p2X purinoceptor 4

Overview
Namep2X purinoceptor 4
Smed IDSMED30022519
Length (bp)1435
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of p2X purinoceptor 4 (SMED30022519) t-SNE clustered cells

Violin plots show distribution of expression levels for p2X purinoceptor 4 (SMED30022519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of p2X purinoceptor 4 (SMED30022519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for p2X purinoceptor 4 (SMED30022519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30022519SMESG000020579.1 dd_Smed_v4_9166_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022519SMESG000020579.1 dd_Smed_v4_9166_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022519SMESG000020579.1 dd_Smed_v4_9166_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022519SMESG000020579.1 dd_Smed_v4_9166_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022519SMESG000020579.1 dd_Smed_v4_9166_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022519SMESG000020579.1 Contig39354newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022519SMESG000020579.1 Contig39354uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30022519SMESG000020579.1 dd_Smed_v6_9166_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 307.375 bits (786), Expect = 2.780e-100
Identity = 165/380 (43.42%), Postives = 238/380 (62.63%), Query Frame = 1
Query:   52 GLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLL 1179
              LFEY+T +IV I S KVG++NR +QLLI+ Y++ WV + EKGYQE D+ VS++TTKVKG+   N S     G   WD ADYV+P QE N+ FV+TN ++T  Q+ G+C E PD     CK+D+ C   S    ++G+ TG+C+ ++     CE+  WCPVE+D+  +         EN+T+L+KN+I +PKF   +RN+L      +L +C ++A  +   +CPI     I +    + + +  EGG++ I ++W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L+KAYG+RF + V GKAGKF +IP  +N+GSGLALLG+A++LCDIIVL+ +  +  Y+  KY+ VE  E+ L
Sbjct:   10 AFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTS---KLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTV-CKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDT-HVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDA--KTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGL 382          
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 297.36 bits (760), Expect = 4.638e-96
Identity = 166/396 (41.92%), Postives = 239/396 (60.35%), Query Frame = 1
Query:   52 GLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIV-C---------------WVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLL 1179
              LFEY+T +IV I S KVG++NR +QLLI+ Y++ C               WV + EKGYQE D+ VS++TTKVKG+   N S     G   WD ADYV+P QE N+ FV+TN ++T  Q+ G+C E PD     CK+D+ C   S    ++G+ TG+C+ ++     CE+  WCPVE+D+  +         EN+T+L+KN+I +PKF   +RN+L      +L +C ++A  +   +CPI     I +    + + +  EGG++ I ++W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L+KAYG+RF + V GKAGKF +IP  +N+GSGLALLG+A++LCDIIVL+ +  +  Y+  KY+ VE  E+ L
Sbjct:   10 AFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGCYHPHLAEVEMESPRRWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTS---KLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTV-CKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDT-HVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDA--KTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGL 398          
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 283.493 bits (724), Expect = 1.530e-91
Identity = 141/332 (42.47%), Postives = 203/332 (61.14%), Query Frame = 1
Query:   52 GLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIP 1035
              LFEY+T +IV I S KVG++NR +QLLI+ Y++ WV + EKGYQE D+ VS++TTKVKG+   N S     G   WD ADYV+P QE N+ FV+TN ++T  Q+ G+C E PD     CK+D+ C   S    ++G+ TG+C+ ++     CE+  WCPVE+D+  +         EN+T+L+KN+I +PKF   +RN+L      +L +C ++A  +   +CPI     I +    + + +  EGG++ I ++W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L+KAYG+RF + V GKAGKF +IP
Sbjct:   10 AFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTS---KLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTV-CKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDT-HVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDA--KTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIP 334          
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX5 (purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:HGNC:8536])

HSP 1 Score: 282.722 bits (722), Expect = 3.010e-90
Identity = 154/399 (38.60%), Postives = 220/399 (55.14%), Query Frame = 1
Query:   43 KGIGL-LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSK-KFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRF-EANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDE-NANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIKTETTKTFLA 1218
            KG+ L LF+Y+T+K V   + KVG++ R++Q  I+ Y+V WV +++KGYQ++DT + SA+ TKVKG+ F N SD    G   WD ADYV+P Q  N FFV+TN ++TP Q   VC E+  + D  C  DSDC     +   +G+ TG+CL       G CEI  WCP+E  S P   EP     E++T+ IKN I FPKF   + NV+D   + FL +C F   NH    YCPI    ++ +   +  + +  EGGV+ INI W C+LD     C+P YSF RLD++ + +++ G NFRF  YY+       R L+KAYG+RF V V GK   F                      CD+++++L+  +  Y+  KYE V   E    E + E +   L+
Sbjct:    7 KGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSD---LGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRP--EEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNH----YCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFF----------------------CDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLS 374          
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX5-TAX1BP3 (P2RX5-TAX1BP3 readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:49191])

HSP 1 Score: 282.337 bits (721), Expect = 5.639e-90
Identity = 154/399 (38.60%), Postives = 220/399 (55.14%), Query Frame = 1
Query:   43 KGIGL-LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSK-KFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRF-EANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDE-NANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIKTETTKTFLA 1218
            KG+ L LF+Y+T+K V   + KVG++ R++Q  I+ Y+V WV +++KGYQ++DT + SA+ TKVKG+ F N SD    G   WD ADYV+P Q  N FFV+TN ++TP Q   VC E+  + D  C  DSDC     +   +G+ TG+CL       G CEI  WCP+E  S P   EP     E++T+ IKN I FPKF   + NV+D   + FL +C F   NH    YCPI    ++ +   +  + +  EGGV+ INI W C+LD     C+P YSF RLD++ + +++ G NFRF  YY+       R L+KAYG+RF V V GK   F                      CD+++++L+  +  Y+  KYE V   E    E + E +   L+
Sbjct:    7 KGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSD---LGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRP--EEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNH----YCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFF----------------------CDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLS 374          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:ZFIN;Acc:ZDB-GENE-030319-5])

HSP 1 Score: 298.13 bits (762), Expect = 1.403e-95
Identity = 158/375 (42.13%), Postives = 230/375 (61.33%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD-DENA--NIAKGLNFRFGHYY-QINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQ 1164
            L +Y+T+K V   + KVGV+ R+ QL +IGY++ WV I +KGYQE +  + S++ TK+KG+   N S    +G+  W   DYV+PPQ +  FFV+TN ++TP Q  G C ESP V D  C ND++C +  +++   G+ TG+CLN +   G CEI  WCPVE+   P+  EP+    EN+TV +KN I+FPKF   + NVL  +   +L TCR++ +H    YCPI     +      T + L   GG + I I W C+LD +   CNPEYSF RLD  EN+  ++  G NFRF  YY       +R+L K YG+RF + V GKAG+FS+IP  +N+GSGLAL+G     CD+I+L+++   + Y+  K+E +++
Sbjct:   12 LLDYKTEKFVIAKNKKVGVLFRLFQLTVIGYLIGWVFIWKKGYQETEEAIQSSVITKLKGVDLTNSSQ---FGLQLWGAEDYVIPPQGDRVFFVVTNYLVTPNQRLGYCPESPKVPDGFCTNDNECVEGESVLAGHGVKTGRCLNDT---GTCEINAWCPVEHGHAPV--EPMLAKAENFTVYVKNFIKFPKFGFFKSNVLPITNSTYLKTCRYDKDHH--PYCPIFLVGDVINWTGYTFQDLATRGGSIGIGIEWNCDLDKDESHCNPEYSFTRLDSSENSQHSVTSGYNFRFARYYNDAAGQTYRNLFKVYGIRFDILVNGKAGRFSIIPTVINIGSGLALMGAGVFACDMILLYMMSKSSFYRETKFEAIKK 376          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:ZFIN;Acc:ZDB-GENE-030319-5])

HSP 1 Score: 298.13 bits (762), Expect = 1.403e-95
Identity = 158/375 (42.13%), Postives = 230/375 (61.33%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD-DENA--NIAKGLNFRFGHYY-QINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQ 1164
            L +Y+T+K V   + KVGV+ R+ QL +IGY++ WV I +KGYQE +  + S++ TK+KG+   N S    +G+  W   DYV+PPQ +  FFV+TN ++TP Q  G C ESP V D  C ND++C +  +++   G+ TG+CLN +   G CEI  WCPVE+   P+  EP+    EN+TV +KN I+FPKF   + NVL  +   +L TCR++ +H    YCPI     +      T + L   GG + I I W C+LD +   CNPEYSF RLD  EN+  ++  G NFRF  YY       +R+L K YG+RF + V GKAG+FS+IP  +N+GSGLAL+G     CD+I+L+++   + Y+  K+E +++
Sbjct:   12 LLDYKTEKFVIAKNKKVGVLFRLFQLTVIGYLIGWVFIWKKGYQETEEAIQSSVITKLKGVDLTNSSQ---FGLQLWGAEDYVIPPQGDRVFFVVTNYLVTPNQRLGYCPESPKVPDGFCTNDNECVEGESVLAGHGVKTGRCLNDT---GTCEINAWCPVEHGHAPV--EPMLAKAENFTVYVKNFIKFPKFGFFKSNVLPITNSTYLKTCRYDKDHH--PYCPIFLVGDVINWTGYTFQDLATRGGSIGIGIEWNCDLDKDESHCNPEYSFTRLDSSENSQHSVTSGYNFRFARYYNDAAGQTYRNLFKVYGIRFDILVNGKAGRFSIIPTVINIGSGLALMGAGVFACDMILLYMMSKSSFYRETKFEAIKK 376          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4b (purinergic receptor P2X, ligand-gated ion channel, 4b [Source:ZFIN;Acc:ZDB-GENE-030319-4])

HSP 1 Score: 290.041 bits (741), Expect = 1.488e-93
Identity = 156/376 (41.49%), Postives = 240/376 (63.83%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLL-YEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENA--NIAKGLNFRFGHYYQIN-NTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVE-QDE 1170
            LF++ T  I+ ++S KVG I R++QL II Y+  +V   ++ YQE D+ +S+++TKVKG    N S   + G   WDT++YV+PPQ  N+FFV+TNA++T  Q+ G C E P      C++DSDC++    I  +G+ TGKC+ YS+    CE+  WCP+END++ I    L    E++TVLIKN+I++PKF+ ++RN+L      +L  C F  NH+   +CP+     I  +      ++  +GG++ I I W+C+LD+N +FC P+YSFRRLD++N   N+A G NFR+  YY  N NT  R L+KA+G+RF V V G AGKF+++P  +N+G+ LALL L  ++CD  +L+ L     Y + K++ ++ +DE
Sbjct:   11 LFDHGTPVILVVSSKKVGFIFRLLQLCIIVYVAVYVCWYKRAYQERDSVISSVSTKVKGNILTNSS---ALGTHVWDTSEYVIPPQGENSFFVLTNAIVTQGQTQGSCPEIPS-EFTNCQSDSDCKEGLKEIRGNGVQTGKCVQYSETIKTCEVLSWCPLENDTV-IPKPALLSAAEDFTVLIKNNIQYPKFKFRKRNILRHINSTYLKNCTF--NHKTDPHCPVFRLGDIVTESGEDFSIMALKGGIIGIFIDWSCDLDFNERFCVPKYSFRRLDNKNPENNVAPGYNFRYAKYYMNNENTETRTLIKAFGIRFDVIVFGMAGKFNIVPTIVNVGAALALLNLMKVICDWFMLNCLSDSEYYSKHKFKHLKPKDE 379          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 286.574 bits (732), Expect = 2.811e-92
Identity = 162/382 (42.41%), Postives = 228/382 (59.69%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLL-YEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIK 1191
             F+Y T KI+ I S KVG +NR  Q L+I Y++ +V +  KGYQ+ DT +S++TTKVKGI   N S+    G   WD ADY++PPQE+ +FFV+TN +IT  Q+   C E+P    + C +  DC++  N     G+ TG+C++YS     CE+  WCP+E    P  N PL    EN+TVLIKN+I +PKF   +RN+L      +L  C F  + +    CPI     I  +     +++   GGV+ + I W C+LD    +C P Y+FRRLD  D + N+A G NFRF  YY+  + T  R L+K YG+RF V V G+AGKF++IP  +N+G+GLALLGL +++CD IVL  +  K  Y+  KY  V+    L NE K
Sbjct:   15 FFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSE---LGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENP-TPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDP-PNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVF--SRKTDPDCPIFRLGDIVGEAEEDFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNMGAGLALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDFGLLHNEDK 389          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 279.256 bits (713), Expect = 2.649e-89
Identity = 162/391 (41.43%), Postives = 228/391 (58.31%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQ---------ENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLL-YEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIK 1191
             F+Y T KI+ I S KVG +NR  Q L+I Y++ +V +  KGYQ+ DT +S++TTKVKGI   N S+    G   WD ADY++PPQ         E+ +FFV+TN +IT  Q+   C E+P    + C +  DC++  N     G+ TG+C++YS     CE+  WCP+E    P  N PL    EN+TVLIKN+I +PKF   +RN+L      +L  C F  + +    CPI     I  +     +++   GGV+ + I W C+LD    +C P Y+FRRLD  D + N+A G NFRF  YY+  + T  R L+K YG+RF V V G+AGKF++IP  +N+G+GLALLGL +++CD IVL  +  K  Y+  KY  V+    L NE K
Sbjct:   15 FFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSE---LGERIWDVADYIIPPQVVRRLDEEEEDGSFFVLTNMIITTNQTQSKCAENP-TPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDP-PNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVF--SRKTDPDCPIFRLGDIVGEAEEDFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNMGAGLALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDFGLLHNEDK 398          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: ENSXETT00000000163.1 (purinergic receptor P2X, ligand gated ion channel, 4 [Source:NCBI gene;Acc:100489363])

HSP 1 Score: 305.064 bits (780), Expect = 3.308e-99
Identity = 164/384 (42.71%), Postives = 240/384 (62.50%), Query Frame = 1
Query:   40 GKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFE-ANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDE--NANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKL 1176
            G+    +F+Y+T +I  I S K+G +NR IQL I+ Y++ WV I EKGYQE DT VS++T+KVKG+   N S+    GV  WD ADY++P QE NAFFV+TN ++T  Q+ G C E P+  ++ C     C        ++G+ TGKC+ Y+     CEI  WCPVEND+  + +       EN+TVLIKN+I +PKF+  +RN+L      +L +C+++  NH    +CPI    +I K+   T + +  +GGV+ I I+W C+LDW   +C P+YSFRRLD+   + N++ G NFRF  Y++  N    R L+K YG+RF + V G AGKF +IP  +N+GSG AL G+A++LCD+IV H    ++ Y+  KY+ VE  ++L
Sbjct:   19 GQVYSCIFDYDTPRIALIKSRKIGFLNRFIQLGILAYVIGWVFIWEKGYQEFDTVVSSVTSKVKGVAVTNTSE---LGVKIWDVADYIIPAQEENAFFVMTNLILTQNQTQGYCPELPE--NSVCSEKQPCTPGYVGKQSNGVQTGKCVPYNSTVNTCEIFAWCPVENDT-HVPDPAFLNGAENFTVLIKNNIWYPKFQAFKRNILSNISSSYLKSCQYDKVNH---PFCPIFRLGSIVKEAGETFRDMAVQGGVMGIQINWDCDLDWKLTYCVPKYSFRRLDNREIDHNVSPGYNFRFAKYFKDSNGVESRSLMKVYGIRFDILVFGTAGKFDIIPTMINIGSGAALFGVATVLCDMIVFHFFKKRHYYREKKYKYVEDYDEL 393          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: ENSXETT00000000415.1 (purinergic receptor P2X, ligand gated ion channel, 4 [Source:NCBI gene;Acc:100489363])

HSP 1 Score: 298.13 bits (762), Expect = 1.096e-96
Identity = 163/384 (42.45%), Postives = 239/384 (62.24%), Query Frame = 1
Query:   40 GKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFE-ANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDE--NANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKL 1176
            G+    +F+Y+T +I  I S K+G +NR IQL I+ Y++ WV I EKGYQE DT VS++T+KVKG+   N S+    GV  WD ADY++P  E NAFFV+TN ++T  Q+ G C E P+  ++ C     C        ++G+ TGKC+ Y+     CEI  WCPVEND+  + +       EN+TVLIKN+I +PKF+  +RN+L      +L +C+++  NH    +CPI    +I K+   T + +  +GGV+ I I+W C+LDW   +C P+YSFRRLD+   + N++ G NFRF  Y++  N    R L+K YG+RF + V G AGKF +IP  +N+GSG AL G+A++LCD+IV H    ++ Y+  KY+ VE  ++L
Sbjct:    9 GQVYSCIFDYDTPRIALIKSRKIGFLNRFIQLGILAYVIGWVFIWEKGYQEFDTVVSSVTSKVKGVAVTNTSE---LGVKIWDVADYIIP--EENAFFVMTNLILTQNQTQGYCPELPE--NSVCSEKQPCTPGYVGKQSNGVQTGKCVPYNSTVNTCEIFAWCPVENDT-HVPDPAFLNGAENFTVLIKNNIWYPKFQAFKRNILSNISSSYLKSCQYDKVNH---PFCPIFRLGSIVKEAGETFRDMAVQGGVMGIQINWDCDLDWKLTYCVPKYSFRRLDNREIDHNVSPGYNFRFAKYFKDSNGVESRSLMKVYGIRFDILVFGTAGKFDIIPTMINIGSGAALFGVATVLCDMIVFHFFKKRHYYREKKYKYVEDYDEL 381          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 298.516 bits (763), Expect = 1.623e-96
Identity = 164/386 (42.49%), Postives = 232/386 (60.10%), Query Frame = 1
Query:   43 KGIGL-LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSK--KFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDE--NANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKL 1176
            KG+ L  F+Y+T+K V   + KVG++ R++QL I+ Y+V WV +V+KGYQE DT + S+I TK+KG+ F N S+    G   WD  DYV+PPQ  N FFV+TN ++TP Q    C ES  + DA C  +SDC +   ++  +G+ TG+CL        G CEI  WCP+E         PL    EN+TV IKN I FPKF   + N+L+     +L TCR+    ++  YCPI     I     +  + +  EGGV+ I I W CNLD     C+P YSF RLD++    +++ G NFRF  YY+  N   +R L+KAYG+RF + V GKAGKF++IP  +N+GSGLALLG  +  CD+++L+L+   N Y+  K+E V+   K+
Sbjct:    7 KGLFLSFFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSE---LGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKK--PKTPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYS---KDDHYCPIFHLGKIVSWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFEEVKSASKM 384          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: ENSXETT00000000980.1 (purinergic receptor P2X, ligand gated ion channel, 4 [Source:NCBI gene;Acc:100489363])

HSP 1 Score: 296.59 bits (758), Expect = 2.935e-96
Identity = 162/385 (42.08%), Postives = 236/385 (61.30%), Query Frame = 1
Query:   40 GKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFE-ANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDE--NANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLL 1179
            G+    +F+Y+T +I  I S K+G +NR IQL I+ Y++ WV I EKGYQE DT VS++T+KVKG+   N S+    GV  WD ADY++P QE NAFFV+TN ++T  Q+ G C E+  +       D+  Q            TGKC+ Y+     CEI  WCPVEND+  + +       EN+TVLIKN+I +PKF+  +RN+L      +L +C+++  NH    +CPI    +I K+   T + +  +GGV+ I I+W C+LDW   +C P+YSFRRLD+   + N++ G NFRF  Y++  N    R L+K YG+RF + V G AGKF +IP  +N+GSG AL G+A++LCD+IV H    ++ Y+  KY+ VE  ++L+
Sbjct:    8 GQVYSCIFDYDTPRIALIKSRKIGFLNRFIQLGILAYVIGWVFIWEKGYQEFDTVVSSVTSKVKGVAVTNTSE---LGVKIWDVADYIIPAQEENAFFVMTNLILTQNQTQGYCPENILLNILLFLPDAGVQ------------TGKCVPYNSTVNTCEIFAWCPVENDT-HVPDPAFLNGAENFTVLIKNNIWYPKFQAFKRNILSNISSSYLKSCQYDKVNH---PFCPIFRLGSIVKEAGETFRDMAVQGGVMGIQINWDCDLDWKLTYCVPKYSFRRLDNREIDHNVSPGYNFRFAKYFKDSNGVESRSLMKVYGIRFDILVFGTAGKFDIIPTMINIGSGAALFGVATVLCDMIVFHFFKKRHYYREKKYKYVEDYDELM 373          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: ENSXETT00000000402.1 (purinergic receptor P2X, ligand gated ion channel, 4 [Source:NCBI gene;Acc:100489363])

HSP 1 Score: 295.819 bits (756), Expect = 7.519e-96
Identity = 163/384 (42.45%), Postives = 237/384 (61.72%), Query Frame = 1
Query:   40 GKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFE-ANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDE--NANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKL 1176
            G+    +F+Y+T +I  I S K+G +NR IQL I+ Y++ WV I EKGYQE DT VS++T+KVKG+   N S+    GV  WD ADY++P QE NAFFV+TN ++T  Q+ G C   P+VR                +  +G+ TGKC+ Y+     CEI  WCPVEND+  + +       EN+TVLIKN+I +PKF+  +RN+L      +L +C+++  NH    +CPI    +I K+   T + +  +GGV+ I I+W C+LDW   +C P+YSFRRLD+   + N++ G NFRF  Y++  N    R L+K YG+RF + V G AGKF +IP  +N+GSG AL G+A++LCD+IV H    ++ Y+  KY+ VE  ++L
Sbjct:    8 GQVYSCIFDYDTPRIALIKSRKIGFLNRFIQLGILAYVIGWVFIWEKGYQEFDTVVSSVTSKVKGVAVTNTSE---LGVKIWDVADYIIPAQEENAFFVMTNLILTQNQTQGYC---PEVRLNI------LLNILLFLPDAGVQTGKCVPYNSTVNTCEIFAWCPVENDT-HVPDPAFLNGAENFTVLIKNNIWYPKFQAFKRNILSNISSSYLKSCQYDKVNH---PFCPIFRLGSIVKEAGETFRDMAVQGGVMGIQINWDCDLDWKLTYCVPKYSFRRLDNREIDHNVSPGYNFRFAKYFKDSNGVESRSLMKVYGIRFDILVFGTAGKFDIIPTMINIGSGAALFGVATVLCDMIVFHFFKKRHYYREKKYKYVEDYDEL 375          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 298.13 bits (762), Expect = 7.359e-97
Identity = 165/381 (43.31%), Postives = 238/381 (62.47%), Query Frame = 1
Query:   52 GLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLN 1182
              LFEY+T +IV I S KVG++NR++QLLI+ Y++ WV + EKGYQE D+ VS++TTK KG+   N S     G   WD ADYVVP QE N+ F++TN ++T  Q+ G C E PD + + C +D++C   S+   +SG+ TG+C+ ++     CE+  WCPVEND+  +         EN+T+L+KN+I +PKF   +RN+L      +L +C +  N +   +CPI     I      + +++  EGG++ I I W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L KAYG+RF + V GKAGKF +IP  +N+GSGLALLG+A++LCD+IVL+ +  +  Y+  KY+ VE  E+ L+
Sbjct:   10 AFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTS---QLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPD-KTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDA-GVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIY--NARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCMKKRYYYRDKKYKYVEDYEQGLS 383          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:MGI Symbol;Acc:MGI:2137026])

HSP 1 Score: 292.738 bits (748), Expect = 7.449e-94
Identity = 167/402 (41.54%), Postives = 240/402 (59.70%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKF-GLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENA-NIAKGLNFRFGHYYQINNTPH----RDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVE-QDEKLLNEIKTETTKTFLAPDNKIE 1236
            LF+Y+T K V   S KVG++ R++QL I+ Y++ WV +++K YQ+IDT + SA+ TKVKG+ + N +     G   WD AD+V+P Q  N FFV+TN ++TP Q  G+C E   + D  C  D+DC    +++   G+ TG+CL       G CEI  WCPVE  S+P   +PL    E +T+ IKN I FPKF   + NVL+   K FL TC F + +    YCPI    +I +   A  + +  +GGV+ I+I W C+LD     CNP Y F RLD+++  +I+ G NFRF  YY+    PH    RDL+KAYG+RF V V GKAGKFS+IP  +N+GSGLAL+G  +  CD+++++L+     Y+  K+E V  Q E+   E++    +  L  D  +E
Sbjct:   13 LFDYKTAKFVVAKSKKVGLLYRVLQLTILLYLLIWVFLIKKSYQDIDTSLQSAVVTKVKGVAYTNTT---MLGERLWDVADFVIPSQGENVFFVVTNLIVTPNQRQGICAEREGIPDGECSEDTDCHAGESVVAGHGLKTGRCLRVGNSTRGTCEIFAWCPVETKSMP--TDPLLKDAEGFTIFIKNFIRFPKFNFSKANVLETGNKHFLKTCHFSSTNL---YCPIFRLGSIVRWAGADFQDIALKGGVIGIHIEWDCDLDKAASHCNPHYYFNRLDNKHTQSISSGYNFRFARYYR---DPHGVEFRDLMKAYGIRFDVIVNGKAGKFSIIPTVINIGSGLALMGAGAFFCDLVLIYLIRKSEFYRDKKFEKVRGQKEEDNVEVEANEMEQELPEDKPLE 403          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 275.404 bits (703), Expect = 2.752e-88
Identity = 150/381 (39.37%), Postives = 219/381 (57.48%), Query Frame = 1
Query:   52 GLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLN 1182
              LFEY+T +IV I S KVG++NR++QLLI+ Y++ WV + EKGYQE D+ VS++TTK KG+   N S     G   WD ADYVVP QE N+ F++TN ++T  Q+ G C E PD + + C +D++C   S+   +SG+ TG+C+ ++     CE+  WCPVEND+  +         EN+T+L+KN+I +PKF   +RN+L      +L +C +  N +   +CPI     I      + +++  EGG++ I I W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L KAYG+RF + V GKA                      ++LCD+IVL+ +  +  Y+  KY+ VE  E+ L+
Sbjct:   10 AFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTS---QLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPD-KTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDA-GVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIY--NARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKA----------------------TVLCDVIVLYCMKKRYYYRDKKYKYVEDYEQGLS 361          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 265.774 bits (678), Expect = 1.390e-84
Identity = 156/381 (40.94%), Postives = 222/381 (58.27%), Query Frame = 1
Query:   52 GLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLN 1182
              LFEY+T +IV I S KVG++NR++QLLI+ Y++ WV + EKGYQE D+ VS++TTK KG+   N S     G   WD ADYVVP QE N+ F++TN ++T  Q+ G C E PD + + C +D++C   S+   +SG+ TG+C+ ++     CE+  WCPVEND+                             V  RN+L      +L +C +  N +   +CPI     I      + +++  EGG++ I I W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L KAYG+RF + V GKAGKF +IP  +N+GSGLALLG+A++LCD+IVL+ +  +  Y+  KY+ VE  E+ L+
Sbjct:   10 AFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTS---QLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPD-KTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDA----------------------------GVPTRNILPNITTSYLKSCIY--NARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCMKKRYYYRDKKYKYVEDYEQGLS 356          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:MGI Symbol;Acc:MGI:2137026])

HSP 1 Score: 264.233 bits (674), Expect = 4.442e-84
Identity = 147/375 (39.20%), Postives = 210/375 (56.00%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKF-GLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENA-NIAKGLNFRFGHYYQINNTPH----RDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETV 1158
            LF+Y+T K V   S KVG++ R++QL I+ Y++ WV +++K YQ+IDT + SA+ TKVKG+ + N +     G   WD AD+V+P Q  N FFV+TN ++TP Q  G+C E   + D  C  D+DC    +++   G+ TG+CL       G CEI  WCPVE  S+P   +PL    E +T+ IKN I FPKF   + NVL+   K FL TC F + +    YCPI    +I +   A  + +  +GGV+ I+I W C+LD     CNP Y F RLD+++  +I+ G NFRF  YY+    PH    RDL+KAYG+RF V V GK   F                      CD+++++L+     Y+  K+E V
Sbjct:   13 LFDYKTAKFVVAKSKKVGLLYRVLQLTILLYLLIWVFLIKKSYQDIDTSLQSAVVTKVKGVAYTNTT---MLGERLWDVADFVIPSQGENVFFVVTNLIVTPNQRQGICAEREGIPDGECSEDTDCHAGESVVAGHGLKTGRCLRVGNSTRGTCEIFAWCPVETKSMP--TDPLLKDAEGFTIFIKNFIRFPKFNFSKANVLETGNKHFLKTCHFSSTNL---YCPIFRLGSIVRWAGADFQDIALKGGVIGIHIEWDCDLDKAASHCNPHYYFNRLDNKHTQSISSGYNFRFARYYR---DPHGVEFRDLMKAYGIRFDVIVNGKGAFF----------------------CDLVLIYLIRKSEFYRDKKFEKV 354          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q99571|P2RX4_HUMAN (P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX4 PE=1 SV=2)

HSP 1 Score: 307.375 bits (786), Expect = 1.335e-99
Identity = 165/380 (43.42%), Postives = 238/380 (62.63%), Query Frame = 1
Query:   52 GLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLL 1179
              LFEY+T +IV I S KVG++NR +QLLI+ Y++ WV + EKGYQE D+ VS++TTKVKG+   N S     G   WD ADYV+P QE N+ FV+TN ++T  Q+ G+C E PD     CK+D+ C   S    ++G+ TG+C+ ++     CE+  WCPVE+D+  +         EN+T+L+KN+I +PKF   +RN+L      +L +C ++A  +   +CPI     I +    + + +  EGG++ I ++W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L+KAYG+RF + V GKAGKF +IP  +N+GSGLALLG+A++LCDIIVL+ +  +  Y+  KY+ VE  E+ L
Sbjct:   10 AFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTS---KLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTV-CKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDT-HVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDA--KTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGL 382          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|P51577|P2RX4_RAT (P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.077e-96
Identity = 167/380 (43.95%), Postives = 238/380 (62.63%), Query Frame = 1
Query:   55 LLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLN 1182
             LFEY+T +IV I S KVG++NR +QLLI+ Y++ WV + EKGYQE D+ VS++TTK KG+   N S     G   WD ADYV+P QE N+ F++TN ++T  Q+   C E PD + + C +D+DC   S    +SG+ TG+C+ +++    CE+  WCPVEND + +         EN+T+L+KN+I +PKF   +RN+L      +L +C +  N Q   +CPI    TI +    + +++  EGG++ I I W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L KAYG+RF + V GKAGKF +IP  +N+GSGLALLG+A++LCD+IVL+ +  K  Y+  KY+ VE  E+ L+
Sbjct:   11 FLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTS---QLGFRIWDVADYVIPAQEENSLFIMTNMIVTVNQTQSTCPEIPD-KTSICNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPVEND-VGVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIY--NAQTDPFCPIFRLGTIVEDAGHSFQEMAVEGGIMGIQIKWDCNLDRAASLCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGKEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCMKKKYYYRDKKYKYVEDYEQGLS 383          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q5E9U1|P2RX4_BOVIN (P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.187e-96
Identity = 166/381 (43.57%), Postives = 237/381 (62.20%), Query Frame = 1
Query:   52 GLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLN 1182
              LFEY+T +IV I S KVG++NR +QLLI+ Y++ WV + EKGYQE D+ VS++T K KG+   N S     G   WD ADYV+P QE N+ F++TN VIT  Q+ G+C E P  +   C+ D++C   S    +SG+ TG+C++++     CE+  WCPVE+D+  +         EN+T+L+KN+I +PKF   +RN+L      +L TC ++A  +   +CPI     I +    + + +  EGG++ I I W CNLD    FC P YSFRRLD  D   N++ G NFRF  YY  +    HR L+KAYG+RF + V GKAGKF +IP  +N+GSGLALLG+A++LCD+IVL+ +  +  Y+  KY+ VE  E+ L 
Sbjct:   10 AFLFEYDTPRIVLIRSRKVGLMNRTVQLLILAYVIGWVFVWEKGYQETDSVVSSVTVKAKGVTMTNTS---KLGFRIWDVADYVIPAQEENSVFIMTNMVITMNQTQGLCPEIPG-KTTVCETDANCTAGSAGTHSSGVATGRCVSFNGTLKTCEVAAWCPVEDDT-EVPKPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTAYLKTCIYDA--KTDPFCPIFRLGKIVESAGHSFQDIAIEGGIMGIQIKWNCNLDRAASFCLPRYSFRRLDTRDLAHNVSPGYNFRFAKYYSDLKGAEHRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGVATVLCDVIVLYCMKKRYYYREKKYKYVEDYEQGLG 383          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q9JJX6|P2RX4_MOUSE (P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 4.104e-96
Identity = 165/380 (43.42%), Postives = 238/380 (62.63%), Query Frame = 1
Query:   55 LLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLN 1182
             LFEY+T +IV I S KVG++NR++QLLI+ Y++ WV + EKGYQE D+ VS++TTK KG+   N S     G   WD ADYVVP QE N+ F++TN ++T  Q+ G C E PD + + C +D++C   S+   +SG+ TG+C+ ++     CE+  WCPVEND+  +         EN+T+L+KN+I +PKF   +RN+L      +L +C +  N +   +CPI     I      + +++  EGG++ I I W CNLD     C P YSFRRLD  D   N++ G NFRF  YY+ +     R L KAYG+RF + V GKAGKF +IP  +N+GSGLALLG+A++LCD+IVL+ +  +  Y+  KY+ VE  E+ L+
Sbjct:   11 FLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQ---LGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPD-KTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDA-GVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIY--NARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCMKKRYYYRDKKYKYVEDYEQGLS 383          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|P51578|P2RX5_RAT (P2X purinoceptor 5 OS=Rattus norvegicus OX=10116 GN=P2rx5 PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 4.643e-91
Identity = 161/380 (42.37%), Postives = 231/380 (60.79%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKF-GLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENAN-IAKGLNFRFGHYYQI-NNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLN 1182
            LF+Y+T K V   S KVG++ R++QL+I+ Y++ WV +++K YQ+IDT + SA+ TKVKG+ + N +     G   WD AD+V+P Q  N FFV+TN ++TP Q  G+C E   + D  C  D DC    +++   G+ TG+CL       G CEI  WCPVE  S+P   +PL    E++T+ IKN I FPKF   + NVL+   K FL TC F + +    YCPI    +I +   A  + +  +GGV+ I I W C+LD     CNP Y F RLD+++ + I+ G NFRF  YY+  N    RDL+KAYG+RF V V GKAGKFS+IP  +N+GSGLAL+G  +  CD+++++L+     Y+  K+E V   ++  N
Sbjct:   13 LFDYKTAKFVVAKSKKVGLLYRVLQLIILLYLLIWVFLIKKSYQDIDTSLQSAVVTKVKGVAYTNTT---MLGERLWDVADFVIPSQGENVFFVVTNLIVTPNQRQGICAEREGIPDGECSEDDDCHAGESVVAGHGLKTGRCLRVGNSTRGTCEIFAWCPVETKSMP--TDPLLKDAESFTISIKNFIRFPKFNFSKANVLETDNKHFLKTCHFSSTNL---YCPIFRLGSIVRWAGADFQDIALKGGVIGIYIEWDCDLDKAASKCNPHYYFNRLDNKHTHSISSGYNFRFARYYRDPNGVEFRDLMKAYGIRFDVIVNGKAGKFSIIPTVINIGSGLALMGAGAFFCDLVLIYLIRKSEFYRDKKFEKVRGQKEDAN 384          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: Q65A65 (P2X ATP gated ion channel OS=Schistosoma mansoni OX=6183 GN=schP2X PE=2 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 9.118e-144
Identity = 212/392 (54.08%), Postives = 281/392 (71.68%), Query Frame = 1
Query:   37 MGKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCL-NYSKKFGLCEIRGWCPVENDSLPIKNEP-LFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIKTETTK 1206
            M KGI +LFEYET K+VQI++ K+GV  R++QL+I+ Y+VCWVMI EKGYQE D   SA+TTKVKG+GF N S  P  G+ +WD ADY+VPP ENNA FVITN V T RQS   C+ES  V +A C  DSDC+        +G  TGKC+       G CEI  WCP+END+LP+  +  LFPMV NYT+LIKNDI F KF + RRN+ +W+ KKFL TC +     E ++CPI  F TIF++ N  + +   GGV+ I+I W C+LDW+ ++CNP YSFRRLDD +A IA G NFR+ H+Y  N T +RDL+KAYG+RF++ V+G+AGKF ++PLTMN+GSGLALLGLA  +CDII L+LL S+++YQRAK+ET+ +++  L+  + +  +
Sbjct:    1 MVKGIAVLFEYETPKLVQISNIKIGVTQRLLQLVILIYVVCWVMIYEKGYQENDIAKSAVTTKVKGVGFTNFSHIPGIGMRSWDVADYIVPPLENNALFVITNLVKTERQSLSKCQESSWVPEAACYKDSDCKPYFISHLGNGAHTGKCIIKPGNDIGSCEIYSWCPLENDTLPLGRKSFLFPMVYNYTLLIKNDINFEKFGIHRRNIQNWASKKFLRTCLYNKTDPENRFCPIFQFGTIFEEANVDQSIFISGGVIGIDIDWKCDLDWDVQYCNPTYSFRRLDDAHAKIASGFNFRYAHFYSENGTNYRDLIKAYGIRFVIHVSGEAGKFHLLPLTMNIGSGLALLGLAPTVCDIIALNLLRSRDIYQRAKFETIAEEQAHLSSRRADKAQ 392          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: C1LKL9 (P2X purinoceptor 4 isoform 3 OS=Schistosoma japonicum OX=6182 GN=P2X4 PE=2 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 2.128e-143
Identity = 211/392 (53.83%), Postives = 279/392 (71.17%), Query Frame = 1
Query:   37 MGKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYS-KKFGLCEIRGWCPVENDSLPI-KNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIKTETTK 1206
            M KGI +LFEYET K+VQI++ K+GV  R++QL+I+ Y+VCWVMI EKGYQE D   SA+TTKVKG+GF N  + P  G+ +WD ADY+VPP ENNA FV+TN + T RQS   C ES  V  A C  DSDC+        +G  TGKC+  S    G CEI  WCP+END+LP+ K   LFPMV NYT+LIKNDI F KF + RRN+ +W+ KKFL +C +     E ++CPI  F TIF++ N  + +   GGV+ I+I W C+LDW+ ++CNP YSFRRLDD NA IA G NFR+ H+Y  N T +RDL+KAYG+RF++ V+G+AGKF  +PLTMN+GSGLALLGLA  +CDII L+LL S+++YQRAK+ET+ +++  L+  + +  +
Sbjct:    1 MVKGIAVLFEYETPKLVQISNIKIGVTQRLLQLVILIYVVCWVMIYEKGYQENDVAKSAVTTKVKGVGFTNFPNIPGIGMRSWDVADYIVPPLENNALFVVTNMIKTQRQSLSKCAESSFVPGAACHEDSDCKPYFITHLGNGAQTGKCIIESGSDIGSCEIYSWCPLENDTLPLDKKSFLFPMVYNYTLLIKNDINFEKFGIHRRNIQNWASKKFLRSCLYNKTDPENRFCPIFQFSTIFEEANVDESIFISGGVIGIDIDWKCDLDWDVQYCNPTYSFRRLDDANAKIAAGFNFRYAHFYSENGTNYRDLIKAYGIRFVIHVSGEAGKFHFLPLTMNIGSGLALLGLAPTVCDIIALNLLRSRDIYQRAKFETIAEEQAQLSSRRADKAE 392          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: C1LKL8 (p2X purinoceptor 4 OS=Schistosoma japonicum OX=6182 GN=P2X4 PE=2 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 3.503e-143
Identity = 211/392 (53.83%), Postives = 279/392 (71.17%), Query Frame = 1
Query:   37 MGKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYS-KKFGLCEIRGWCPVENDSLPI-KNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIKTETTK 1206
            M KGI +LFEYET K+VQI++ K+GV  R++QL+I+ Y+VCWVMI EKGYQE D   SA+TTKVKG+GF N  + P  G+ +WD ADY+VPP ENNA FV+TN + T RQS   C ES  V  A C  DSDC+        +G  TGKC+  S    G CEI  WCP+END+LP+ K   LFPMV NYT+LIKNDI F KF + RRN+ +W+ KKFL +C +     E ++CPI  F TIF++ N  + +   GGV+ I+I W C+LDW+ ++CNP YSFRRLDD NA IA G NFR+ H+Y  N T +RDL+KAYG+RF++ V+G+AGKF  +PLTMN+GSGLALLGLA  +CDII L+LL S+++YQRAK+ET+ +++  L+  + +  +
Sbjct:    1 MVKGIAVLFEYETPKLVQISNIKIGVTQRLLQLVILIYVVCWVMIYEKGYQENDVAKSAVTTKVKGVGFTNFPNIPGIGMRSWDVADYIVPPLENNALFVVTNMIKTQRQSLSKCAESSFVPGAACHEDSDCKPYFITHLGNGAQTGKCIIESGSDIGSCEIYSWCPLENDTLPLDKKSFLFPMVYNYTLLIKNDINFEKFGIHRRNIQNWASKKFLRSCLYNKTDPENRFCPIFQFSTIFEEANVDESIFISGGVIGIDIDWKCDLDWDVQYCNPTYSFRRLDDANAKIAAGFNFRYAHFYSENGTNYRDLIKAYGIRFVIHVSGEAGKFHFLPLTMNIGSGLALLGLAPTVCDIIALNLLRSRDIYQRAKFETIAEEQAQLSSRRADKAE 392          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: Q4QVH2 (ATP-gated channel subunit OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 1.066e-142
Identity = 211/392 (53.83%), Postives = 280/392 (71.43%), Query Frame = 1
Query:   37 MGKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCL-NYSKKFGLCEIRGWCPVENDSLPIKNEP-LFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIKTETTK 1206
            M KGI +LFEYET K+VQI++ K+GV  R++QL+I+ Y+VCWVMI EKGYQE D   SA+TTKVKG+GF N S  P  G+ +WD ADY+VPP  NNA FVITN V T RQS   C+ES  V +A C  DSDC+        +G  TGKC+       G CEI  WCP+END+LP+  +  LFPMV NYT+LIKNDI F KF + RRN+ +W+ KKFL TC +     E ++CPI  F TIF++ N  + +   GGV+ I+I W C+LDW+ ++CNP YSFRRLDD +A IA G NFR+ H+Y  N T +RDL+KAYG+RF++ V+G+AGKF ++PLTMN+GSGLALLGLA  +CDII L+LL S+++YQRAK+ET+ +++  L+  + +  +
Sbjct:    1 MVKGIAVLFEYETPKLVQISNIKIGVTQRLLQLVILIYVVCWVMIYEKGYQENDIAKSAVTTKVKGVGFTNFSHIPGIGMRSWDVADYIVPPLGNNALFVITNLVKTERQSLSKCQESSWVPEAACYKDSDCKPYFISHLGNGAHTGKCIIKPGNDIGSCEIYSWCPLENDTLPLGRKSFLFPMVYNYTLLIKNDINFEKFGIHRRNIQNWASKKFLRTCLYNKTDPENRFCPIFQFGTIFEEANVDQSIFISGGVIGIDIDWKCDLDWDVQYCNPTYSFRRLDDAHAKIASGFNFRYAHFYSENGTNYRDLIKAYGIRFVIHVSGEAGKFHLLPLTMNIGSGLALLGLAPTVCDIIALNLLRSRDIYQRAKFETIAEEQAHLSSRRADKAQ 392          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: C1LKM1 (p2X purinoceptor 4 OS=Schistosoma japonicum OX=6182 GN=P2X4 PE=2 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 2.963e-142
Identity = 210/392 (53.57%), Postives = 279/392 (71.17%), Query Frame = 1
Query:   37 MGKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYS-KKFGLCEIRGWCPVENDSLPI-KNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIKTETTK 1206
            M KGI +LFEYET K+VQI++ K+GV  R++QL+I+ Y+VCWVMI EKGYQE D   SA+TTKVKG+GF N  + P  G+ +WD ADY+VPP ENNA FV+TN + T RQS   C ES  V  A C  DSDC+        +G  TGKC+  S    G CEI  WCP+END+LP+ K   LFPMV NYT+LIKNDI F KF + RRN+ +W+ KKFL +C +     E ++CPI  F TIF++ N  + +   GGV+ I+I W C+LDW+ ++CNP YSFRRLDD NA IA G NFR+ ++Y  N T +RDL+KAYG+RF++ V+G+AGKF  +PLTMN+GSGLALLGLA  +CDII L+LL S+++YQRAK+ET+ +++  L+  + +  +
Sbjct:    1 MVKGIAVLFEYETPKLVQISNIKIGVTQRLLQLVILIYVVCWVMIYEKGYQENDVAKSAVTTKVKGVGFTNFPNIPGIGMRSWDVADYIVPPLENNALFVVTNMIKTQRQSLSKCAESSFVPGAACHEDSDCKPYFITHLGNGAQTGKCIIESGSDIGSCEIYSWCPLENDTLPLDKKSFLFPMVYNYTLLIKNDINFEKFGIHRRNIQNWASKKFLRSCLYNKTDPENRFCPIFQFSTIFEEANVDESIFISGGVIGIDIDWKCDLDWDVQYCNPTYSFRRLDDANAKIAAGFNFRYAYFYSENGTNYRDLIKAYGIRFVIHVSGEAGKFHFLPLTMNIGSGLALLGLAPTVCDIIALNLLRSRDIYQRAKFETIAEEQAQLSSRRADKAE 392          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 296.59 bits (758), Expect = 2.034e-95
Identity = 159/381 (41.73%), Postives = 230/381 (60.37%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQINNTPH-RDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEI 1188
             F+Y T K + I S  VG INR+ Q L+I YI+ +V + +KGYQ+ DT +S++TTKVKGI   N SD    G   WD ADY++PPQE N+FFV+TN  ITP Q+   C E+P   ++ C +D DC+K       SG+ TG+C+++S++   CE+  WCP+E    P  + P+    EN+TVLIKN + +PKF   RRN+L      +L  C F  +      CPI   + I  +     + +   GGV+ + I W C+LD    +C P Y+FRRLD  D   N+A G NFRF  YY+ +N    R L+K YG+RF + V GKAGKF+V+P  +N+G+GL L+GL +++CD  VL  +  +++Y+  KY  V+  + L NE+
Sbjct:   79 FFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSD---LGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPENPG-PESSCSSDQDCKKGFRNGRLSGVRTGRCVHFSERIKTCEVLAWCPLEKYDEP-PDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVFSRDTDPD--CPIFRLRDIVAEAGEDFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVLVFMRKRHLYRERKYSYVDDFQLLSNEV 452          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 291.582 bits (745), Expect = 8.796e-93
Identity = 156/372 (41.94%), Postives = 225/372 (60.48%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQINNTPH-RDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVE 1161
             F+Y T K + I S  VG INR+ Q L+I YI+ +V + +KGYQ+ DT +S++TTKVKGI   N SD    G   WD ADY++PPQE N+FFV+TN  ITP Q+   C E+P   ++ C +D DC+K       SG+ TG+C+++S++   CE+  WCP+E    P  + P+    EN+TVLIKN + +PKF   RRN+L      +L  C F  +      CPI   + I  +     + +   GGV+ + I W C+LD    +C P Y+FRRLD  D   N+A G NFRF  YY+ +N    R L+K YG+RF + V GKAGKF+V+P  +N+G+GL L+GL +++CD  VL  +  +++Y+  KY  V+
Sbjct:   79 FFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSD---LGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPENPG-PESSCSSDQDCKKGFRNGRLSGVRTGRCVHFSERIKTCEVLAWCPLEKYDEP-PDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVFSRDTDPD--CPIFRLRDIVAEAGEDFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVLVFMRKRHLYRERKYSYVD 443          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx8 (purinergic receptor P2X, ligand-gated ion channel, 8 [Source:ZFIN;Acc:ZDB-GENE-030319-7])

HSP 1 Score: 271.937 bits (694), Expect = 7.631e-87
Identity = 150/370 (40.54%), Postives = 220/370 (59.46%), Query Frame = 1
Query:   61 FEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSK-KFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTI-FKQINATKKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD-DENAN-IAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYE 1152
            F+Y+T+K V   + KVG++ R+IQL ++GYI+ WV + +KGYQE +  + S++ TKVKG+   N S     G   W   DYV+P Q  +  F+ TN + TP Q  G C ES  V D RC+ + DC +   ++  +G+ TG+CL   +   G CEI GWCP+E     I   PL    EN+T+ IKN I FPKF   + NVLD +G  +L TC ++A      YCPI     I  +  +  + +   GG + I I W C+LD  Y  C+P Y+F RLD +  AN ++ G NFR+ HY++      HR L+K YG+RF + V G+AGKF++IP  +N+GSGLAL+G  S  CD+++L+++    +Y+  K+E
Sbjct:   13 FDYKTEKYVIAKNKKVGILYRVIQLSLLGYIIGWVFLTKKGYQETEESIQSSVITKVKGVLLTNSSGT---GPRLWGPEDYVIPQQGEDVLFITTNFIETPNQKLGYCAESFKVLDGRCRKNEDCPEGEAVVAGNGVRTGRCLKKDRNSTGTCEIYGWCPIEKSQRLI--VPLLGKTENFTIYIKNFIRFPKFGFSKSNVLDTAGDSYLKTCLYDAIAHP--YCPIFRLGDIVLRSGHDFQDMALLGGSIGILIEWHCDLDKGYSHCHPRYTFTRLDFNSTANSVSSGYNFRYAHYFKNPAGETHRTLLKVYGIRFDIQVHGRAGKFNIIPTIINIGSGLALMGAGSFFCDMVLLYMMKKSTLYRERKFE 375          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx3b (purinergic receptor P2X 3 [Source:NCBI gene;Acc:103030692])

HSP 1 Score: 260.381 bits (664), Expect = 6.670e-82
Identity = 150/378 (39.68%), Postives = 214/378 (56.61%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCL---NYSKKFGLCEIRGWCPVENDSLPIKNEPLFPM--VENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVE 1161
             F YET K V + S  +G+INRI+QLLII Y + WV + EK YQ+ DT + S++ TKVKG G         +     D ADYV P Q  + F +IT  + T  Q  G C ES      +C+++ +C K  +   ++G+ TGKC+   N S     CEIRGWCP E D +PIK     PM  VEN+T+ IKN I FP+F   + N L      ++  C F+   ++  YCPI     + +  +     L+ +GGV+ I I W C+LD +   C P YSF RLD   E ++++ G NFRF  Y+   + T +R L+KAYG+RF V V G AGKFS+IP  +N+ +    +G+ ++LCDII+L+ L   + Y+  K+E V 
Sbjct:    8 FFTYETTKSVVVKSWTIGIINRIVQLLIISYFIGWVFLYEKAYQDRDTAIESSVMTKVKGFG--------EHHHKIMDVADYVTPTQGASVFCIITKLITTENQVQGKCPESES--KFKCQHNDNCTKLMSRPASNGLLTGKCVQQFNSSTSEKYCEIRGWCPAEIDDIPIK-----PMMEVENFTIFIKNSIRFPRFNFTKGNFLPTINSSYIKKCNFD--DKKNTYCPIFKVGDVVRLAHQNFTALVNKGGVIGIKISWVCDLDKSEDECKPAYSFTRLDAMSEKSSVSPGYNFRFAKYFMGQDGTEYRTLLKAYGIRFDVIVNGDAGKFSMIPTLINMVAAFTSVGVGAVLCDIILLNFLKGADQYKAKKFEEVS 368          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:ZFIN;Acc:ZDB-GENE-030319-5])

HSP 1 Score: 258.84 bits (660), Expect = 1.306e-80
Identity = 144/378 (38.10%), Postives = 216/378 (57.14%), Query Frame = 1
Query:   37 MGKGIGLLF----EYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENA---NIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQR 1140
            M +  G+ F    +Y+T+K V   + KVGV+ R+ QL +IGY++ WV + +K YQE +  + S++ TK+KG+   N ++    G+L W   DYV+P Q +  FF++TN + TP Q   VC ES  V D  C  D+DC +   +    G+ TG+C+N +   G CEI GWCPVE+   P   EPL    EN+T+ IKN I FPKF   + NVL  + K +L TC ++  H    YCPI     I +      +++  +GG + + I W C+LD +   CNP+YSF RLD       ++  G NFRF  YY+  +   +R L K YG+RF + V G+    S  P  +N+GSGLAL+G    +CD+I+L+++ + +  +R
Sbjct:    1 MAQSRGMFFYSLLDYKTEKFVIAKNKKVGVLFRLFQLGVIGYLIGWVFLWKKSYQEREEAIQSSVFTKLKGVALTNSTE---LGLLVWGAEDYVIPSQGDRVFFIVTNYLETPNQRLNVCAESVKVPDGLCSYDADCLEGETVTAGHGVKTGRCVNET---GTCEIYGWCPVESSRTP--QEPLLGKAENFTIYIKNFIRFPKFDFSKSNVLSTTNKSYLKTCNYDREHH--PYCPIFRVGDIVQWTGHNFQEMAVKGGSIGVEIDWTCDLDKDSSKCNPQYSFTRLDASKGSTNSVTSGYNFRFARYYRDSDGQTYRSLYKVYGIRFDIMVNGEVRPASYHPTVVNIGSGLALMGAGVFICDMILLYMMSTSSQKER 368          
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008095.1 (pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 gene:ENSPMAG00000007268.1 transcript:ENSPMAT00000008095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 299.671 bits (766), Expect = 4.851e-98
Identity = 163/386 (42.23%), Postives = 234/386 (60.62%), Query Frame = 1
Query:   31 LSMGKGIGLL----FEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDT-PVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKK-YCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQD 1167
            L+M +G G L    FEY+T+K++      VGV+ R++QL+I+ YI+ WV +V+KGYQE D  P +++ TKVKG+   N ++ P  G   WDTADYV+PPQ  + FFV+TN V TPRQ  G+C E+P+V  ARC+ D DC       T +G+ TG+C+  +    +CE+  WCPVEN   P   E +    EN+TV IK  + F +F V RRNVL+     +L +C F   H E+   CP+     +  +  A+   +   GGV+A+++ W C+LD +   C  +Y F RLD E + +A G NFRF  Y   +    R L+K YGVRF V V+GKAGKFS++P  +NLG+GLALLG  + LCD+ +L+       Y++ K+E  E+D
Sbjct:    1 LAM-QGCGALVCSAFEYKTEKLMIARDRSVGVVYRLMQLVILAYIIGWVFVVKKGYQETDPDPETSVITKVKGVALTNSTEGP--GQRLWDTADYVIPPQGESRFFVVTNLVSTPRQRQGLCAENPNVPGARCQEDGDCPAGRTFNTGNGICTGRCVPTNGTARVCEVHAWCPVENS--PTPREAVLREAENFTVFIKVSVNFTRFNVHRRNVLEEGDSSYLKSCEF---HPERSPLCPVFRLGELAVRAGASFSDMATRGGVIAVHLAWDCDLDRDLSACAAQYRFSRLDSERSRVAAGHNFRFARYSWQDGAETRSLLKVYGVRFDVMVSGKAGKFSIVPTLLNLGAGLALLGAGAFLCDLFLLYASKESPQYRQRKFERSEED 378          
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007719.1 (pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 gene:ENSPMAG00000006964.1 transcript:ENSPMAT00000007719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 4.690e-62
Identity = 136/366 (37.16%), Postives = 186/366 (50.82%), Query Frame = 1
Query:   67 YETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENAN--IAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYE 1152
            Y   K  +I S K  ++  ++ ++++     WV I   GYQE D  VS+ T KVKG              +  D ADYV+ P+E N+FFV+TN + TP Q  G C E PDV  A C +D+DC+         G+FTG C+  +     CE+  WCP+  DS P K+                            N+L  S   +L +CR+  + Q    CPI     I  +     K+L  EGGV +I I W CNLD N + C P Y FRRLD EN N  I+ G NFRF  YY+       R LVKAYG+RF+V V G+AGK S++   ++LGSG+ LLG+  ++CD+IVL       +Y+   YE
Sbjct:   16 YTITKKARIKSRKAAILTFLVFVMLVISYTGWV-IYTHGYQEFDGVVSSSTAKVKGA--------TEVTGMVMDAADYVISPEEPNSFFVMTNFIETPNQKQGACAEDPDV--APCSSDTDCRAGVTDPEGEGVFTGLCVPINNTTKSCEVNAWCPLPKDSNPPKH----------------------------NILG-SNASYLKSCRY--HRQSDPECPIFILGDIVSEAGEDFKELAIEGGVFSIMIEWNCNLDLNEQACKPNYKFRRLDKENRNKTISPGYNFRFPKYYKDAKGIETRTLVKAYGIRFMVEVIGQAGKASLLRSLISLGSGVGLLGMVWVICDLIVLFCCRKSRIYREQLYE 339          
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008762.1 (pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 gene:ENSPMAG00000007911.1 transcript:ENSPMAT00000008762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.652 bits (470), Expect = 5.297e-55
Identity = 117/324 (36.11%), Postives = 174/324 (53.70%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRD---ARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNV-LDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQI-NNTPHRDLVKAYGVRFLVFVTGK 1011
            +F Y  + ++ I +   G I+ +++++I+GY   +V+  E  Y+E +   SA+  KVKG       D P+ GV T+D+ADYVVP QE N FFV+TN ++T  Q+      +P+      + C+ND DC + ++    SG+ TG+C+ Y      CE+ GWCPVE  + P    PL P  EN TV I+N + F K   +R N  L+  GK  L +CR+    ++   CPI     I      +   +  +GG++AI I W C L  +   C P YSF RL D N    +G NFR   Y  +  +   R LVKA+G+RF + VTG+
Sbjct:   13 IFFYPRELVIGIENKYCGPIHMVVRIVILGYGARYVVGFEHAYREYEDVTSAVRVKVKGTA---KVDIPNEGVRTFDSADYVVPDQEPNTFFVMTNFIVTKNQTQVTTCCNPEAMKFSVSPCQNDGDCTRDASKHLGSGIQTGRCIRYDATCKSCEVMGWCPVERRTSP-PQPPLLPATENATVYIQNHVYFIKNNKERENFPLNLEGKD-LSSCRYHP--RDDPSCPIFRLGDITAMAGHSFSSMSVQGGIIAIVISWDCKL--SEVECFPAYSFHRL-DRNYTTKRGYNFRSLVYKSMETDVQTRTLVKAFGIRFNILVTGQ 326          
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000196.1 (pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gene:ENSPMAG00000000176.1 transcript:ENSPMAT00000000196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.115e-15
Identity = 36/99 (36.36%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  463 GMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQ 759
            G  TG+C+ + K    CE+  WCPVE +      + L    EN+T+LIKN+I FPKF V + N+ +   K FL +C     H     CPI + + I + 
Sbjct:    1 GEKTGRCVPFDKNVSTCEVNAWCPVEVEGKNT-GKRLLRSAENFTILIKNNIRFPKFNVSKGNLPENMDKNFLKSCHHHPKHNN--LCPIFSLRDILRS 96          
BLAST of p2X purinoceptor 4 vs. Ensembl Nematostella
Match: EDO41363 (P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S4Q4])

HSP 1 Score: 330.872 bits (847), Expect = 5.465e-110
Identity = 187/384 (48.70%), Postives = 253/384 (65.89%), Query Frame = 1
Query:   40 GKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSY----GVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGL--CEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDE 1170
            GK I  L EY T KIV I S KVG+INR+IQL IIGYI+ +V+I +KGYQE++ P S++TTK+KG  F N++ N S+    G   WD ADYV+PP+EN+AFFV TN VITP Q  G C ESPD+ + +C  D +C +        G  TGKC+   ++ G+  CE+  WCPVE D  P+   P FP ++N+TVLIKN ++FP F V +RN+   +    L +C+++ +      CPI   +TI K+      KL Y+GGV+ I I W C+ D     C P YSFRRLD+ NA IAKG NFR  +YY  N+T HR L KAYG+RF+V VTG+ GKF+V+PL +NLGSGLALL +A++LCD++VL++L  K  Y+  KY+ V ++ 
Sbjct:    6 GKVIDSLLEYNTSKIVHIKSKKVGLINRLIQLAIIGYIIGYVIIYKKGYQEVEKPYSSVTTKLKGTSFTNLTGNESFPLYGGPFVWDQADYVIPPEENDAFFVATNMVITPDQRQGTCPESPDIANVKCTRDENCTRMEETSYGHGFQTGKCVPSDQEKGIKVCEVFAWCPVELDITPM---PQFPSLKNFTVLIKNTVQFPSFGVSKRNIAPDADTSTLKSCQYDKD--TSPLCPIFRLETITKEAGQDFNKLAYKGGVIGIIITWNCDFDSLLYSCKPVYSFRRLDNANAPIAKGYNFRHANYYVKNDTLHRTLFKAYGIRFVVTVTGQGGKFNVVPLFLNLGSGLALLSIATVLCDVVVLYVLRRKEFYREKKYQYVVENS 384          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx5 (P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001])

HSP 1 Score: 272.707 bits (696), Expect = 4.668e-86
Identity = 144/371 (38.81%), Postives = 220/371 (59.30%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQI-NATKKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD-DENANIAKGLNFRFGHYYQIN-NTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETV 1158
            L  Y+T+K V   + ++G++ R+ QL ++GYI+ WV +V+KGYQE +  V +++ TKVKG+   N S    Y    W   DYV+PP     FF++TN + TP Q  G C ESP V +  C++D DC +  ++    G+ TG CLN +   G CEI  WCPVE+   P   E L    EN+T+ IKN I FPKF   + NVL+ S   +L  C ++   +   YCPI   + + +   N  + +  +GG V I I W C+LD +   CNP YSF RLD + N++I  G NFR   YY+      +R L K YG+RF + + G+AGKF+++P  + +GSG+AL+G+ + +CD+I+L+++ + + Y+  K+E +
Sbjct:   11 LLNYKTEKYVIAENRRIGILFRLYQLAVLGYIIGWVFVVKKGYQEKEEAVQTSVITKVKGVSLINSSQTGPY---LWSAEDYVIPPNGEQVFFIVTNYIETPNQRLGFCAESPKVPNGMCQSDEDCLEGESIAAGHGIMTGLCLNST---GTCEIYAWCPVEHSKRP--TEALLSEAENFTIYIKNFIRFPKFEFSKSNVLETSDDSYLKKCSYD--RENHPYCPIFRLRDLVRNTGNDFQDMAAKGGSVGILIEWNCDLDKDSSECNPRYSFTRLDMNLNSSITSGYNFRHARYYKDEKGETYRTLYKVYGIRFDIMINGQAGKFNIVPTIIAIGSGVALMGIGAFVCDMILLYMMNTSSFYRERKFEII 371          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx3b (purinergic receptor P2X 3 [Source:NCBI gene;Acc:101174325])

HSP 1 Score: 261.536 bits (667), Expect = 1.942e-82
Identity = 150/375 (40.00%), Postives = 210/375 (56.00%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPM--VENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLD--DENANIAKGLNFRFGHYYQI-NNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVE 1161
             F YET K V + S  +G+INR++QLLII Y + WV + EK YQ IDT + S++ TKVKG G  N            D ADYV P Q  + F +IT  + T  Q  G+C ES   +   C NDSDC    N     G+ TG+C++++     CEI+GWCP E D++ I      PM  VEN+T+ IKN I FPKF   + N L    + ++  C F+  +    YCPI     +    +    KL  +GGV+ I I W C+LD + + C P YSF RLD   +   ++ G NFRF  YY++ N T +R L+KAY +RF V V G AGKF++IP  +N+ +    +G+ ++LCDII+L+ L     Y+  K+E V 
Sbjct:    8 FFTYETTKSVVVKSWTIGIINRVVQLLIITYFIGWVFLCEKAYQIIDTAIESSVMTKVKGFGVHNGQ--------VMDVADYVTPTQGASVFCIITKTITTENQVQGLCPESE--KRWICYNDSDCNPQRNKPGDYGILTGRCVSFNDTKKTCEIKGWCPAEIDTVKIT-----PMMEVENFTIFIKNSIRFPKFNYTKGNFLPSINRTYIKKCNFDKVNNT--YCPIFRVGDVVHYADQDFSKLADKGGVIGIKISWMCDLDKSDEHCKPSYSFNRLDTMSQKNEVSPGYNFRFAKYYKMENGTDYRTLIKAYAIRFDVIVNGNAGKFNMIPTLINMVAAFTSVGVGTVLCDIILLNFLKGAEQYKAKKFEEVS 365          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx3a (P2X purinoceptor 3 [Source:NCBI gene;Acc:101165153])

HSP 1 Score: 253.062 bits (645), Expect = 3.443e-79
Identity = 154/376 (40.96%), Postives = 200/376 (53.19%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPV-SAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYE-GGVVAINIHWACNLDWNYKFCNPEYSFRRLDDE--NANIAKGLNFRFGHYYQI-NNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQDE 1170
             F YET K V + S  VG+INRI+QLLII Y V WV I EK YQ IDT + S++ TKVKG G  N            D ADYV PPQ +  F ++T  ++T  Q  G C ES    +  C  D DC    N + ++G+ TG C N S   G CEI GWCP END   + N     ++ N+T+ IKN I FP F V R N       + +  C +   H     CPI     +          L E GG + INI W CN D + + C P+YSF RLD       ++KG NFRF  YY+  N T  R L KA+ +RF V VTG AGKFS IP  +NL +    +GL +++CDII+L+ L     Y+  K+E V + +
Sbjct:   15 FFTYETTKSVVVKSWSVGIINRIVQLLIITYFVGWVFIHEKAYQVIDTGIESSVMTKVKGFGRLNHQ--------VMDVADYVYPPQGSGIFCIMTRIIVTEDQFQGRCAESQP--NFNCSTDEDCYLHKNTLLSNGVITGVCRNESG--GRCEIEGWCPAENDD--VTNSTTLDVL-NFTIFIKNSIRFPLFNVTRGNFPSSMTSEMIKNCVYHPEHNPS--CPIFRVGDVLNYTGQDLTSLTEKGGEIGINIEWKCNFDRDIELCVPKYSFTRLDAPFMKNQVSKGYNFRFAKYYKTENGTEFRTLHKAFAIRFDVMVTGNAGKFSTIPTLINLVAAFTSIGLGTVICDIILLNFLKGAKQYKAKKFEEVSESQ 373          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx4b (purinergic receptor P2X 4 [Source:NCBI gene;Acc:101168548])

HSP 1 Score: 254.218 bits (648), Expect = 5.409e-79
Identity = 153/369 (41.46%), Postives = 222/369 (60.16%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSD-NPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDS-LPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENA--NIAKGLNFRFGHYYQ-INNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAK 1146
            +F+YET K + I    VG++ R  QLL++ Y+V +V +V+KGYQE D+ +S +TTKVKG  + N SD +P      WD ADYV+PPQ +++FF++TN V+TP Q+   C E P+     CK+D DC +  N    +G+ TG C N+S     CE+  WCP+E D+ LP K   L    EN+TVLIKN I +PKF    RN+L      +L  C F  N      CPI   K I  +  A  +++  +GG++ I I W+C+LDW    C P+YSF RLD++N   ++A G NFRF  +Y+  +    R L+KAYG+RF V V G AGKF ++P  +NLG+ L+ L L  I+ D ++L  +  +++Y + K
Sbjct:   14 VFDYETAKTLVIPHFGVGIVFRFTQLLVVLYVVGYVCVVQKGYQETDSVISTVTTKVKGFAYTNTSDMDPR----MWDVADYVIPPQGDSSFFILTNLVVTPEQTQSHCPELPNPSTV-CKDDCDCIEGYNDPRRNGIRTGLCENFSTTVKTCEVFSWCPLEVDTRLPKK--ALLAAAENFTVLIKNSITYPKFNFHGRNILPHVNSSYLAHCEF--NRLTDPDCPIFRLKRIISEAEADFQEMAVKGGILGILIDWSCDLDWWAGKCLPKYSFHRLDNQNQGNDVAPGYNFRFAKFYKRADGVEERTLIKAYGIRFEVIVFGTAGKFGIVPAIVNLGAALSFLSLVPIVADWVMLTCMRKRDLYTKQK 373          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 244.202 bits (622), Expect = 4.972e-76
Identity = 146/394 (37.06%), Postives = 222/394 (56.35%), Query Frame = 1
Query:   55 LLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGV-LTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINAT-KKLLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRL-------DDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKY---ETVEQDEKL-LNEIKTE 1197
              FEYET + V + + +VGV+ R+IQL ++ YI+ WV I EKGYQ  +T VS++ TKVKG+G  N+S     GV   WD +DYV PPQ +++F V+TN ++T  Q+ G C E P      CK+D+DC+  +   T  G  TG C+  +K    CE+  WCP+E+D   I N PL    EN+T+ IKN + FP F + R N+++    K +  C F+ ++     CPI     I K    T + +  +GG + + I W CN D++ K C P+Y F  L       D   A++  G NFR+  YY  +    R L+K +G+RF + V     KF +IP    +GSG+ + G+A+++CD+++L++L  ++ Y+  K+   +T  QD  L    IKT 
Sbjct:   12 FFFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNIS-----GVERVWDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPELPG--RYICKSDTDCKGGTYNRTVDGKLTGVCVKETKT---CELLAWCPLEDDR-NIPNPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSP--LCPIFKLGDIVKLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASV--GYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRDFYKNMKFKYTDTAAQDPDLDTGSIKTS 390          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000020579.1 (SMESG000020579.1)

HSP 1 Score: 435.647 bits (1119), Expect = 1.425e-153
Identity = 209/210 (99.52%), Postives = 209/210 (99.52%), Query Frame = 1
Query:  166 MIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYEGG 795
            MIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYE G
Sbjct:    1 MIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLYEVG 210          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000010795.1 (SMESG000010795.1)

HSP 1 Score: 365.155 bits (936), Expect = 1.139e-121
Identity = 186/373 (49.87%), Postives = 254/373 (68.10%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCL--NYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLY-EGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQD 1167
            +FEYET K+VQI S KVG+I R+ QL II YI  WVM +EKGYQ  D PV+ +T K+KGI F N+S     G + WD AD+VVPPQ+N+AFFV TN VIT  Q+ G C ES DV    CK+DSDC K   + T SG+ TG+C+  +      +CEI GWCP END +PI  +PL     N+TVL+KN IEFPKF+VKRRN+L W  KKFL +CR++  H   K+CPI   K +    NA  K ++  G +++I+I W CNLD NY+ C PEY+FRRLDD + ++ KG NFR+  +Y  N    R L+K YG++  + V+G+ GKF+    +MNLGSGLALLG+AS+LCD++VL+++  ++ Y+RA+ +  +++
Sbjct:   15 IFEYETSKVVQIRSWKVGIIYRLTQLGIILYIALWVMYLEKGYQVFDYPVAGVTAKLKGIAFANLSKT---GAIVWDVADFVVPPQQNSAFFVSTNMVITANQTLGRCPESTDVHGVTCKSDSDCIKNRIIHTGSGVITGRCVLSDIKNDTKVCEIYGWCPTENDVMPIPGQPLLSSAPNFTVLLKNSIEFPKFKVKRRNILTWMDKKFLNSCRYDPKHWRNKFCPIFQLKDLINFSNAKNKNIWTHGALISIHIEWNCNLDINYEKCVPEYTFRRLDDFDFDVGKGWNFRYSEHYYENGVEKRTLIKTYGIQCFITVSGRGGKFNPFAFSMNLGSGLALLGIASVLCDLVVLNIVRKRDFYKRARIDQFQKE 384          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000079250.1 (SMESG000079250.1)

HSP 1 Score: 364.77 bits (935), Expect = 6.408e-121
Identity = 182/372 (48.92%), Postives = 257/372 (69.09%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGL--CEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLY-EGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQ 1164
            +FEYET K+VQI S K+G I R+IQL II Y+  WVM  EKGYQ  D PV+ +T K+KGI F N+++  S G+  WDTAD+V+PPQ+N+AFFV TN VITP QS G C ES DV    C NDS C  +  +   SG+ TGKC+  +K  G+  CEI GWCP E+D +P+ N  L     N+TVL+KN IEF  F++KRRN+L W  KKFLY+CR+  +H+  K+CPI   K I K  +A  + ++  GG+++I+I W C+LD++ + C PEY+FRRLDD   ++ KG NFR+ ++Y  N T  R L+K YG++F + V+G+ GKF+    +MNLGSGLALLG+AS+LCD+ VL+++  + +Y++A+ ++ + 
Sbjct:   15 IFEYETSKVVQIKSWKIGFIYRLIQLAIILYVSLWVMYNEKGYQIFDYPVAGVTAKLKGIAFANLTNISSIGMRVWDTADFVIPPQQNSAFFVATNMVITPNQSLGNCDESTDVYGVICVNDSQCVYSKPIHIGSGIQTGKCVESTKIKGIKVCEIYGWCPTEHDRMPLHNRSLLSSAPNFTVLLKNSIEFTAFKIKRRNILKWMDKKFLYSCRYNPHHKRHKFCPIFRLKDIVKYSDAKNQNIWTHGGLMSIHIEWNCDLDFDVENCVPEYTFRRLDDFKEDVGKGWNFRYSYHYVENGTEKRTLIKVYGIQFFITVSGRGGKFNPFKFSMNLGSGLALLGIASVLCDLFVLNIVRKRELYKKARVDSFKS 386          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000044174.1 (SMESG000044174.1)

HSP 1 Score: 363.614 bits (932), Expect = 1.306e-119
Identity = 181/372 (48.66%), Postives = 257/372 (69.09%), Query Frame = 1
Query:   58 LFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGL--CEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLY-EGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQ 1164
            +FEYET K+VQI S K+G I R+IQL II Y+  WVM  EKGYQ  D PV+ +T K+KGI F N+++  S G+  WDTAD+V+PPQ+N+AFFV TN VITP QS G C ES DV    C NDS C  +  +   SG+ TGKC+  +K  G+  CEI GWCP E+D +P+ N  L     N+TVL+KN IEF  F++KRRN+L W  +KFLY+CR+  +H+  K+CPI   K I K  +A  + ++  GG+++I+I W C+LD++ + C PEY+FRRLDD   ++ KG NFR+ ++Y  N T  R L+K YG++F + V+G+ GKF+    +MNLGSGLALLG+AS+LCD+ VL+++  + +Y++A+ ++ + 
Sbjct:   90 IFEYETSKVVQIKSWKIGFIYRLIQLAIILYVSLWVMYNEKGYQIFDYPVAGVTAKLKGIAFANLTNISSIGMRVWDTADFVIPPQQNSAFFVATNMVITPNQSLGNCDESTDVYGVICVNDSQCVYSKPIHIGSGIQTGKCVESTKIKGIKVCEIYGWCPTEHDRMPLHNRSLLSSAPNFTVLLKNSIEFTAFKIKRRNILKWMDRKFLYSCRYNPHHKRHKFCPIFRLKDIVKYSDAKNQNIWTHGGLMSIHIEWNCDLDFDVENCVPEYTFRRLDDFKEDVGKGWNFRYSYHYVENGTEKRTLIKVYGIQFFITVSGRGGKFNPFKFSMNLGSGLALLGIASVLCDLFVLNIVRKRELYKKARVDSFKS 461          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000028996.1 (SMESG000028996.1)

HSP 1 Score: 313.153 bits (801), Expect = 9.925e-103
Identity = 175/380 (46.05%), Postives = 251/380 (66.05%), Query Frame = 1
Query:   49 IGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGYQEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFVITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCLNYSKKFGLCEIRGWCPVEN---DSLPIKNEPLFPMVENYTVLIKNDIEFPKFRVKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKK----LLYEGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYYQINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNXXXXXXXXXXXXILCDIIVLHLLGSKNVYQRAKYETVEQD 1167
            I ++ EYET KIV I + K+G+I R IQL+I+ Y++ +V++ +KGYQE +  +SA+ +KVKG+   N S   + G   WD ADYV+PPQE NAFF+ +NA+IT +Q+ G C E  +   A+CK ++DC     +I   G+ TG C+N       CE+  WCPVE+   DS  +K  PL   V N+TV IKN+IEF KF+V R N+     K  L +CR+ +++ +   CPI     I   +N T K    +L  GGV++ +I+W CNLD + + C P YSF RLD ++  +AKG NFR  +YY IN T +RDL+KAYG+RF++ V+ KAGKFS+IPLTMNLGSGLALL +A+I+CD IVL++L +++ Y  AKY  ++++
Sbjct:   11 ISVIIEYETVKIVSIKNKKIGLIFRFIQLVILSYVIGYVIVYKKGYQETEPGISAVISKVKGVSLTNRSF--AGGETIWDVADYVIPPQEENAFFITSNALITKKQTQGKCPEDKNTVGAQCKTNADCVPLEPIILGDGVKTGVCINNQT----CEVYAWCPVESSAEDSKTVK-LPLLNNVNNFTVYIKNNIEFRKFKVFRSNIPSNFNKSMLSSCRYSSSNTK---CPIFQIGMI---LNLTGKSYDDILKTGGVISFSINWDCNLDVSLENCFPTYSFNRLDSDDIKLAKGWNFRHANYYYINETQYRDLIKAYGIRFVISVSSKAGKFSIIPLTMNLGSGLALLAIATIICDFIVLYILRNRSKYIEAKYHLIDEE 377          
The following BLAST results are available for this feature:
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2RX42.780e-10043.42purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX44.638e-9641.92purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX41.530e-9142.47purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX53.010e-9038.60purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:... [more]
P2RX5-TAX1BP35.639e-9038.60P2RX5-TAX1BP3 readthrough (NMD candidate) [Source:... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx51.403e-9542.13purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx51.403e-9542.13purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4b1.488e-9341.49purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a2.811e-9242.41purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a2.649e-8941.43purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000000163.13.308e-9942.71purinergic receptor P2X, ligand gated ion channel,... [more]
ENSXETT00000000415.11.096e-9642.45purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx51.623e-9642.49purinergic receptor P2X, ligand gated ion channel,... [more]
ENSXETT00000000980.12.935e-9642.08purinergic receptor P2X, ligand gated ion channel,... [more]
ENSXETT00000000402.17.519e-9642.45purinergic receptor P2X, ligand gated ion channel,... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2rx47.359e-9743.31purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx57.449e-9441.54purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx42.752e-8839.37purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx41.390e-8440.94purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx54.442e-8439.20purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99571|P2RX4_HUMAN1.335e-9943.42P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX... [more]
sp|P51577|P2RX4_RAT1.077e-9643.95P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q5E9U1|P2RX4_BOVIN1.187e-9643.57P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 ... [more]
sp|Q9JJX6|P2RX4_MOUSE4.104e-9643.42P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2r... [more]
sp|P51578|P2RX5_RAT4.643e-9142.37P2X purinoceptor 5 OS=Rattus norvegicus OX=10116 G... [more]
back to top
BLAST of p2X purinoceptor 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q65A659.118e-14454.08P2X ATP gated ion channel OS=Schistosoma mansoni O... [more]
C1LKL92.128e-14353.83P2X purinoceptor 4 isoform 3 OS=Schistosoma japoni... [more]
C1LKL83.503e-14353.83p2X purinoceptor 4 OS=Schistosoma japonicum OX=618... [more]
Q4QVH21.066e-14253.83ATP-gated channel subunit OS=Schistosoma mansoni O... [more]
C1LKM12.963e-14253.57p2X purinoceptor 4 OS=Schistosoma japonicum OX=618... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx4a2.034e-9541.73purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a8.796e-9341.94purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx87.631e-8740.54purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx3b6.670e-8239.68purinergic receptor P2X 3 [Source:NCBI gene;Acc:10... [more]
p2rx51.306e-8038.10purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008095.14.851e-9842.23pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 g... [more]
ENSPMAT00000007719.14.690e-6237.16pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 g... [more]
ENSPMAT00000008762.15.297e-5536.11pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 ... [more]
ENSPMAT00000000196.11.115e-1536.36pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gen... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413635.465e-11048.70P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx54.668e-8638.81P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001... [more]
p2rx3b1.942e-8240.00purinergic receptor P2X 3 [Source:NCBI gene;Acc:10... [more]
p2rx3a3.443e-7940.96P2X purinoceptor 3 [Source:NCBI gene;Acc:101165153... [more]
p2rx4b5.409e-7941.46purinergic receptor P2X 4 [Source:NCBI gene;Acc:10... [more]
p2rx14.972e-7637.06purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020579.11.425e-15399.52SMESG000020579.1[more]
SMESG000010795.11.139e-12149.87SMESG000010795.1[more]
SMESG000079250.16.408e-12148.92SMESG000079250.1[more]
SMESG000044174.11.306e-11948.66SMESG000044174.1[more]
SMESG000028996.19.925e-10346.05SMESG000028996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022519 ID=SMED30022519|Name=p2X purinoceptor 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1435bp
CAAAATTTCAAAAGAAATCATAAATTATAATTATCGATGGGAAAAGGAAT
TGGTTTACTTTTTGAATATGAAACTCAAAAGATCGTACAAATTAATAGCA
CAAAGGTCGGAGTTATTAATAGAATTATTCAACTTTTAATAATAGGTTAC
ATCGTTTGTTGGGTAATGATTGTAGAAAAAGGTTATCAGGAAATAGATAC
TCCAGTTAGTGCAATCACCACGAAGGTTAAAGGAATAGGATTTAGAAACG
TATCTGATAATCCATCATACGGAGTGCTAACCTGGGACACGGCGGATTAT
GTTGTACCCCCTCAGGAAAACAATGCATTTTTTGTCATAACAAACGCTGT
GATTACCCCAAGACAATCGCCAGGAGTCTGCAGAGAAAGTCCAGATGTTC
GAGACGCTCGGTGCAAAAACGACAGTGATTGTCAAAAAGCCAGTAATTTA
ATCACAGCCTCTGGGATGTTTACTGGAAAATGCTTAAACTATTCAAAGAA
ATTTGGATTGTGTGAAATCCGAGGTTGGTGTCCAGTTGAAAATGATTCTC
TCCCAATAAAGAACGAGCCGCTTTTTCCCATGGTAGAAAACTATACAGTT
CTTATTAAAAACGATATCGAATTTCCAAAATTCCGAGTGAAAAGGAGAAA
TGTTTTGGACTGGTCGGGGAAAAAATTTCTTTATACTTGTAGATTCGAGG
CCAATCATCAAGAGAAAAAGTACTGTCCGATAATAACCTTCAAAACAATC
TTCAAGCAGATAAATGCGACTAAAAAACTGTTATATGAGGGAGGAGTGGT
GGCAATTAATATTCATTGGGCATGCAATCTAGACTGGAACTACAAATTTT
GCAATCCTGAATATTCTTTCAGAAGATTAGATGATGAAAATGCAAACATT
GCAAAAGGCCTAAATTTCAGATTCGGACATTATTACCAAATAAATAACAC
GCCACATCGAGATTTGGTAAAGGCCTATGGAGTAAGGTTTTTGGTGTTCG
TCACGGGAAAGGCTGGGAAATTTAGTGTCATTCCATTAACAATGAATCTA
GGATCAGGTTTAGCGTTATTAGGTTTGGCGTCAATTCTATGTGACATAAT
CGTGCTGCATTTATTGGGATCAAAGAATGTCTATCAAAGAGCCAAATATG
AAACTGTAGAACAAGACGAAAAGCTTTTGAACGAAATCAAAACGGAAACG
ACGAAAACATTTTTAGCGCCGGACAACAAAATCGAGCTGGCAATGTGAAT
AATTAAAGCTATCATTTAACATTCCTATATTTACAAAATTTTGTTTTGTG
TTTAAATTTGCTATTTATATAATTGCTGATGAAAAATGATGAGATGATAA
TATGAAATATCAATATTGACAAAAATGTAACAGAAAATAACTTTTTTAAT
TTTGTGATTAAGCATCAAAGTTTGTTAATATTATT
back to top

protein sequence of SMED30022519-orf-1

>SMED30022519-orf-1 ID=SMED30022519-orf-1|Name=SMED30022519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=404bp
MGKGIGLLFEYETQKIVQINSTKVGVINRIIQLLIIGYIVCWVMIVEKGY
QEIDTPVSAITTKVKGIGFRNVSDNPSYGVLTWDTADYVVPPQENNAFFV
ITNAVITPRQSPGVCRESPDVRDARCKNDSDCQKASNLITASGMFTGKCL
NYSKKFGLCEIRGWCPVENDSLPIKNEPLFPMVENYTVLIKNDIEFPKFR
VKRRNVLDWSGKKFLYTCRFEANHQEKKYCPIITFKTIFKQINATKKLLY
EGGVVAINIHWACNLDWNYKFCNPEYSFRRLDDENANIAKGLNFRFGHYY
QINNTPHRDLVKAYGVRFLVFVTGKAGKFSVIPLTMNLGSGLALLGLASI
LCDIIVLHLLGSKNVYQRAKYETVEQDEKLLNEIKTETTKTFLAPDNKIE
LAM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0001614purinergic nucleotide receptor activity
GO:0004931extracellular ATP-gated cation channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001429P2X_purnocptor
IPR027309P2X_extracellular_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
Vocabulary: biological process
TermDefinition
GO:0098655cation transmembrane transport
GO:0033198response to ATP
GO:0035590purinergic nucleotide receptor signaling pathway
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001429P2X purinoreceptorPRINTSPR01307P2XRECEPTORcoord: 290..300
score: 56.52
coord: 81..89
score: 57.49
coord: 157..168
score: 63.77
coord: 309..323
score: 51.3
coord: 245..257
score: 34.45
IPR001429P2X purinoreceptorTIGRFAMTIGR00863TIGR00863coord: 7..371
e-value: 1.1E-127
score: 423.9
IPR001429P2X purinoreceptorPIRSFPIRSF005713P2X_purinoceptorcoord: 1..398
e-value: 3.3E-137
score: 455.2
IPR027309P2X purinoreceptor extracellular domain superfamilyGENE3DG3DSA:2.60.490.10coord: 52..328
e-value: 2.8E-123
score: 413.1
NoneNo IPR availablePFAMPF00864P2X_receptorcoord: 9..378
e-value: 1.8E-137
score: 458.4
NoneNo IPR availableGENE3DG3DSA:1.10.287.940coord: 32..353
e-value: 2.8E-123
score: 413.1
NoneNo IPR availablePANTHERPTHR10125P2X PURINOCEPTORcoord: 6..385
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 338..360