SMED30022534

Overview
NameSMED30022534
Smed IDSMED30022534
Length (bp)1276
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022534 (SMED30022534) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022534 (SMED30022534) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022534 (SMED30022534) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022534 (SMED30022534) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022534

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022534SMESG000064314.1 SmedASXL_017252SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30022534SMESG000064303.1 SMESG000064314.1 Contig19558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022534SMESG000064303.1 SMESG000064314.1 Contig19558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30022534SMESG000064314.1 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022534SMESG000064314.1 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022534SMESG000064314.1 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022534SMESG000064314.1 Contig53784newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022534SMESG000064314.1 Contig53784uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30022534SMESG000064314.1 Contig53784newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022534SMESG000064314.1 Contig53784uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022534 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000055:317481..318891 -5459
v31.000055:315352..316578 -4936
v31.000055:317728..318878 -2319
v31.000055:315767..318401 -1388
Homology
BLAST of SMED30022534 vs. Planmine SMEST
Match: SMESG000064314.1 (SMESG000064314.1)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 363/426 (85.21%), Postives = 385/426 (90.38%), Query Frame = 1
Query:   10 VNETDHSDDQNDGELAKQIIIEIDEVEKNI----LDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            V+ET+   + N  ELA   II+++E  K      L++V  VDE D+S + N+   +E  + EV   +  Q ++V+ +  SK+D+ D S++LNESELAESNISEVDE ETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNII VDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE
Sbjct: 1362 VDETEEFINPNRSELADHNIIKVEEETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1787          

HSP 2 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 339/425 (79.76%), Postives = 364/425 (85.65%), Query Frame = 1
Query:    1 LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNV+ELENSVILNENTLTE IKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQ+QVNS++VI V  K  S +P+  E  +PN   + E +KNI EESNVK L  V E  HS DQ + EL E NI  +D+ E+NI+   N+ E SKVD+IDHS + NE         E++K E  Q + V S+E S++ EK  S +PN+ E  E
Sbjct: 2089 LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVE 2513          

HSP 3 Score: 259.225 bits (661), Expect = 3.185e-76
Identity = 222/500 (44.40%), Postives = 292/500 (58.40%), Query Frame = 1
Query:    7 NVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVN------------------------------------LDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVD-NVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNS----------------DD-------------------------PNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPA 1272
            NV++T HS DQN+ ELA Q II+ID+ EKNILDQVNV+ +TDHS + NK + +E  INEVD  + KQQ++V+ D VSKVD KD+S++ NESEL E N+ E+DE E    E+ N +E+ NV+ TDHS + N+ ELA+Q IIE+D  ++NI ++VN                                    LD VSKVD+ D+ ++ NESE AESNI++VDE ETKQ EQVN EEVSNV   ++S   NE+ L E    EVD +  NI     N +E SKVDE D  + PN+SE AESNIN VDE ETKQQ+QVN E+V  V E  NS                D+                         PN  E  + N+  VDEEE    E+ N   + NVD K+ S +  +SEL EPN   + E ++NI+ ++N+KE  KV + +HSV+ NE  L E    EIDK+E+  +D V  +E SK+DE  +SADPNESE A
Sbjct: 1973 NVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISE-KVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESA 2471          

HSP 4 Score: 251.136 bits (640), Expect = 1.823e-73
Identity = 208/442 (47.06%), Postives = 270/442 (61.09%), Query Frame = 1
Query:    1 LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV---------------VDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVEN-IQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQ-VNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            L  ++E D S   N+ +LA+  IIEID+ E N+ D V V                +ETDHSA+  + EP+ES INE  E +  Q+K  +L+ +SKV +KD S + NESE +ES I+EVDE E KQ EQVN EEVS V+  D+S +PNE  LAE  I+E+D  K NI++ VNL+E+SKVDE D   D NE+E +ESNIN+VDEGE KQQEQVN E VS V E +NS   N+ +  E  +  ++     + N   N  E SK+ E D S  PN+SE AE NIN VDEEE KQQ Q  N E+  +V EK NSDDPN  E ++P++KN+ E EKNI EESNVK L+ V  K+HS DQI+           + EERNIT D N K+ S VD+ DH+ + NE    E    E+D+ E          E+SK+DEK  S DP ++E  E
Sbjct: 3226 LSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEK-FNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNS---NDPSEIEPAESNINEFGGEMTNEKFNLVEASKIFEKDDSFDPNKSELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEG----------NSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSE------EESKVDEKDNSDDPYKNELVE 3647          

HSP 5 Score: 247.669 bits (631), Expect = 2.737e-72
Identity = 210/517 (40.62%), Postives = 276/517 (53.38%), Query Frame = 1
Query:   10 VNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRS------------------------INL---------------NESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEH-----------------------------------------STDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKL----------DEKYYSADPNESEPAE 1275
            ++E D S D N  EL++  IIEID+VEKNI D VNV     V+ETD +AN N+SEP ES I EVD  + KQ+++V+L+ VSKV++ D S                         NL               NE E+ + NI  +DE ET   E+ N  E+S +D  D S  PNE +LAE  IIE+D  K NI++ VNL+E+SKVDE     D NE+E +E NIN+VDEGE KQQEQVN E VS V E +NS   NE  L +    E+D  EN      N +E SKVDE  HS    +SEP+E NIN+VDE E KQQ+Q N E+V++V +K NSDDPN  E ++ ++  +D+ E NI +  NV  +S V+E +H                                         S D  +SE+ EPNI+NV E E +I+ + N+ E SK+D+ID SV  NE  L E    EID+ E    D V  +E S            +E  +SAD  E EPAE
Sbjct: 2780 IDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSEPDDSNINELGGKMTHEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAE 3296          

HSP 6 Score: 245.743 bits (626), Expect = 1.195e-71
Identity = 220/545 (40.37%), Postives = 297/545 (54.50%), Query Frame = 1
Query:    7 NVNETDHSDDQNDGELAKQIIIEIDEVEKNI-----LDQVNVVDETDHSANSNKSEPSESKINEVDE---------------------------ADW-------------KQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVD----------NVENIQNV----HANSEEESK----------------------VDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDH-----------------------------------------SVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            NV++TDHS D N+ +LA+Q IIE+D  E+NI     L++V+ V ETD S + N++EP+ES IN+VDE                           +D+             KQ K+++LD VSK+D+ D S++ NES+  ESNI EVD+ E  Q EQVNSEEVSNVD T HS + NE ELA QNII++D  ++NI     LD+V+ + + D  VDPN+ + AE NIN+VD GE KQQEQVN +EVS V   + SV  NE+ L E    E+D          NV+ + NV    H++ + + +                      VDETDHS   N+SEP+ES IN+VDE + KQQ +V+ + V +V +K  S + N  E  + N+  VDE E   +E+ N + +SNVD  +HS +  + ELAE NI  VD ++RNI+   NL E SKVD+ID                                          SV LNE TLTEPI KE+D  E  Q  H  SEE+SK+DE  +S  PN+SEPAE
Sbjct: 1811 NVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNI-----LDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAE 2349          

HSP 7 Score: 242.662 bits (618), Expect = 1.538e-70
Identity = 217/494 (43.93%), Postives = 279/494 (56.48%), Query Frame = 1
Query:   16 ETDHSDDQNDGELAKQIIIEIDE----VEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVD-----------------------------------------LDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQ-VNFEEVSNVYELENSVILNENTLTES-IKKEVDNVENIQ-------------------NVHANSEEE-----------SKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESE 1266
            ETDHS DQ + E A+  I E  E     EK  L+ ++ V E D S +SN+SEPSES INEVDE + KQQ++V+                                         L+ +SKVD++D S +LNE+E +ESNI+EVDE E KQ EQVN E VS V+  D+S +P+E E AE NI E   +  N  EK NL E SK+ E D   DPN+SE AE NIN VDE E KQQ+Q  NFEE S V+E +NS   NEN L E  IK  V+  +NI                     +  NSEE            S VDETDH+   N+SEPAESN N+VDEEE   +++       +V EK NSDDP   E ++P +KN +  EKNI  ES +K L  VD+ EHS +Q+K ++          EERNIT DANL++ S+VD+IDHSVN NE+TLT     E+DK ++ Q +    EE SK+DE ++SA+PNESE
Sbjct: 3282 ETDHSADQIEREPAESNINEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEFGGEMTN--EKFNLVEASKIFEKDDSFDPNKSELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSEEES------KVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKI----------EERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESE 3757          

HSP 8 Score: 239.58 bits (610), Expect = 1.484e-69
Identity = 208/477 (43.61%), Postives = 272/477 (57.02%), Query Frame = 1
Query:   16 ETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVD---------------------------------------------------EKEHSTDQIKSELAEPNIRNVDEEERNITAD-ANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            E D S D N+ E+ +  I  +DE E NI ++ NV     +DE D S   N+S+ +E  I E+D++       V+L+ +SKVD+K  S +LNE+E +E NI+EVDE E KQ EQVN E VS V+  D+S +PNE ELA+ NI E+D  + NI++ VN+DEVSKVDE     D  ESE +E NIN+VDEGE KQQEQ N EEV  V + +NS   N++ L ES   E+D  EN    H N +E SKV+ETDH+   N+SEP ESNI +VDE E KQQ+QVN E+V +V EK +S D N  E ++PN+KNV E E +I EE NV  LS +D                                                   E +HS DQI+ E AE NI    EEE  IT +  NL++ SKV + D S + NE   +E    E+D+ E  Q + V  EE SK++EK  S DPNES  AE
Sbjct: 2903 ENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEE--ITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAE 3377          

HSP 9 Score: 238.039 bits (606), Expect = 4.905e-69
Identity = 204/466 (43.78%), Postives = 277/466 (59.44%), Query Frame = 1
Query:    1 LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKS------------------------------------LSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            L NV+E +HS DQ   ELA+  I  +DE E+NI    N+     VD+ DHS N N+   +E    E+D+ +  Q   V  +  SK+D+K  S + NESE AESNI+EVD+ E KQ ++++ EEVSNVD TDHS + NE +LAEQNIIEVDV +RNISE+ NL+EVS V E D  VD NE+E  ESNIN VDE ET  QEQ+  EEVS V E + SV  NE+   E   K+VD  E  Q+   N  + SK+DETDHS+  N+S+P ESNI +VD+ E  QQ+QVNSE+V  V + Y+S D N  E  + N+  +D+ EKNI+++ NV                                      +S VD K+ S D  +SEL EPN+  +DE E+NI+  +N+KE   V++ DHS + N+  L + I  EID+ E+   D V     + +DE  +SA+ N+SEP+E
Sbjct: 1686 LSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEET-TQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINL-DVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQV-----NVVDETDHSANSNKSEPSE 2144          

HSP 10 Score: 230.72 bits (587), Expect = 1.786e-66
Identity = 209/522 (40.04%), Postives = 277/522 (53.07%), Query Frame = 1
Query:    1 LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELA-----------------------------------------ESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVS----------------------NVY-------------------ELENSVILNENTLTESIKKEVDNVEN----------IQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            L  ++E D S   N+ +LA+  IIEID+ + NI D VN+     VDE  HSA+ N++EPSE  INEVDE + KQQ++V+ +GVSKV++KD S + NE ELA                                         E NI+EVDE E KQ EQ N EEV  V+  D+S +PN+ EL E +IIE+D  + NI++ VN+DEVSKV+E D   + NESE  ESNI +VDEGE KQQEQVN EEVS                      NVY                   E++ SV  NE+ L E    E+D  EN            N +   +     +ETDHS    + EPAESNIN+  EEE  Q+ + N E + +V EK +S D N  E  +  +  VDE E    E+ N + +S V+EK++S D  +S LAE  I  +D+ + NIT   NL E SKVD+ DHS +LNE   +E    E+D+ E  Q + V  E  SK++EK  S DP+E EPAE
Sbjct: 2939 LSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQE-KFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAE 3459          

HSP 11 Score: 228.409 bits (581), Expect = 1.173e-65
Identity = 213/512 (41.60%), Postives = 274/512 (53.52%), Query Frame = 1
Query:    1 LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNIS--------------------------------------------------EKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEE-RNITADANLKEESKVDKIDHSVNLNEKTLTEP--------------------ITKEIDKN-----------EQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            +L VN+ D+SDD N  EL +  IIEID+ E NI D VNV     V+ETDH+ N N+SEP ES I EVDE + KQQ++V+ + VSKV++K  S + NESE+ E NI  V E ET   E+ N  E+S +D  D S   NE +LAE  IIE+D  + N++                                                  EK NL+++SKV E D   D NESE +ES IN+VDEGE KQQEQVN EEVS V E +NS   NE+ L E    E+D  +N      N  E SKVDE DHS   N++EP+ESNIN+VDE E KQQ+QVN E V +V EK NS+DP+  E  + N+     E  N  E+ N+   S + EK+ S D  KSELAE NI  VDEEE +    + N +E SKV + D+S + NE  L EP                    +TK   K            E+  TD V  ++ S +DE  ++ D NESEPAE
Sbjct: 3103 VLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEFGGEMTN--EKFNLVEASKIFEKDDSFDPNKSELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAE 3612          

HSP 12 Score: 228.409 bits (581), Expect = 1.380e-65
Identity = 185/427 (43.33%), Postives = 249/427 (58.31%), Query Frame = 1
Query:   10 VNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVV-----DETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            V+ETDHS D N+ E +   I EI + EKNI D+VNV      DE+DHS + NKSEP +S INE++       KK++LD V KVD+ + S++ NE E+ ESNI  V+E +T   E+ N  E S +D  D S +PN+ EL+E  IIE+D  ++NIS+ VN+DEVSKV+E D+  + NESE  ESNI +VD GE KQ+EQVN EEV                                         SKV+E D+S  PN SEP +SNIN++  + T   ++ N E+V +  E  +S DPN  E + PN+K +DE E NI EESNV  LS +DE + S    +S+LAE  I  +D+ + NIT   NL E SKVD+  HS +LNE   +E    E+D+ E  Q + V  E  SK++EK  S DPNE E A+
Sbjct: 2659 VDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGE--ITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEV-----------------------------------------SKVNENDYSRDPNGSEPDDSNINELGGKMT--HEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQ 3040          

HSP 13 Score: 215.312 bits (547), Expect = 4.058e-61
Identity = 206/469 (43.92%), Postives = 271/469 (57.78%), Query Frame = 1
Query:   10 VNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISE-KVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILN----------------ENTLTESIKKEVDNVE----------------NIQNV---------HANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            ++ETDHS D N+ ELA+  I E+DE E   L+QVN      VD TDHS   N+ E +E  I  VD       +KV+LD VSKVD+ D+ ++ NESE AESNI++VDE ETKQ EQVN EEVSNV   ++S   NE+ L E    EVD +  NI     N +E SKVDE D  + PN+SE AESNIN VDE ETKQQ+QVN E+V  V E  NS   N                +N + ES  K + NV+                NI+NV          AN +EESKVD+ DHS+  N+    E    ++D+ E  Q D V SE+  ++ EKY S DPN  E  + N+  VD+ E+   ++ +++ +SNVD+ +HS D  +S+LAE NI  VD  ERNI+   NL+E S V + D SV+LNE   TE    ++D+ E TQ + +ISEE SK+ EK  S DPNES+  E
Sbjct: 1443 LDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVD-NVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQ-EQLISEEVSKVGEKDVSVDPNESDFVE 1909          

HSP 14 Score: 205.682 bits (522), Expect = 7.622e-58
Identity = 164/341 (48.09%), Postives = 221/341 (64.81%), Query Frame = 1
Query:  256 RSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEK-VNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            R+ NLNE++     I+++ E   +  E  N   ++ +D  D+S +P E    E  I ++D  +  I +K VNL+EV KVDE ++F++PN SE A+ NI  V+E ETK+QEQ+N EEV+NV E + SV  NE TLTE I KEV NVENIQ    NSEE SK+DETDHS+  N+SE AESNI++VDE ETKQ +QVNSE+V  V    +S +PN  E  + N+  VD +++NI E+ N+  +S VDE +   D  +SE AE NI +VDE E       N +E S V ++++SV LNE TLTE I KE+D  E  Q  H  SEE+SK+DE  +S  PN+SEPAE
Sbjct: 1291 RADNLNETQ-----INKLGENVDQVNETFNLYVMTKMDQKDNSVDPYESAHIEAKINKID--EETIKQKQVNLEEVPKVDETEEFINPNRSELADHNIIKVEE-ETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAE 1623          

HSP 15 Score: 184.882 bits (468), Expect = 1.118e-50
Identity = 183/470 (38.94%), Postives = 265/470 (56.38%), Query Frame = 1
Query:    1 LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESA---------------------------------------ESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNII-EESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAE 1275
            L  ++ T HS D+N+ ELA+  I  ++E E++++   N+     VDE  +S + N++  +E    EVD  +  Q   V  + + K D+ + S++  E E AESNI EVDE E  Q E+ N +EVS VD TDHS +PNE E +  NI E+   ++NIS+KVN+D+VSK DE D  VDPN+SE                                         ESNI +V+EG+T   E+ N  E S + E + SV  N++ L+E    E+D VE   +   N +E SKV+ETD +   N+SEP ESNI +VD  E KQ++QVN E+V +V E   S DPN  E   P+  N++E    +  E+ N++ +S   E + S D  + E+ +PNI+ +DE E NI+ ++N+ E SK+D+ID SV  NE  L E    EID+++   TD V   E SK+DEK +SAD NE+EP+E
Sbjct: 2535 LSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEEL-KADETEYSVDQIERESAESNIDEVDEEEITQ-EKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSE---PDDSNINELGGKMTHEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSE 2999          

HSP 16 Score: 119.398 bits (298), Expect = 1.380e-28
Identity = 110/288 (38.19%), Postives = 145/288 (50.35%), Query Frame = 1
Query:   70 IEIDEVEKNILDQVNV-----VDETDHSANSNKSEPSESKINEVDEADWKQQK--KVD---------------------------------LDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEE 813
            IE +  E+NI D VN      VDETDH+ +SN+SEP+ES  NEVDE +   ++  KVD                                 L  + KVDK + S+N  + ++ E NI++            N  ++S VD  DHS   NE  L   N+IEVD  ++N  E  NL+E+SKVDEI    +PNESE  ESNI +VDEGET QQ+QVN                NE+T  E    EVD  E  Q  H N EEES VD+ D+ + P +S   + ++NKV E E
Sbjct: 3575 IEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSEEESKVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITD----------DANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN---------------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGE 3837          

HSP 17 Score: 67.0106 bits (162), Expect = 1.854e-11
Identity = 68/199 (34.17%), Postives = 88/199 (44.22%), Query Frame = 1
Query:    1 LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNI-----LDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQE 582
            L  V+E DHS + N+  L    +IE+D+ +KN      L++++ VDE  HSAN N+SE  ES I EVDE +  QQK+V               N NES   E N +EVD  E  Q E VN EE S VD                                         +ID FVDP ES   + ++N V EGE  + E
Sbjct: 3700 LSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQV---------------NPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVD-----------------------------------------KIDNFVDPKESPFTKPDVNKVSEGEKNKAE 3842          
The following BLAST results are available for this feature:
BLAST of SMED30022534 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022534 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064314.13.185e-7685.21SMESG000064314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022534 ID=SMED30022534|Name=SMED30022534|organism=Schmidtea mediterranea sexual|type=transcript|length=1276bp
CTGTTAAACGTTAATGAAACAGATCATTCCGATGATCAAAATGATGGTGA
ACTTGCTAAGCAAATTATAATCGAAATCGATGAAGTTGAAAAAAATATAT
TAGATCAAGTTAATGTGGTTGATGAAACAGATCATTCTGCTAATTCAAAT
AAAAGTGAACCTTCTGAGTCTAAAATCAATGAGGTAGATGAGGCAGATTG
GAAACAACAGAAGAAAGTTGATTTGGATGGAGTATCAAAGGTTGATAAAA
AGGATCGTTCCATCAATCTAAATGAAAGTGAACTTGCTGAGTCTAATATC
AGTGAAGTTGATGAGAGAGAGACTAAACAACTAGAGCAAGTTAATTCAGA
AGAAGTTTCAAATGTTGATATAACAGATCATTCTGGTGAACCAAATGAAC
ATGAACTTGCAGAGCAAAATATCATTGAGGTCGATGTTGATAAAAGGAAT
ATATCCGAAAAAGTTAATTTGGATGAGGTGTCAAAGGTTGATGAAATAGA
TCAATTTGTCGATCCAAATGAAAGTGAATCTGCTGAATCTAATATCAATG
ACGTTGATGAGGGAGAAACGAAACAACAAGAGCAAGTTAATTTTGAAGAG
GTATCAAATGTTTATGAATTAGAAAATTCTGTCATTCTGAATGAAAATAC
GCTGACTGAGTCCATCAAGAAAGAAGTCGATAATGTTGAAAACATTCAAA
ATGTGCATGCTAATTCTGAGGAGGAGTCAAAAGTTGATGAAACAGATCAT
TCTATATTTCCAAATCAAAGTGAACCTGCTGAATCTAATATCAACAAGGT
CGACGAGGAAGAAACAAAACAACAAGACCAAGTTAATTCTGAAAAAGTAA
TAGAAGTTGTTGAAAAATATAATTCTGATGATCCTAATTATGGTGAATTT
ATTGACCCTAATATGAAAAACGTGGACGAAGAAGAAAAGAATATAATCGA
GGAATCAAATGTGAAATCACTGTCAAATGTTGATGAAAAAGAGCATTCTA
CCGATCAGATTAAAAGTGAACTTGCTGAGCCTAATATAAGGAACGTCGAT
GAAGAGGAAAGGAATATAACCGCAGATGCAAATTTAAAAGAAGAGTCAAA
AGTTGATAAAATAGATCATTCTGTCAATCTGAATGAAAAGACCCTTACTG
AGCCCATCACAAAAGAAATCGATAAAAATGAACAAACTCAAACTGATCAT
GTTATTTCTGAAGAGAAGTCAAAGCTTGATGAGAAATATTATTCTGCAGA
TCCAAATGAAAGTGAACCTGCTGAGT
back to top

protein sequence of SMED30022534-orf-1

>SMED30022534-orf-1 ID=SMED30022534-orf-1|Name=SMED30022534-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=425bp
LLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSN
KSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNI
SEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRN
ISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEE
VSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDH
SIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEF
IDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVD
EEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDH
VISEEKSKLDEKYYSADPNESEPAE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 222..242
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 46..91
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 236..288
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 237..251
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 263..277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 167..192
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 39..121
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 99..113