNNLLKIGDFGVSRLLMGSCELATTLTGTPHYMSPEALKHQGYDAKSDIWSLACILYEMCCLDHAFAGSSFLSVVLNIVEGKTPSLPDRYPRELNTIMERMLNKSPSLRPSAADILKAPYMEEQLQ---LLMCKYPEMTLEDKNSVCQKEAAHTINAVQKKLHLQTLQALSDTQKTTPRERMWLRKLQAADERARRLKKIAEENYKENDKRMQALR 380          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek1 (NIMA (never in mitosis gene a)-related expressed kinase 1 [Source:MGI Symbol;Acc:MGI:97303])

HSP 1 Score: 218.779 bits (556), Expect = 7.149e-60
Identity = 109/266 (40.98%), Postives = 168/266 (63.16%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            +Y+ L  IG+GSFG    VK     +G+    V+KE+N+  M   + +E  RE  +L+ + H NIV++ +SF    +  I+ +YCEGGDL + I   K  G+  +E +I+ WF+Q+   L ++H RKILHRD+K  NIFL  D +V++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYE+C LKHAF   N+  +++ I+    P +  +YS +L+ +L  +  ++P +RP    IL+  FI  +I
Sbjct:    3 KYVRLQKIGEGSFGKAVLVKSTE--DGRHY--VIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQK--GALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRI 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek1 (NIMA (never in mitosis gene a)-related expressed kinase 1 [Source:MGI Symbol;Acc:MGI:97303])

HSP 1 Score: 218.779 bits (556), Expect = 7.311e-60
Identity = 109/266 (40.98%), Postives = 168/266 (63.16%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            +Y+ L  IG+GSFG    VK     +G+    V+KE+N+  M   + +E  RE  +L+ + H NIV++ +SF    +  I+ +YCEGGDL + I   K  G+  +E +I+ WF+Q+   L ++H RKILHRD+K  NIFL  D +V++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYE+C LKHAF   N+  +++ I+    P +  +YS +L+ +L  +  ++P +RP    IL+  FI  +I
Sbjct:    3 KYVRLQKIGEGSFGKAVLVKSTE--DGRHY--VIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQK--GALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRI 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek1 (NIMA (never in mitosis gene a)-related expressed kinase 1 [Source:MGI Symbol;Acc:MGI:97303])

HSP 1 Score: 218.779 bits (556), Expect = 7.755e-60
Identity = 109/266 (40.98%), Postives = 168/266 (63.16%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            +Y+ L  IG+GSFG    VK     +G+    V+KE+N+  M   + +E  RE  +L+ + H NIV++ +SF    +  I+ +YCEGGDL + I   K  G+  +E +I+ WF+Q+   L ++H RKILHRD+K  NIFL  D +V++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYE+C LKHAF   N+  +++ I+    P +  +YS +L+ +L  +  ++P +RP    IL+  FI  +I
Sbjct:    3 KYVRLQKIGEGSFGKAVLVKSTE--DGRHY--VIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQK--GALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRI 262          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NG66|NEK11_HUMAN (Serine/threonine-protein kinase Nek11 OS=Homo sapiens OX=9606 GN=NEK11 PE=1 SV=2)

HSP 1 Score: 309.301 bits (791), Expect = 4.990e-95
Identity = 153/360 (42.50%), Postives = 232/360 (64.44%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETL-VNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQ 1200
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLSKL+H  IVKF  SF  ++N+CIITEYCEG DL   I++ K++G    E +II WFIQ++ G+DY+H+R+ILHRDLK  N+FLK + +KIGDFG+SR+L  + DLA+T  GTP+YMSPE LKH GY+T SDIWS   ILYEMC + HAF G N + +++ I+E   P +P  Y + L  ++E +L K+P  RP A EIL +P++  ++++      E     + L    E+  I N + K   L  + A S   ++TP++++ L+K   AD+KA + ++ +E+ ++ N +  ++L+   FQ
Sbjct:   26 ARRYVLQQKLGSGSFGTVYLVSDKKAKRGEE-LKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQ 384          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WNU8|NEK11_MACFA (Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis OX=9541 GN=NEK11 PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 2.373e-93
Identity = 152/360 (42.22%), Postives = 230/360 (63.89%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETL-VNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQ 1200
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLSKL+H  IVKF  SF  ++N+CIITEYCEG DL   I++ K +G    + +II WFIQ++ G+DY+H+R+ILHRDLK  NIFLK + +KIGDFG+SR+L  + DLA+T  GTP+YMSPE LKH GY+T SDIWS   ILYEMC + HAF G N + +++ I+E   P +P  Y + L  ++E +L K+P  RP A EIL +P+I  +++       E     + L    E+  + N + K   L  + A S   ++TP++++ L+K   AD++A + ++ +E+ ++ N +  ++L+   FQ
Sbjct:   26 ARRYVLQQKLGSGSFGTVYLVSDKKAKRGEE-LKVLKEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDYKIQEYKEAGKIFPDNQIIEWFIQLLLGVDYMHERRILHRDLKSKNIFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNTIMESMLNKNPSLRPSAIEILKIPYIDEQLQHLMCRHSEMTLEDKNLDCQKEAARLINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADERARKLKKIVEEKYEENSKRMQELRSRNFQ 384          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C0Q4|NEK11_MOUSE (Serine/threonine-protein kinase Nek11 OS=Mus musculus OX=10090 GN=Nek11 PE=2 SV=2)

HSP 1 Score: 288.115 bits (736), Expect = 4.283e-87
Identity = 144/358 (40.22%), Postives = 223/358 (62.29%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMS----ETLVNNESKDISNFLSKSTGLNIITAAS--VELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLK 1185
              RY+    +G GSFGTVY V D +   G+E +KVLKE++V  ++ ++  +   E +LLS+L+H  IV+F  SF  +  +CIITEYCEG DL   I++ K +G    E +I+ WFIQ++ G+DY+H+R+ILHRDLK  NIFLK + +KIGDFG+SR+L  + +LA+T  GTP+YMSPE LKH GY+  SDIWS   ILYEMC L HAF G + + V++ I+E   P +P  Y   L  ++E +L K P  RP A +IL  P+++ +++   + + +  +M+     ++   E+    N + K   L  + A S   + TP++++ L+K   AD++A   ++  E+ +K N +  + L+
Sbjct:   27 ARRYVLQQKLGSGSFGTVYLVSDKKAKPGEE-LKVLKEISVGELNPNETVQANVEAQLLSRLHHPAIVRFHASFMEQETFCIITEYCEGRDLDYRIQEYKEAGKVFAENQIVEWFIQLLLGVDYMHERRILHRDLKSKNIFLKNNLLKIGDFGVSRLLMGSCELATTLTGTPHYMSPEALKHQGYDAKSDIWSLACILYEMCCLDHAFAGSSFLSVVLNIVEGKTPSLPDRYPRELNTIMERMLNKSPSLRPSAADILKAPYMEEQLQ---LLMCKYPEMTLEDKNSVCQKEAAHTINAVQKKLHLQTLQALSDTQKTTPRERMWLRKLQAADERARRLKKIAEENYKENDKRMQALR 380          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86I06|NEK3_DICDI (Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum OX=44689 GN=nek3 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.569e-60
Identity = 120/267 (44.94%), Postives = 163/267 (61.05%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS----VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHD-GYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFI 918
            ++Y  +  IGKGSFG    VK  R  +G   + VLKE+NV  M   +  +   E  LLS L+H NI+ ++DSF L     II EY   GD+   I+K         E  I+ WF Q+ + L YI  R ILHRDLK  NIFL   +    +K+GDFGI++ILN    LAST LGTPYY+SPE+++++ GY+  SDIWS G +LYE+  LKHAF   NL  +++ IL+   P IPS+YS +L+ ++  +L  DP NRP   +IL+LPFI
Sbjct:    2 DKYEEIKTIGKGSFGRAILVK--RKSDGL--LLVLKEINVMEMQPKERSDAMNEVNLLSMLDHENIIGYYDSFILNGCLYIIMEYANAGDINLEIKKRTLQNKTFSEFEILSWFSQICKALQYISSRNILHRDLKTQNIFLSIVNGDYFIKLGDFGIAKILNSETSLASTVLGTPYYLSPELIQNEKGYDHKSDIWSLGCVLYELTTLKHAFNAANLPALVLKILKGTYPPIPSHYSNDLRNLISSMLQIDPKNRPSVNDILELPFI 264          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P51954|NEK1_MOUSE (Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2)

HSP 1 Score: 218.779 bits (556), Expect = 5.114e-59
Identity = 109/266 (40.98%), Postives = 168/266 (63.16%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            +Y+ L  IG+GSFG    VK     +G+    V+KE+N+  M   + +E  RE  +L+ + H NIV++ +SF    +  I+ +YCEGGDL + I   K  G+  +E +I+ WF+Q+   L ++H RKILHRD+K  NIFL  D +V++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYE+C LKHAF   N+  +++ I+    P +  +YS +L+ +L  +  ++P +RP    IL+  FI  +I
Sbjct:    3 KYVRLQKIGEGSFGKAVLVKSTE--DGRHY--VIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQK--GALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRI 262          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8G9L5 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 2.149e-101
Identity = 184/428 (42.99%), Postives = 243/428 (56.78%), Query Frame = 1
Query:  121 RHWGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDD---------MSETLVNNESKDISNFLSKSTGLNIITAASV------------------------------------ELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQSS--------------LPFTNQR 1227
            R   NRY  +  IGKG+FGTV+ V+D R  E  E  KVLKEV +  +D D+  E   E KLL KL+HS I+KF++ F    ++CI+TEYC+ GDL Q I + K++G +L     IRWFIQ++ G+DY+H R+ILHRDLK  NIFLK  +VKIGDFGISR+L   +D+ASTFLGTPY+MSPE+LKH+GYN  SDIWS G ILYEMCAL+HAF G  LM ++ +I  +PCP IP  Y   LQ VLE +L KDP +R  A E+L  PFI+ +++    + VE+           M ET+   ESK++ + L +   LN +   S                                      L+P QK+LL+K  EAD +A E      +T + N E  +K     F+ S              LP  NQR
Sbjct:   15 RVLSNRYRVVRQIGKGAFGTVHLVEDLRSSE--EKFKVLKEVQIGEVDPDETLEVVHEAKLLGKLDHSAILKFYNCFMEPPSFCIVTEYCDEGDLDQCISRLKQAGHNLPVQTTIRWFIQILLGVDYLHGRRILHRDLKTKNIFLKSGTVKIGDFGISRVLMSNSDMASTFLGTPYFMSPELLKHEGYNAKSDIWSVGCILYEMCALEHAFKGAGLMGILFSICGNPCPVIPDRYPPELQAVLEKMLAKDPQDRLSAREVLKEPFIREQMQS-LREAVESQSGGNRQQQLLMEETINEAESKNLLSVLQEKPTLNSLEFESRAMAAAAAAAAEVTLKPNSDTVRQKVKGPGQAGGDFNALSPHQKMLLRKQREADDRARELATQAAETSRRNAELAKKFGNRTFRPSGSEGRTAFPQPQDDLPVRNQR 439          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267F3B3 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005885g2 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 4.519e-101
Identity = 184/428 (42.99%), Postives = 243/428 (56.78%), Query Frame = 1
Query:  121 RHWGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDD---------MSETLVNNESKDISNFLSKSTGLNIITAASV------------------------------------ELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQSS--------------LPFTNQR 1227
            R   NRY  +  IGKG+FGTV+ V+D R  E  E  KVLKEV +  +D D+  E   E KLL KL+HS I+KF++ F    ++CI+TEYC+ GDL Q I + K++G +L     IRWFIQ++ G+DY+H R+ILHRDLK  NIFLK  +VKIGDFGISR+L   +D+ASTFLGTPY+MSPE+LKH+GYN  SDIWS G ILYEMCAL+HAF G  LM ++ +I  +PCP IP  Y   LQ VLE +L KDP +R  A E+L  PFI+ +++    + VE+           M ET+   ESK++ + L +   LN +   S                                      L+P QK+LL+K  EAD +A E      +T + N E  +K     F+ S              LP  NQR
Sbjct:   20 RVLSNRYRVVRQIGKGAFGTVHLVEDLRSSE--EKFKVLKEVQIGEVDPDETLEVVHEAKLLGKLDHSAILKFYNCFMEPPSFCIVTEYCDEGDLDQCISRLKQAGHNLPVQTTIRWFIQILLGVDYLHGRRILHRDLKTKNIFLKSGTVKIGDFGISRVLMSNSDMASTFLGTPYFMSPELLKHEGYNAKSDIWSVGCILYEMCALEHAFKGAGLMGILFSICGNPCPVIPDRYPPELQAVLEKMLAKDPQDRLSAREVLKEPFIREQMQS-LREAVESQSGGNRQQQLLMEETINEAESKNLLSVLQEKPTLNSLEFESRAMAAAAAAAAEVTLKPNSDTVRQKVKGPGQAGGDFNALSPHQKMLLRKQREADDRARELATQAAETSRRNAELAKKFGNRTFRPSGSEGRTAFPQPQDDLPVRNQR 444          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267F7N0 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005885g1 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 5.043e-101
Identity = 184/428 (42.99%), Postives = 243/428 (56.78%), Query Frame = 1
Query:  121 RHWGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDD---------MSETLVNNESKDISNFLSKSTGLNIITAASV------------------------------------ELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQSS--------------LPFTNQR 1227
            R   NRY  +  IGKG+FGTV+ V+D R  E  E  KVLKEV +  +D D+  E   E KLL KL+HS I+KF++ F    ++CI+TEYC+ GDL Q I + K++G +L     IRWFIQ++ G+DY+H R+ILHRDLK  NIFLK  +VKIGDFGISR+L   +D+ASTFLGTPY+MSPE+LKH+GYN  SDIWS G ILYEMCAL+HAF G  LM ++ +I  +PCP IP  Y   LQ VLE +L KDP +R  A E+L  PFI+ +++    + VE+           M ET+   ESK++ + L +   LN +   S                                      L+P QK+LL+K  EAD +A E      +T + N E  +K     F+ S              LP  NQR
Sbjct:   21 RVLSNRYRVVRQIGKGAFGTVHLVEDLRSSE--EKFKVLKEVQIGEVDPDETLEVVHEAKLLGKLDHSAILKFYNCFMEPPSFCIVTEYCDEGDLDQCISRLKQAGHNLPVQTTIRWFIQILLGVDYLHGRRILHRDLKTKNIFLKSGTVKIGDFGISRVLMSNSDMASTFLGTPYFMSPELLKHEGYNAKSDIWSVGCILYEMCALEHAFKGAGLMGILFSICGNPCPVIPDRYPPELQAVLEKMLAKDPQDRLSAREVLKEPFIREQMQS-LREAVESQSGGNRQQQLLMEETINEAESKNLLSVLQEKPTLNSLEFESRAMAAAAAAAAEVTLKPNSDTVRQKVKGPGQAGGDFNALSPHQKMLLRKQREADDRARELATQAAETSRRNAELAKKFGNRTFRPSGSEGRTAFPQPQDDLPVRNQR 445          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267G446 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018929g1 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 7.977e-100
Identity = 182/428 (42.52%), Postives = 242/428 (56.54%), Query Frame = 1
Query:  121 RHWGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDD---------MSETLVNNESKDISNFLSKSTGLNIITAASV------------------------------------ELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQSS--------------LPFTNQR 1227
            R   NRY  +  IGKG+FGTV+ V+D R  E  E  KVLKEV +  +D D+  E   E KLL KL+HS I+KF++ F    ++CI+TEYC+ GDL Q I + K++G +L     IRWFIQ++ G+DY+H R+ILHRDLK  NIFLK  +VKIGDFGISR+L   +D+ASTFLGTPY+MSPE+LKH+GYN  SDIWS G ILYEMCAL+HAF G  LM ++ +I  +PCP IP  Y   LQ VLE +L KDP +R  A E+L  PF++ +++    + VE+           M ET+    SK++ + L +   LN +   S                                      L+P QK+LL+K  EAD +A E      +T + N E  +K     F+ S              LP  NQR
Sbjct:   21 RVLSNRYRVVRQIGKGAFGTVHLVEDLRSSE--EKFKVLKEVQIGEVDPDETLEVVHEAKLLGKLDHSAILKFYNCFMEPPSFCIVTEYCDEGDLDQCISRLKQAGHNLPVQTTIRWFIQILLGVDYLHGRRILHRDLKTKNIFLKSGTVKIGDFGISRVLMSNSDMASTFLGTPYFMSPELLKHEGYNAKSDIWSVGCILYEMCALEHAFKGAGLMGILFSICGNPCPVIPDRYPPELQAVLEKMLAKDPQDRLSAREVLKEPFVREQMQS-LREAVESQSGGNRQQQLLMEETINEAASKNLLSVLQEKPTLNSLEFESRAMAAAAAAAAEVTLKPNSDTVRQKVKGPGQAGGDFNALSPHQKMLLRKQREADDRARELATQAAETSRRNAELAKKFGNRTFRPSGSEGRTAFPQPQDDLPVRNQR 445          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3JN97 (serine/threonine-protein kinase Nek11 OS=Lingula unguis OX=7574 GN=LOC106174714 PE=4 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 3.898e-96
Identity = 162/374 (43.32%), Postives = 242/374 (64.71%), Query Frame = 1
Query:  130 GNRYIFLSGIGKGSFGTVYKVKDFR--GPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDP--WIDIVENDDMSETLVNN-ESKDISNFLSKSTGLNIITAASVE-----LTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQSSLPFTN 1221
             NRY     +G G+FGT + VKD +   P+  E  KV+KE+ V  +  D+  +   E  LLSKL+H +IVKF+DSF     +CI+TEYC+GGDL+  I K ++ G  L+E+ ++ WF+Q++  + Y+H R++LHRDLK  NIFL+ + VKIGDFGISRIL  T+D+ASTF GTPYYMSPEVLKH+GYN+ SD+WS G ILYE+CAL+HAF G +LM VM  I+E   P++P  Y + LQ VL+ +LVK+P+ RP A E+  +PF+   I      I +    DM E   +  E+++I N L K T L  +  +  +     L+P++++ ++K  +AD++ ++  E + ++++       +LK+DQ +SS   +N
Sbjct:   25 ANRYQVERKLGSGNFGTAFLVKDLKCKDPKDPEQWKVMKEIPVGDLQPDETVDAMHEANLLSKLDHPSIVKFYDSFLDGEFFCIVTEYCDGGDLEDQIIKYRKEGKALDEILVMDWFVQLLLAVQYMHSRRVLHRDLKTRNIFLRNNMVKIGDFGISRILMGTSDMASTFTGTPYYMSPEVLKHEGYNSKSDVWSIGCILYELCALQHAFEGQSLMGVMYKIVEGTSPQLPDKYCKELQGVLKLMLVKEPEKRPSATELTKVPFVHRHIEKLKNTIQVKHKKDMQEKEGHRKEAEEIDNLLRKKTHLQTLRDSEEDVKWKNLSPRERMRIRKQQKADEEKKKLEEAVRQSYEET-----QLKKDQIKSSFLTSN 393          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek1 (NIMA related kinase 1 [Source:NCBI gene;Acc:103028272])

HSP 1 Score: 224.557 bits (571), Expect = 7.684e-62
Identity = 128/375 (34.13%), Postives = 206/375 (54.93%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLSK--STGLNIITAASVELTPKQK----ILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQSSLPFTNQRNAS 1236
            ++Y  +  IG+GSFG    V+     +G +   V+KE+ +  M   + +E  +E  +L+ ++H NIV++ +SF       I+ +YCEGGDL + I   K  G    E +I+ WF+Q+   L ++H RKILHRD+K  NIFL  D ++++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYEMC LKHAF   N+  +++ I+    P +  +YS++L+ +L  +  ++P  RP  C ILD PF+  +I       +   + S++L+           +K  + G + IT A     P  K    + +K+  +A +K       +  + K  VE +  +K    Q+  P   QR  S
Sbjct:    2 DKYEKVKKIGEGSFGKAILVRSKE--DGHQY--VIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEEGGCLYIVMDYCEGGDLFKKINNQK--GVLFTEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSMHYSQDLRSLLGLLFKRNPRERPSVCTILDKPFLAHRIHRFLSPQLIAQEFSQSLLRQPKTPAQGLPAKRPAPGPSPITPAQKITKPAAKYGVPLTVKRPADAGRK-------VADSAKKQVERKPGIKLK--QAPPPAAGQRRVS 361          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek1 (NIMA related kinase 1 [Source:NCBI gene;Acc:103028272])

HSP 1 Score: 221.476 bits (563), Expect = 6.742e-61
Identity = 121/346 (34.97%), Postives = 199/346 (57.51%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLSK--STGLNIITAASVELTPKQK----ILLKKSMEADKK-AEEQREYIEK 1146
            ++Y  +  IG+GSFG    V+     +G +   V+KE+ +  M   + +E  +E  +L+ ++H NIV++ +SF       I+ +YCEGGDL + I   K  G    E +I+ WF+Q+   L ++H RKILHRD+K  NIFL  D ++++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SDIW+ G +LYEMC LKHAF   N+  +++ I+    P +  +YS++L+ +L  +  ++P  RP  C ILD PF+  +I       +   + S++L+           +K  + G + IT A     P  K    + +K+  +A +K A+  ++ +E+
Sbjct:    2 DKYEKVKKIGEGSFGKAILVRSKE--DGHQY--VIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEEGGCLYIVMDYCEGGDLFKKINNQK--GVLFTEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSMHYSQDLRSLLGLLFKRNPRERPSVCTILDKPFLAHRIHRFLSPQLIAQEFSQSLLRQPKTPAQGLPAKRPAPGPSPITPAQKITKPAAKYGVPLTVKRPADAGRKVADSAKKQVER 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:103043005])

HSP 1 Score: 215.698 bits (548), Expect = 7.509e-60
Identity = 109/268 (40.67%), Postives = 165/268 (61.57%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYC---IITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            Y F+  +GKGS+G V  V+     +      V+K++N+ T  + +     +E +LLS+L H NIV + +S+  E + C   I+  +CEGGDL   +++ K  G  L E +++ WF+Q+   L Y+H++ ILHRDLK  NIFL K + +K+GD GI+R+L   ND+AST +GTPYYMSPE+  +  YN  SD+W+ G  +YEM  LKHAF   ++  +   I+E   P++PS Y   L E+++ +L K P++RP    IL  PFIK +I
Sbjct:    4 YGFIRVVGKGSYGEVNLVQH----KSDRKQYVIKKLNLRTSSKRERRAAEQEAQLLSQLKHPNIVTYRESW--EGDDCQLYIVMGFCEGGDLYHRLKQQK--GELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMSTLKHAFNAKDMNSLAFRIIEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPFIKQQI 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:103043005])

HSP 1 Score: 215.698 bits (548), Expect = 1.115e-59
Identity = 109/268 (40.67%), Postives = 165/268 (61.57%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYC---IITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            Y F+  +GKGS+G V  V+     +      V+K++N+ T  + +     +E +LLS+L H NIV + +S+  E + C   I+  +CEGGDL   +++ K  G  L E +++ WF+Q+   L Y+H++ ILHRDLK  NIFL K + +K+GD GI+R+L   ND+AST +GTPYYMSPE+  +  YN  SD+W+ G  +YEM  LKHAF   ++  +   I+E   P++PS Y   L E+++ +L K P++RP    IL  PFIK +I
Sbjct:    4 YGFIRVVGKGSYGEVNLVQH----KSDRKQYVIKKLNLRTSSKRERRAAEQEAQLLSQLKHPNIVTYRESW--EGDDCQLYIVMGFCEGGDLYHRLKQQK--GELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMSTLKHAFNAKDMNSLAFRIIEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPFIKQQI 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000049860.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000129.1:61559:73217:-1 gene:ENSAMXG00000043136.1 transcript:ENSAMXT00000049860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.068 bits (523), Expect = 1.134e-56
Identity = 109/310 (35.16%), Postives = 178/310 (57.42%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKY--DSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLSKSTGLNIITAAS 1056
            N Y  +  IG G++G    V++     G     V+K+++   M   + E+  +E  LLSK+ H NIV FF SF   N+  I+ EYC+GGDL + I  + + G   +E +I+ WF+Q+  GL +IH RK+LHRD+K  NIFL      VK+GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  +D+WS G +LYE+C L+H F G +L +++V I +     +   YS +L+ ++  +    P +RP    +L  P + + I       +  ++ S T+++   K ++    K + ++ ++  S
Sbjct:    2 NEYELVRQIGHGAYGKALLVRER---SGNARHCVIKQISWSRMSPREREDSKKEVTLLSKMKHPNIVAFFRSFNERNSLYIVMEYCDGGDLMKKI--SMQRGQPFKEQQIMDWFVQICLGLKHIHDRKVLHRDIKAQNIFLTQGGSKVKLGDFGIARLLNNTVELARTCVGTPYYLSPEICENRPYNNKTDMWSLGCVLYELCTLRHPFEGSSLRQLIVRICKGYYTPVSQRYSSDLRTLVSQLFKISPRDRPSVNSLLKRPLLHTLISKHLHPQLMEEEFSHTVLHR-VKPVAQPGPKHSAVSKVSPRS 305          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 3.887e-64
Identity = 106/265 (40.00%), Postives = 160/265 (60.38%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSK 927
            RY  +S IG+GSFG    VK     +    + V+KE+N+  M   + +E  +E  +L+ + H NIV + +SF    N  I+ +YCEGGDL + I   K  G    E +I+ W +Q+   L ++H RKILHRD+K  NIFL K   V++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN  SD+W+ G +LYEMC L+HAF   N+  +++ I+    P + ++YS  L+  L  +L +DP  RP    +L  P + ++
Sbjct:    3 RYTMVSQIGEGSFGKAMLVKS----KADGHLYVIKEINISRMSPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINAQK--GVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMKNLVLKIIRGSFPPVSAHYSSELRSTLSGLLRRDPRARPPVAVLLSRPLLMAR 261          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 174.096 bits (440), Expect = 3.384e-46
Identity = 100/268 (37.31%), Postives = 161/268 (60.07%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCP-RIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRD 936
            YI +  +G+G+FG   +   +R  E   S+ V KE+++  +   +  +   E  +LS L H+NI+ +++ F   N   I  EYC GG L + I   K+ G+   E  I+ +F Q++  ++ IH  KILHRD+K  NIFL K D +K+GDFGIS+IL+  + +A +++GTPYYMSPE+++ D YNT SDIW+ G +LYE+  L   F   N +++   I+       I   YS+ ++EV++  L +D + RP A ++L+L  IK++ R+
Sbjct:   36 YIPVRVLGRGAFG---EAALYRRNE-DNSLVVWKEIDLTRLSDKERRDSQNEIDILSLLEHANIISYYNHFLDGNVLLIELEYCNGGTLYEKI--IKQHGAFFPEKDIVWYFYQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKILDSRSQMAESYVGTPYYMSPELIRGDKYNTKSDIWAMGCVLYELLTLTRTFDATNPLKLCYEIIHGKKQVEIDDQYSKEIKEVVQKCLQQDAEQRPTAEDLLELSPIKTRRRE 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 165.622 bits (418), Expect = 3.376e-45
Identity = 90/220 (40.91%), Postives = 123/220 (55.91%), Query Frame = 1
Query:  226 IKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSF--RLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRK-----ILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECIL 861
            + V K ++  TM + + +    E  LL +L H NIV++FD    R      I+ EYCE GDL  +I + +R    LEE  ++R   Q++  L   H+R      +LHRDLKP N+FL    +VK+GDFG++RIL      A TF+GTPYYMSPE      YN  SDIWS G +LYE+CAL   F   N  ++   I E    RIP  YS+ L E++  +L
Sbjct:    2 VLVWKVLDYGTMSEPEKQMLVSEVNLLRELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLARILQHDTSFAKTFVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPFTAMNQKQLAEKIKEGKFRRIPYRYSDELNEIISKML 221          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000555.1 (pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 gene:ENSPMAG00000000500.1 transcript:ENSPMAT00000000555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.829e-39
Identity = 69/182 (37.91%), Postives = 113/182 (62.09%), Query Frame = 1
Query:  406 KQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMR-----VMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIR 933
            KQ+I KT           +++WF+QV   + YIH  KILHRD+K +N+FL K  +VK+GDFGIS+ +  T D+A T +GTPYY+SPE+ +   Y++ SD+W+ G +LYE+CAL+ AF   N++R     +   I+      +  +YS +++ ++  +L + P++RP A  +L  P+ +  +R
Sbjct:    2 KQIITKTN----------VMQWFVQVCMAVQYIHSVKILHRDIKTSNVFLTKAGTVKVGDFGISKAMEGTLDMAVTCVGTPYYLSPEMCQDLPYSSKSDVWALGCLLYELCALRPAFEASNIIRLTRRSLFYKIMRGEPDPLDESYSRDVRALVALLLSRSPEDRPSASAVLASPYAQRHLR 173          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 146.362 bits (368), Expect = 1.115e-36
Identity = 110/381 (28.87%), Postives = 187/381 (49.08%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKV-KDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLSKSTGLNIITAASVELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENR-RKLKQDQFQSSLPFTNQRNASTRSSISEYDEL 1269
            +Y  L  IG+GSFG VYK  K + G      +  LK +        ++    RE  ++  L H NIV+  DSF  +    ++T+Y EG +L Q++E       +L E ++     Q++  L Y+H  +ILHRD+KP NI L K   VK+ DFG +R ++    + ++  GTP YMSPE+++   Y+  +D+WS G ILYE+      F  +++ +++  I++ P  + P N S   +  L+ +L K+P  R     +L  PF+  K        +  DD+S    N  ++D+S  L          AA +  T  Q  +L+K+ +  K AE  +   +     N   R R + +++  S    +++  +  + ++S  D L
Sbjct:    3 KYHVLEMIGEGSFGKVYKGRKRYTG-----QVVALKFIPKVGRSDKELRNLRREIDIMRGLQHPNIVQMLDSFETDKEVVVVTDYAEG-ELFQILED----DGNLPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVGTPPFYTNSIFQLVSLIIKDPV-KWPKNMSSEFRNFLQGLLTKEPKLRLSWPALLHHPFVAGK------SSIVLDDISAEETNPLTEDLSPELQAQKEKQ---AAELAPTSGQSKILRKARQ--KMAEVAKNKEKDNQCGNAPQRQRGVLEEKASSHSALSSKHKSMAKQAVSSADTL 361          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIN3 (Nonessential serine/threonine protein kinase; possible role in DNA damage response; influences tolerance to high levels of ethanol [Source:SGD;Acc:S000000071])

HSP 1 Score: 141.739 bits (356), Expect = 4.883e-37
Identity = 93/318 (29.25%), Postives = 141/318 (44.34%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFF--DSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIH---------------------KRKILHRDLKPNNIFLKYDS----------------------------------------VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEIL 903
            Y  L  IG+GSFG+V KV         + + V K++    M+  + ++   E  +LS+L H NIV+F+  D    +    +  EYC  GDL Q+I+  K+   ++ E  +     Q++  L   H                     K  ++HRDLKP NIFL YD                                         VK+GDFG+++ L  +   A+T++GTPYYMSPEVL    Y+  SDIWS G +++EMC+L   F   N + +   I    C  +P  YS  L  ++  ++  +   RP   E+L
Sbjct:   25 YQVLEEIGRGSFGSVRKVIHI----PTKKLLVRKDIKYGHMNSKERQQLIAECSILSQLKHENIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIFEMCSLHPPFQAKNYLELQTKIKNGKCDTVPEYYSRGLNAIIHSMIDVNLRTRPSTFELL 338          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 139.813 bits (351), Expect = 6.586e-36
Identity = 88/264 (33.33%), Postives = 144/264 (54.55%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS-VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVL--KHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIK 921
            Y   S IG+G+FG VYK  D       + I  +K VN++  D+D IE   +E   L++L    I  +  +   + +  I+ EYC GG    +++++  +G  L E ++     +V  GL Y+H+++ +HRD+K  NI L  +  VK+GDFG+S  +  T     TF+GTPY+M+PEV+  + DGYN  +DIWS G+  YE+          + M+VM  + +   P++   +S+  ++ +   LVK P +RP A  +L   F+K
Sbjct:   18 YSIQSCIGRGNFGDVYKAVD----RVTQEIVAIKVVNLEHSDED-IELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNG--LPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLK-RDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVK 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 140.198 bits (352), Expect = 5.281e-35
Identity = 82/261 (31.42%), Postives = 139/261 (53.26%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSH--LEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS-VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRI--PSNYSENLQEVLECILVKDPDNRPKACEIL 903
            +Y  L  IG+G+ G VY   +     G      +K++N++   Q + E    E  ++    H NIV F DS+ L+ +  +I EY EGG L  V+       +H  L E +I     + + GL+++H + +LHRD+K +NI L  +  +K+ DFG    +N  N   +T +GTPY+M+PEV+    Y    DIWS G+++ EM   +  ++ +  +R +  I  +  P++  P N S +L++ L+  L  +P++R  A E+L
Sbjct:  619 KYANLVKIGQGASGGVYTAYEI----GTNVSVAIKQMNLE--KQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVV-------THCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELL 866          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 138.658 bits (348), Expect = 1.589e-34
Identity = 88/268 (32.84%), Postives = 145/268 (54.10%), Query Frame = 1
Query:  157 IGKGSFGTVYK---VKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNH-SNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS-VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDG-YNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPS-NYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDP 939
            IG+G FG VYK   VK  R       +  +K +N+D+ D D++E+  RE + L+ L   SNI +++ S+  + +  II E+C GG L+ ++   K     ++E  I     +++  L  IHK  ++HRD+K  N+ +  +  VK+ DFG++  +N T+    T  GTPY+M+PEV+     Y+T  DIWS G+  YE+      +     +R M  I++S  PR+   +YS +L+E +   L +DP  R  A ++L   FI++    P
Sbjct:   29 IGRGKFGVVYKGYNVKTGR-------VYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGK-----IDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATP 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 132.109 bits (331), Expect = 1.484e-33
Identity = 88/272 (32.35%), Postives = 138/272 (50.74%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS----VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCP---RIP--SNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSK 927
            YIF   +G GSFG V + +     E   +IK+L +  +   +  Q++    E  +L KL+H NIV F D F  ++ + I+T+   GG+L   I     S     E+  +   +Q++  ++Y+H + ++HRDLKP N+     S    + I DFGI++ L    DL     G+  Y++PEVL  DG+    DIWS GVI Y +      FI +++   M     S  P    +P   N S +++  +   L  +P +RP A E+LD P+I SK
Sbjct:   47 YIFGRTLGAGSFGVVRQARKLSTNE-DVAIKILLKKALQG-NNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRI----LSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITSK 312          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGU2])

HSP 1 Score: 284.263 bits (726), Expect = 1.386e-91
Identity = 142/268 (52.99%), Postives = 180/268 (67.16%), Query Frame = 1
Query:  127 WGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            + NRY  +  +G GSFGTV+ V+D +   G+   KVLKE+ V  +  D+  +  RE KLLSKLNH NIVKF DSF     +CI+TEYCEGGDL   I   ++SG   +E  I+ WFIQ++  + ++H+ +ILHRDLK  NIFLK + VK+GDFGISRIL  T+D+A+TF GTPYYMSPEVLKH+GYN  SDIWS GV+LYE+C L+HAF G +LM VM  I+E   P +   YS  LQ     ++ KDP  RP A EIL   FI   I
Sbjct:    2 YANRYRVVRRLGSGSFGTVFLVEDLKA-NGER--KVLKEIYVGELQPDETVDAMREAKLLSKLNHPNIVKFMDSFMDREYFCIVTEYCEGGDLDDKISAWRKSGKKFDESLILAWFIQIVLAVQHMHEMRILHRDLKTRNIFLKNNIVKLGDFGISRILMGTSDMATTFTGTPYYMSPEVLKHEGYNHKSDIWSLGVVLYELCNLQHAFQGQSLMGVMYKIVEGELPALSDKYSSQLQAFYSRLMDKDPKLRPSANEILKHHFIAENI 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 213.001 bits (541), Expect = 4.098e-64
Identity = 109/268 (40.67%), Postives = 165/268 (61.57%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIIT-EYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            +RY     IGKGS+G V+  K     +  +   VLK+V++      + +    E KLLS+L H NIV + +SF+ +  +  I   +CEGGDL   ++  K  G  L+E +I+ WF+Q+   L Y+H++ ILHRDLK  NIFL K   +K+GD GI+R+L  ++D+A+T +GTPYYMSPE+  +  YN  SD+W+ G  LYEMC L+HAF   ++  ++  IL+   P +P  YS +L  +++ +L +DPD RP A  +L  P+IK +I
Sbjct:    4 DRYTIGKCIGKGSYGEVFLSKH----KKDKKQYVLKKVDLQKASVRERKAAELEAKLLSQLRHPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRLKAQK--GIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMSSLVYKILKGKTPPLPKQYSTDLCSIIKSMLDQDPDKRPSASRLLRHPYIKKQI 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 212.231 bits (539), Expect = 5.840e-64
Identity = 110/266 (41.35%), Postives = 170/266 (63.91%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            RY+ +  IG+GSFG    VK  +  +G+    V+KE+N+  M   + EE  +E K+LS+L H NIV + +SF    N  I+ +YC+GGDL + I   +  G    E +++ WF+Q+  GL ++H RKILHRD+K  NIFL ++  +K+GDFGI+R+L+ T +LA T +GTPYY+SPE++++  YN  SDIWS G +LYEM  LKHAF   N+  +++ I+    P IP  YS +++ ++  +L ++P +RP    +L   FI+ +I
Sbjct:    3 RYVRVKKIGEGSFGKALLVK--KRNDGKHY--VIKEINICRMKPREREESRKEVKVLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQR--GIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAFEAGNMKNLVLKIIRGSYPPIPLRYSADIRMLVAQLLKRNPHDRPSVNTVLKKNFIQKRI 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 200.675 bits (509), Expect = 8.134e-60
Identity = 111/273 (40.66%), Postives = 157/273 (57.51%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWID 948
            NRY  +  IGKG+FG+ + V+        + +  LKE+N   M  +       E K+LS L H NIV++ D+F     + I+ EY EGGDL     K K++       RI+ W  Q++  L +IH + ILHRDLK  NIFL K D VKIGDFGI+RIL+ T D A T +GTPYY+SPE+ +   YN  SDIW+ G +LYE+    H F  DNL  ++V IL    P IP  Y   L++++  +L  +P +RP A +++ +P +      P+ID
Sbjct:    2 NRYQKIDIIGKGTFGSAWLVES----RQSKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHT---KIKQAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPYYLSPEICQRQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQLIYVPGLT-----PYID 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO34646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS0])

HSP 1 Score: 180.644 bits (457), Expect = 5.978e-52
Identity = 92/248 (37.10%), Postives = 145/248 (58.47%), Query Frame = 1
Query:  157 IGKGSFGTVYKVKDFRGPEGQESIKVLKEVNV-DTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDS-VKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGD--NLMRVMVTILESPCPRIPS-NYSENLQEVLECILVKDPDNRP 885
            IG+G F  VYK +          I  LK++ + D MD    ++C +E  LL +LNH N++K++ SF   N   I+ E  + GDL ++I+  K+    + E  + ++F+Q+   L+++H R+++HRD+KP N+F+     VK+GD G+ R  +     A + +GTPYYMSPE +K +GYN  SDIWS G +LYEM AL+  F GD  NL  +   I +   P +P+ +YS+ L+ ++   +   PD RP
Sbjct:   27 IGRGQFSVVYKAR----CTANNQIVALKKIQIFDMMDAKARQDCIKEIDLLKQLNHPNVIKYYASFIENNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLTAALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIKENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPAEHYSQQLRHLVSLCINPIPDQRP 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:101169778])

HSP 1 Score: 217.624 bits (553), Expect = 2.452e-60
Identity = 109/268 (40.67%), Postives = 166/268 (61.94%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYC-IITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            N YIF+  +GKGS+G V  VK     +      V+K++N+ T  + +     +E +LLS+L H NIV + +S+  ++    I+  +CEGGDL   +++  R G  L E +++ WF+Q+   L Y+H+R ILHRDLK  NIFL K + +K+GD GI+R+L   ND+AST +GTPYYMSPE+  +  YN  SD+W+ G  +YEM  LKHAF   ++  ++  I+E   P++PS Y   L ++++ +L K P+ RP    IL  P+IK +I
Sbjct:    2 NSYIFIRVVGKGSYGEVNLVKH----KTDRKQYVIKKLNLSTSSKRERRSAEQEAQLLSQLRHPNIVTYRESWEGDDRQLYIVMGFCEGGDLYHRLKQ--RKGELLPERQVVEWFVQIAMALQYLHERNILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMSTLKHAFNAKDMNSLVYRIVEGKLPQMPSRYDPQLGDLIKSMLSKKPEERPDVKLILRQPYIKRQI 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000545.2 (pep primary_assembly:ASM223467v1:4:1040495:1044496:1 gene:ENSORLG00000000439.2 transcript:ENSORLT00000000545.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 1.904e-56
Identity = 105/259 (40.54%), Postives = 159/259 (61.39%), Query Frame = 1
Query:  157 IGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            IG+GSFG    V      +G++   V+KE+ +  M   +  E  +E  +L+ ++H NIV++ +SF     Y I+ +YCEGGDL + I   K  G    E +I+ WF+Q+   L ++H RKILHRD+K  NIFL  D +V++GDFGI+R+LN T +LA T +GTPYY+SPE+ ++  YN   DIW+ G +LYEMC LKHAF   N+  +++ I+    P +  +YS  L+ +L  +  ++P  RP    IL+ PF+  +I
Sbjct:   10 IGEGSFGKAILVNS--KEDGRQY--VIKEIGISGMSTKERRESRKEVSVLANMSHPNIVQYKESFEGGCLY-IVMDYCEGGDLFKKINSQK--GVLFSEDQILDWFVQICLALKHVHGRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLN-TVELARTCIGTPYYLSPEICENKPYNN-KDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSPELRSLLAQLFRRNPRERPSVSSILEKPFLSCRI 259          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034147.1 (serine/threonine-protein kinase Nek5 [Source:NCBI gene;Acc:101162253])

HSP 1 Score: 200.675 bits (509), Expect = 6.070e-55
Identity = 101/268 (37.69%), Postives = 159/268 (59.33%), Query Frame = 1
Query:  133 NRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVK--IGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            N Y  L  IG+G+FG  + V+   G  G ++  V+K++N+  M   + E   +E  LLS++ H NIV F  SF  + +  I+ E+C+GGDL + I   +  G    E  I+  F+Q+  GL +IH +K+LHRD+K  NIFL    +K  +GDFGI+R+LN + DLA T +GTPYY+SPE+ +   YN  +D+WS G +LYE+C L+H F G +L +++  I       +P+ Y+  L+ ++  +   +P +RP    +L  PF++  I
Sbjct:    2 NDYEVLWQIGEGAFGKAFLVRSKTG--GGDTQCVIKQINLQKMSAKERESSRKEVTLLSRMRHPNIVSFISSFLEKGSLFIVMEFCDGGDLLKKINMQR--GVPFREEEILDLFVQICLGLKHIHDKKVLHRDIKCQNIFLTNGGMKAKLGDFGIARMLNNSMDLARTCVGTPYYLSPEICESRPYNNKTDVWSLGCVLYELCTLRHPFEGSSLRQLLGKICRGRYAPVPTRYTHELRLLVNQLFKVNPRDRPSISSVLQRPFLQKHI 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027525.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:101171427])

HSP 1 Score: 190.66 bits (483), Expect = 2.729e-53
Identity = 106/316 (33.54%), Postives = 172/316 (54.43%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILD----LPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLS-KSTGLNIITAASVEL 1065
            +Y  L  +G+GSFG    V+     E      V+KE+ +   ++ ++ +  +E  LLS++ H NIV F ++F + +  CI+ EYC GGDL Q I++ K +    E   I+RWF Q+  G  +IH +++LHRDLK  NIFL  D SVK+GDFG + +LN +   A  ++GTPYY++PE+  +  YN  SD+WS G +LYE+CAL+H F   +   +++ +     P +P +    L  +++ I   +P +RP    IL        ++S +    I+  ++          E + ++ FL  KS     +  A+VEL
Sbjct:    3 KYTQLKVVGEGSFGRAVLVQWISTQEKY----VVKEIQLPK-NESKLRDSRKEAILLSRMKHPNIVAFREAFEMTDLLCIVMEYCSGGDLLQRIQQQKATNFCTEN--ILRWFAQMCAGAQHIHDKRVLHRDLKSKNIFLTGDGSVKLGDFGSACVLNSSKAYAHAYVGTPYYVAPEIWDNKPYNNKSDVWSLGCVLYELCALQHPFQASSWKSLILKVCRGAYPPLPRHLPYELLHLMKQIFKTNPKDRPSVQTILTSHRVSKLLRSHLPSQAIEKAKDGRRPGRWNREEGEKVAQFLGDKSLQRTSVFGAAVEL 311          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045610.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:101171427])

HSP 1 Score: 190.66 bits (483), Expect = 2.729e-53
Identity = 106/316 (33.54%), Postives = 172/316 (54.43%), Query Frame = 1
Query:  136 RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYD-SVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILD----LPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLS-KSTGLNIITAASVEL 1065
            +Y  L  +G+GSFG    V+     E      V+KE+ +   ++ ++ +  +E  LLS++ H NIV F ++F + +  CI+ EYC GGDL Q I++ K +    E   I+RWF Q+  G  +IH +++LHRDLK  NIFL  D SVK+GDFG + +LN +   A  ++GTPYY++PE+  +  YN  SD+WS G +LYE+CAL+H F   +   +++ +     P +P +    L  +++ I   +P +RP    IL        ++S +    I+  ++          E + ++ FL  KS     +  A+VEL
Sbjct:    3 KYTQLKVVGEGSFGRAVLVQWISTQEKY----VVKEIQLPK-NESKLRDSRKEAILLSRMKHPNIVAFREAFEMTDLLCIVMEYCSGGDLLQRIQQQKATNFCTEN--ILRWFAQMCAGAQHIHDKRVLHRDLKSKNIFLTGDGSVKLGDFGSACVLNSSKAYAHAYVGTPYYVAPEIWDNKPYNNKSDVWSLGCVLYELCALQHPFQASSWKSLILKVCRGAYPPLPRHLPYELLHLMKQIFKTNPKDRPSVQTILTSHRVSKLLRSHLPSQAIEKAKDGRRPGRWNREEGEKVAQFLGDKSLQRTSVFGAAVEL 311          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000057044.1 (SMESG000057044.1)

HSP 1 Score: 1236.09 bits (3197), Expect = 0.000e+0
Identity = 600/605 (99.17%), Postives = 601/605 (99.34%), Query Frame = 1
Query:   97 MSILQESTRHWGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLSKSTGLNIITAASVELTPKQKILLKKSMEADKKAEEQREYIEKTHKSNVENRRKLKQDQFQSSLPFTNQRNASTRSSISEYDELNSSRNSGFNTFAGINKVEKENYNRLSKTEIIGKHFKLTPIEAFKNNDEEDDIYSRKTNFNQNGLFNTQYRNLKYDDSSNYNVAPYNPVNDPDNQDILFEYAPDFETDSDSSSNSVREKNGEDEIQMDLNFEAFQDNPETDPYGKNTKQKKINAMKKKCLEKVDEKTLEKAIRYMKENWRKKDYIIRLLKICKSDDVAMTVDQLFFLMLPINEIY 1911
            MSILQESTRHWGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLSKSTGLNIITAASVELTPKQKILLKKSMEADKKA+EQREYIEKTHKSNVENRRKLKQDQFQSSLPFTNQRNASTRSSISEYDELN SRNSGFNTFAGINKVEKENYNRLSKTEIIGKHFKLTPIEAFKNNDEEDDIYSRKTNFNQNGLFNTQY NLKYDDSSNYNVAPYNPVNDPDNQD  FEYAPDFETDSDSSSNSVREKNGEDEIQMDLNFEAFQDNPETDPYGKNTKQKKINAMKKKCLEKVDEKTLEKAIRYMKENWRKKDYIIRLLKICKSDDVAMTVDQLFFLMLPINEIY
Sbjct:    1 MSILQESTRHWGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNESKDISNFLSKSTGLNIITAASVELTPKQKILLKKSMEADKKAKEQREYIEKTHKSNVENRRKLKQDQFQSSLPFTNQRNASTRSSISEYDELNCSRNSGFNTFAGINKVEKENYNRLSKTEIIGKHFKLTPIEAFKNNDEEDDIYSRKTNFNQNGLFNTQYTNLKYDDSSNYNVAPYNPVNDPDNQDTFFEYAPDFETDSDSSSNSVREKNGEDEIQMDLNFEAFQDNPETDPYGKNTKQKKINAMKKKCLEKVDEKTLEKAIRYMKENWRKKDYIIRLLKICKSDDVAMTVDQLFFLMLPINEIY 605          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000005635.1 (SMESG000005635.1)

HSP 1 Score: 204.142 bits (518), Expect = 5.056e-57
Identity = 111/264 (42.05%), Postives = 151/264 (57.20%), Query Frame = 1
Query:  139 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            Y F+  IG+GS+G V+ VK     +      VLK+++       ++E    E +LL  L H NIV++ DSF   N+  I   +CE GDL   +++  R GS L E +II W IQ+   L YIH+R ILHRDLK  NIFL    +KIGD GI++ L    D+A T +GTPYYMSPE+ +   YN  SDIWS G + YEM  LKHAF   N   +   IL    P +PS Y++ L  +++ +L K P+ RP   +IL   FI+  I
Sbjct:    8 YSFIKKIGQGSYGEVWLVKH---KDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKE--RKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHI 266          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 196.823 bits (499), Expect = 7.083e-53
Identity = 108/264 (40.91%), Postives = 164/264 (62.12%), Query Frame = 1
Query:  148 LSGIGKGSFGTVYKVKDFRGPEGQESIK--VLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            L+ IG+G+FG  + V      E +   K  VLKE+ +  M + +  E  +E  LLSK+NH NIV +++SF     + I+ EYCEGGDL + I+   ++G   +E +++ +FIQ+   L +IH ++ILHRD+KP NIFL K +SVK+GDFGI++ ++ T  L  T +GTP+Y SPE+ +   YN  SDIWS G ILYE+C+L +AF G ++  + + I +     +PS +S  L+ +++ +  + PD RP    IL  PFI  KI
Sbjct:   10 LNKIGQGAFGIAWLV------ESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKI 265          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 196.823 bits (499), Expect = 7.408e-53
Identity = 108/264 (40.91%), Postives = 164/264 (62.12%), Query Frame = 1
Query:  148 LSGIGKGSFGTVYKVKDFRGPEGQESIK--VLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            L+ IG+G+FG  + V      E +   K  VLKE+ +  M + +  E  +E  LLSK+NH NIV +++SF     + I+ EYCEGGDL + I+   ++G   +E +++ +FIQ+   L +IH ++ILHRD+KP NIFL K +SVK+GDFGI++ ++ T  L  T +GTP+Y SPE+ +   YN  SDIWS G ILYE+C+L +AF G ++  + + I +     +PS +S  L+ +++ +  + PD RP    IL  PFI  KI
Sbjct:   10 LNKIGQGAFGIAWLV------ESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKI 265          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 196.823 bits (499), Expect = 7.606e-53
Identity = 108/264 (40.91%), Postives = 164/264 (62.12%), Query Frame = 1
Query:  148 LSGIGKGSFGTVYKVKDFRGPEGQESIK--VLKEVNVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKI 930
            L+ IG+G+FG  + V      E +   K  VLKE+ +  M + +  E  +E  LLSK+NH NIV +++SF     + I+ EYCEGGDL + I+   ++G   +E +++ +FIQ+   L +IH ++ILHRD+KP NIFL K +SVK+GDFGI++ ++ T  L  T +GTP+Y SPE+ +   YN  SDIWS G ILYE+C+L +AF G ++  + + I +     +PS +S  L+ +++ +  + PD RP    IL  PFI  KI
Sbjct:   10 LNKIGQGAFGIAWLV------ESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKI 265          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK111.174e-9742.50NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGN... [more]
NEK111.174e-9742.50NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGN... [more]
NEK112.845e-9742.50NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGN... [more]
NEK116.311e-9642.50NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGN... [more]
NEK111.039e-9542.50NIMA related kinase 11 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-33.845e-4935.36Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-33.845e-4935.36Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-14.346e-4939.62NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-15.599e-4939.62NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-22.747e-4132.57Serine/threonine-protein kinase nekl-2 [Source:Un... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek22.881e-4935.96gene:FBgn0029970 transcript:FBtr0071142[more]
niki9.338e-4438.80gene:FBgn0045980 transcript:FBtr0084737[more]
GckIII6.890e-4133.83gene:FBgn0266465 transcript:FBtr0083399[more]
Slik1.772e-3530.83gene:FBgn0035001 transcript:FBtr0290019[more]
Slik1.916e-3530.83gene:FBgn0035001 transcript:FBtr0100470[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek119.042e-8541.71NIMA-related kinase 11 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
nek11.079e-6340.82NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek43.113e-6040.23NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek43.146e-6040.23NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek122.315e-5536.84NIMA-related kinase 12 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sult1c15.557e-9543.21sulfotransferase family, cytosolic, 1C, member 1 [... [more]
ENSXETT00000013864.11.454e-8539.90serine/threonine-protein kinase Nek11-like [Source... [more]
sez6l22.000e-6038.06seizure related 6 homolog like 2 [Source:Xenbase;A... [more]
nek11.429e-5941.57NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
nek11.485e-5941.57NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek118.487e-8941.67NIMA (never in mitosis gene a)-related expressed k... [more]
Nek116.123e-8840.22NIMA (never in mitosis gene a)-related expressed k... [more]
Nek17.149e-6040.98NIMA (never in mitosis gene a)-related expressed k... [more]
Nek17.311e-6040.98NIMA (never in mitosis gene a)-related expressed k... [more]
Nek17.755e-6040.98NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NG66|NEK11_HUMAN4.990e-9542.50Serine/threonine-protein kinase Nek11 OS=Homo sapi... [more]
sp|Q8WNU8|NEK11_MACFA2.373e-9342.22Serine/threonine-protein kinase Nek11 OS=Macaca fa... [more]
sp|Q8C0Q4|NEK11_MOUSE4.283e-8740.22Serine/threonine-protein kinase Nek11 OS=Mus muscu... [more]
sp|Q86I06|NEK3_DICDI1.569e-6044.94Probable serine/threonine-protein kinase nek3 OS=D... [more]
sp|P51954|NEK1_MOUSE5.114e-5940.98Serine/threonine-protein kinase Nek1 OS=Mus muscul... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G9L52.149e-10142.99Protein kinase domain-containing protein OS=Macros... [more]
A0A267F3B34.519e-10142.99Protein kinase domain-containing protein (Fragment... [more]
A0A267F7N05.043e-10142.99Protein kinase domain-containing protein (Fragment... [more]
A0A267G4467.977e-10042.52Protein kinase domain-containing protein (Fragment... [more]
A0A1S3JN973.898e-9643.32serine/threonine-protein kinase Nek11 OS=Lingula u... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek17.684e-6234.13NIMA related kinase 1 [Source:NCBI gene;Acc:103028... [more]
nek16.742e-6134.97NIMA related kinase 1 [Source:NCBI gene;Acc:103028... [more]
nek47.509e-6040.67NIMA related kinase 4 [Source:NCBI gene;Acc:103043... [more]
nek41.115e-5940.67NIMA related kinase 4 [Source:NCBI gene;Acc:103043... [more]
ENSAMXT00000049860.11.134e-5635.16pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007414.13.887e-6440.00pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
NEK93.384e-4637.31NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
nek23.376e-4540.91NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
ENSPMAT00000000555.11.829e-3937.91pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 g... [more]
STK361.115e-3628.87serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN34.883e-3729.25Nonessential serine/threonine protein kinase; poss... [more]
SPS16.586e-3633.33Putative protein serine/threonine kinase; localize... [more]
STE205.281e-3531.42Cdc42p-activated signal transducing kinase; involv... [more]
KIC11.589e-3432.84Protein kinase of the PAK/Ste20 family, required f... [more]
CMK21.484e-3332.35Calmodulin-dependent protein kinase; may play a ro... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO370691.386e-9152.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496904.098e-6440.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498225.840e-6441.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491388.134e-6040.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346465.978e-5237.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek42.452e-6040.67NIMA related kinase 4 [Source:NCBI gene;Acc:101169... [more]
ENSORLT00000000545.21.904e-5640.54pep primary_assembly:ASM223467v1:4:1040495:1044496... [more]
ENSORLT00000034147.16.070e-5537.69serine/threonine-protein kinase Nek5 [Source:NCBI ... [more]
ENSORLT00000027525.12.729e-5333.54NIMA related kinase 3 [Source:NCBI gene;Acc:101171... [more]
ENSORLT00000045610.12.729e-5333.54NIMA related kinase 3 [Source:NCBI gene;Acc:101171... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057044.10.000e+099.17SMESG000057044.1[more]
SMESG000005635.15.056e-5742.05SMESG000005635.1[more]
SMESG000020466.17.083e-5340.91SMESG000020466.1[more]
SMESG000020466.17.408e-5340.91SMESG000020466.1[more]
SMESG000020466.17.606e-5340.91SMESG000020466.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022545 ID=SMED30022545|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1948bp
TAATGAAGAAATTTTAATTTCTTTGCTGTTATATTTAATTATATTTTTAC
ATGATCATATTTGCATAATTTTTTTCATTTCCAAATAGCACTTAACATGT
CAATTCTGCAAGAAAGCACGCGACACTGGGGCAACAGATATATATTTTTG
AGTGGAATTGGTAAAGGTTCATTTGGAACTGTTTATAAAGTCAAAGATTT
TCGAGGTCCGGAAGGGCAAGAAAGTATCAAAGTACTGAAAGAAGTGAATG
TTGATACAATGGACCAAGATCAAATTGAAGAATGTACAAGAGAAGGAAAA
TTGTTATCGAAATTGAATCATTCAAACATTGTTAAATTTTTTGATTCTTT
CCGCTTAGAGAATAACTATTGCATAATAACTGAATACTGCGAAGGCGGAG
ATTTAAAGCAAGTAATAGAGAAAACCAAACGATCAGGAAGTCATCTTGAA
GAGCTGCGAATTATTCGCTGGTTTATTCAAGTGATTGAAGGGTTGGATTA
TATCCATAAACGGAAAATCCTTCATCGAGATCTCAAACCGAATAACATTT
TCCTCAAATACGATTCGGTAAAGATAGGCGATTTTGGAATATCGAGAATT
CTCAATTTTACTAATGACCTGGCATCGACATTTCTCGGCACGCCTTACTA
TATGAGTCCTGAAGTTTTGAAGCATGACGGATACAACACAGCTTCCGATA
TCTGGTCGAGTGGAGTTATTTTATATGAAATGTGCGCGTTAAAGCACGCG
TTTATTGGGGATAATTTAATGAGAGTTATGGTGACAATTCTAGAAAGTCC
ATGTCCTCGAATTCCTTCAAATTATAGCGAAAATCTACAAGAGGTCCTTG
AATGTATTTTAGTCAAAGATCCAGACAACAGACCCAAGGCATGTGAAATT
TTAGATTTGCCATTTATCAAATCAAAGATTCGAGATCCCTGGATAGACAT
AGTGGAAAACGACGACATGAGTGAAACACTGGTGAATAATGAATCAAAGG
ATATTTCAAACTTTTTGTCTAAATCGACAGGTTTGAACATAATTACTGCT
GCCTCAGTCGAACTTACGCCAAAGCAGAAAATTCTACTGAAAAAGTCAAT
GGAAGCCGACAAAAAGGCAGAAGAGCAACGAGAATACATTGAAAAAACTC
ATAAATCAAATGTAGAAAACCGGCGAAAGCTGAAACAAGATCAGTTCCAA
TCATCTCTGCCTTTCACCAACCAAAGAAATGCGTCAACAAGATCTTCGAT
TTCTGAATATGATGAATTAAATTCTTCTAGAAATTCAGGATTCAACACAT
TTGCGGGAATAAATAAAGTTGAAAAAGAGAATTACAATCGGCTGTCTAAA
ACAGAAATAATTGGAAAACATTTCAAACTCACCCCAATTGAAGCCTTTAA
GAATAATGACGAAGAAGACGATATTTATAGTAGGAAGACAAATTTTAATC
AAAACGGATTGTTCAATACTCAATATAGAAATTTGAAATATGACGATTCA
TCTAATTATAACGTGGCTCCCTATAACCCAGTTAACGACCCCGATAATCA
AGATATCCTTTTTGAATATGCTCCTGATTTCGAAACGGACTCCGACAGTA
GCTCAAATTCCGTTAGAGAAAAAAATGGCGAGGATGAGATACAAATGGAT
CTAAACTTCGAAGCATTTCAAGATAATCCCGAAACTGATCCATATGGGAA
GAATACAAAACAGAAAAAAATTAATGCAATGAAAAAAAAATGCCTTGAAA
AGGTCGACGAGAAAACTCTTGAAAAAGCTATAAGATATATGAAAGAAAAT
TGGAGGAAAAAAGATTATATAATCAGACTTTTAAAGATCTGTAAGTCTGA
TGATGTTGCTATGACAGTGGATCAACTATTCTTTTTGATGCTTCCGATAA
ACGAAATATATTAGAGAATTTTGCTTGTTGTATAGATATTATATTAAA
back to top

protein sequence of SMED30022545-orf-1

>SMED30022545-orf-1 ID=SMED30022545-orf-1|Name=SMED30022545-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=606bp
MSILQESTRHWGNRYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEV
NVDTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEG
GDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNN
IFLKYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTAS
DIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPCPRIPSNYSENLQEV
LECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNES
KDISNFLSKSTGLNIITAASVELTPKQKILLKKSMEADKKAEEQREYIEK
THKSNVENRRKLKQDQFQSSLPFTNQRNASTRSSISEYDELNSSRNSGFN
TFAGINKVEKENYNRLSKTEIIGKHFKLTPIEAFKNNDEEDDIYSRKTNF
NQNGLFNTQYRNLKYDDSSNYNVAPYNPVNDPDNQDILFEYAPDFETDSD
SSSNSVREKNGEDEIQMDLNFEAFQDNPETDPYGKNTKQKKINAMKKKCL
EKVDEKTLEKAIRYMKENWRKKDYIIRLLKICKSDDVAMTVDQLFFLMLP
INEIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0016310phosphorylation
GO:0016572histone phosphorylation
GO:0031572G2 DNA damage checkpoint
GO:0031573intra-S DNA damage checkpoint
GO:0035556intracellular signal transduction
GO:0044772mitotic cell cycle phase transition
GO:1901990regulation of mitotic cell cycle phase transition
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 15..274
e-value: 3.3E-84
score: 295.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 18..274
e-value: 9.0E-63
score: 212.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 15..274
score: 48.654
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 6..372
e-value: 6.3E-80
score: 270.9
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 16..116
e-value: 0.011
score: 11.4
coord: 293..400
e-value: 260.0
score: -3.0
coord: 104..218
e-value: 1.1E-12
score: 44.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..382
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 351..382
NoneNo IPR availablePANTHERPTHR43671FAMILY NOT NAMEDcoord: 12..596
NoneNo IPR availablePANTHERPTHR43671:SF24SERINE/THREONINE-PROTEIN KINASE NEK11coord: 12..596
NoneNo IPR availableCDDcd08215STKc_Nekcoord: 14..274
e-value: 8.82203E-118
score: 348.298
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 141..153
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 12..275