SMED30022511

Overview
NameSMED30022511
Smed IDSMED30022511
Length (bp)2387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022511 (SMED30022511) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022511 (SMED30022511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022511 (SMED30022511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022511 (SMED30022511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022511 SmedASXL_030063SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
testisSMED30022511 Contig2347newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30022511 vs. Ensembl Human
Match: CDKAL1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:21050])

HSP 1 Score: 70.8626 bits (172), Expect = 2.295e-14
Identity = 38/93 (40.86%), Postives = 56/93 (60.22%), Query Frame = -2
Query:   41 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFEAE------SYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS 295
            +LL DIE+++S  D   +D+  V  DV+   ++ RN +    E E      S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++
Sbjct:    8 TLLDDIEDIVSQEDSKPQDRHFVRKDVV-PKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKIT 95          
BLAST of SMED30022511 vs. Ensembl Human
Match: CDKAL1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:21050])

HSP 1 Score: 72.4034 bits (176), Expect = 1.829e-12
Identity = 40/97 (41.24%), Postives = 58/97 (59.79%), Query Frame = -2
Query:   29 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFEAE------SYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGS 295
            +LL DIE+++S  D   +D+  V  DV+   ++ RN +    E E      S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++ N S
Sbjct:    8 TLLDDIEDIVSQEDSKPQDRHFVRKDVV-PKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKITENAS 99          
BLAST of SMED30022511 vs. Ensembl Human
Match: CDKAL1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:21050])

HSP 1 Score: 72.4034 bits (176), Expect = 1.829e-12
Identity = 40/97 (41.24%), Postives = 58/97 (59.79%), Query Frame = -2
Query:   29 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFEAE------SYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGS 295
            +LL DIE+++S  D   +D+  V  DV+   ++ RN +    E E      S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++ N S
Sbjct:    8 TLLDDIEDIVSQEDSKPQDRHFVRKDVV-PKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKITENAS 99          
BLAST of SMED30022511 vs. Ensembl Celegans
Match: Y92H12BL.4 (pep chromosome:WBcel235:I:1376942:1385057:-1 gene:WBGene00022365.1 transcript:Y92H12BL.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y92H12BL.4)

HSP 1 Score: 49.6766 bits (117), Expect = 5.515e-6
Identity = 22/45 (48.89%), Postives = 32/45 (71.11%), Query Frame = -2
Query:   44 ESYVPGT-HHIYIQTWGCSHNSSDSEYMAGIM--AGILSKYGFKV 169
            +S VPG    ++++TWGCSHN+SDSEYM+G++  AG     GF +
Sbjct:   40 DSMVPGVGQKVWVRTWGCSHNTSDSEYMSGLLQQAGYDVVKGFSI 84          
BLAST of SMED30022511 vs. Ensembl Fly
Match: CG6550 (gene:FBgn0034214 transcript:FBtr0086961)

HSP 1 Score: 63.1586 bits (152), Expect = 7.256e-10
Identity = 39/113 (34.51%), Postives = 62/113 (54.87%), Query Frame = -2
Query:    2 DIENLISNSDDEDK-RIVPTDVILTHLKNRN---VENAQFEA-------ESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS--------LNGSCSLKGDGDE 283
            DIE+LIS  D + + R      +    K R+   +E+ + E        ES +PGT  ++++TWGC+HN+SDSEYMAG +A     YG+++S        L  SC++K   ++
Sbjct:   15 DIEDLISADDVKPRERYENKKTVTVRAKKRSQIRLESQEEEEKPKPTIHESVIPGTQKVFVKTWGCAHNNSDSEYMAGQLAA----YGYRLSGKEEADLWLLNSCTVKNPSED 123          
BLAST of SMED30022511 vs. Ensembl Zebrafish
Match: CABZ01090785.1 (pep chromosome:GRCz11:16:1471:4245:1 gene:ENSDARG00000110572.1 transcript:ENSDART00000181972.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01090785.1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.569e-10
Identity = 26/76 (34.21%), Postives = 45/76 (59.21%), Query Frame = -2
Query:   74 SLLPDIENLISNSDDE--DKRIVPTDVILTHLKNRNVENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMA 295
            + + DIE+++  +D     ++     V+    K++     Q + +S +PG   ++++TWGCSHNSSD EYMAG +A
Sbjct:   11 TAVDDIEDMVRITDVTPLQRQAARKSVVPRARKHKQETGEQMQTDSVIPGMQKVWLKTWGCSHNSSDGEYMAGQLA 86          
BLAST of SMED30022511 vs. Ensembl Xenopus
Match: cwf19l1 (CWF19 like cell cycle control factor 1 [Source:Xenbase;Acc:XB-GENE-995269])

HSP 1 Score: 70.8626 bits (172), Expect = 4.806e-12
Identity = 42/111 (37.84%), Postives = 62/111 (55.86%), Query Frame = -2
Query:    2 SLLPDIENLISNSDDED-KRIVPTDVILTHLKNRNVENAQFE---AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 295
            SLL DIE+++S +D +   R      I+   + RN    Q E   A+S +PGT  I+I+TWGCSHN+SD EYMAG +A     YG+ ++         L  SC++K   ++
Sbjct:   18 SLLDDIEDIVSATDPKPHDRQNARQNIVPRARKRNKNKIQEEEPPADSTIPGTQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYSITEQPEQADLWLLNSCTVKSPAED 124          
BLAST of SMED30022511 vs. Ensembl Xenopus
Match: cwf19l1 (CWF19 like cell cycle control factor 1 [Source:Xenbase;Acc:XB-GENE-995269])

HSP 1 Score: 70.4774 bits (171), Expect = 5.189e-12
Identity = 42/111 (37.84%), Postives = 62/111 (55.86%), Query Frame = -2
Query:    2 SLLPDIENLISNSDDED-KRIVPTDVILTHLKNRNVENAQFE---AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 295
            SLL DIE+++S +D +   R      I+   + RN    Q E   A+S +PGT  I+I+TWGCSHN+SD EYMAG +A     YG+ ++         L  SC++K   ++
Sbjct:    7 SLLDDIEDIVSATDPKPHDRQNARQNIVPRARKRNKNKIQEEEPPADSTIPGTQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYSITEQPEQADLWLLNSCTVKSPAED 113          
BLAST of SMED30022511 vs. Ensembl Xenopus
Match: cwf19l1 (CWF19 like cell cycle control factor 1 [Source:Xenbase;Acc:XB-GENE-995269])

HSP 1 Score: 70.4774 bits (171), Expect = 5.652e-12
Identity = 42/111 (37.84%), Postives = 62/111 (55.86%), Query Frame = -2
Query:    2 SLLPDIENLISNSDDED-KRIVPTDVILTHLKNRNVENAQFE---AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 295
            SLL DIE+++S +D +   R      I+   + RN    Q E   A+S +PGT  I+I+TWGCSHN+SD EYMAG +A     YG+ ++         L  SC++K   ++
Sbjct:   33 SLLDDIEDIVSATDPKPHDRQNARQNIVPRARKRNKNKIQEEEPPADSTIPGTQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYSITEQPEQADLWLLNSCTVKSPAED 139          
BLAST of SMED30022511 vs. Ensembl Xenopus
Match: cwf19l1 (CWF19 like cell cycle control factor 1 [Source:Xenbase;Acc:XB-GENE-995269])

HSP 1 Score: 70.4774 bits (171), Expect = 5.717e-12
Identity = 42/111 (37.84%), Postives = 62/111 (55.86%), Query Frame = -2
Query:    2 SLLPDIENLISNSDDED-KRIVPTDVILTHLKNRNVENAQFE---AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 295
            SLL DIE+++S +D +   R      I+   + RN    Q E   A+S +PGT  I+I+TWGCSHN+SD EYMAG +A     YG+ ++         L  SC++K   ++
Sbjct:   33 SLLDDIEDIVSATDPKPHDRQNARQNIVPRARKRNKNKIQEEEPPADSTIPGTQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYSITEQPEQADLWLLNSCTVKSPAED 139          
BLAST of SMED30022511 vs. Ensembl Xenopus
Match: cwf19l1 (CWF19 like cell cycle control factor 1 [Source:Xenbase;Acc:XB-GENE-995269])

HSP 1 Score: 70.4774 bits (171), Expect = 5.895e-12
Identity = 42/111 (37.84%), Postives = 62/111 (55.86%), Query Frame = -2
Query:    2 SLLPDIENLISNSDDED-KRIVPTDVILTHLKNRNVENAQFE---AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 295
            SLL DIE+++S +D +   R      I+   + RN    Q E   A+S +PGT  I+I+TWGCSHN+SD EYMAG +A     YG+ ++         L  SC++K   ++
Sbjct:    7 SLLDDIEDIVSATDPKPHDRQNARQNIVPRARKRNKNKIQEEEPPADSTIPGTQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYSITEQPEQADLWLLNSCTVKSPAED 113          
BLAST of SMED30022511 vs. Ensembl Mouse
Match: Cdkal1 (CDK5 regulatory subunit associated protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1921765])

HSP 1 Score: 67.781 bits (164), Expect = 1.835e-13
Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = -2
Query:   35 LLPDIENLISNSDDEDK-RIVPTDVILTHLKNRNV-----ENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLN 292
            LL DIE++IS  D + + R      +   ++ RN      E  +  ++S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++ N
Sbjct:    9 LLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKITEN 96          
BLAST of SMED30022511 vs. Ensembl Mouse
Match: Cdkal1 (CDK5 regulatory subunit associated protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1921765])

HSP 1 Score: 67.0106 bits (162), Expect = 3.552e-13
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = -2
Query:   38 LLPDIENLISNSDDEDK-RIVPTDVILTHLKNRNV-----ENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSL 292
            LL DIE++IS  D + + R      +   ++ RN      E  +  ++S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K+++
Sbjct:    9 LLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKITV 95          
BLAST of SMED30022511 vs. Ensembl Mouse
Match: Cdkal1 (CDK5 regulatory subunit associated protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1921765])

HSP 1 Score: 68.9366 bits (167), Expect = 1.146e-12
Identity = 37/94 (39.36%), Postives = 55/94 (58.51%), Query Frame = -2
Query:   29 LLPDIENLISNSDDEDK-RIVPTDVILTHLKNRNV-----ENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGS 292
            LL DIE++IS  D + + R      +   ++ RN      E  +  ++S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++ N S
Sbjct:    9 LLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKITENAS 98          
BLAST of SMED30022511 vs. Ensembl Mouse
Match: Cdkal1 (CDK5 regulatory subunit associated protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1921765])

HSP 1 Score: 66.6254 bits (161), Expect = 1.355e-12
Identity = 35/90 (38.89%), Postives = 53/90 (58.89%), Query Frame = -2
Query:   41 LLPDIENLISNSDDEDK-RIVPTDVILTHLKNRNV-----ENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS 292
            LL DIE++IS  D + + R      +   ++ RN      E  +  ++S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++
Sbjct:    9 LLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKIT 94          
BLAST of SMED30022511 vs. Ensembl Mouse
Match: Cdkal1 (CDK5 regulatory subunit associated protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1921765])

HSP 1 Score: 69.3218 bits (168), Expect = 8.951e-12
Identity = 37/94 (39.36%), Postives = 55/94 (58.51%), Query Frame = -2
Query:   29 LLPDIENLISNSDDEDK-RIVPTDVILTHLKNRNV-----ENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGS 292
            LL DIE++IS  D + + R      +   ++ RN      E  +  ++S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++ N S
Sbjct:    9 LLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKITENAS 98          
BLAST of SMED30022511 vs. UniProt/SwissProt
Match: sp|Q6NS26|CDKAL_XENLA (Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Xenopus laevis OX=8355 GN=cdkal1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.411e-12
Identity = 43/111 (38.74%), Postives = 63/111 (56.76%), Query Frame = -2
Query:    2 SLLPDIENLISNSDDED-KRIVPTDVILTHLKNRNVENAQFE---AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 295
            SLL DIE+++S +D +   R      I+   + RN  N Q E   A+S +PGT  I+I+TWGCSHN+SD EYMAG +A     YG+ ++         L  SC++K   ++
Sbjct:    7 SLLDDIEDMVSATDPKPHDRQSARKNIVPRARKRNKNNIQEEEPPADSTIPGTQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYSITEQPEKADLWLLNSCTVKSPAED 113          
BLAST of SMED30022511 vs. UniProt/SwissProt
Match: sp|Q5VV42|CDKAL_HUMAN (Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Homo sapiens OX=9606 GN=CDKAL1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.785e-12
Identity = 40/97 (41.24%), Postives = 58/97 (59.79%), Query Frame = -2
Query:   29 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFEAE------SYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGS 295
            +LL DIE+++S  D   +D+  V  DV+   ++ RN +    E E      S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++ N S
Sbjct:    8 TLLDDIEDIVSQEDSKPQDRHFVRKDVV-PKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKITENAS 99          
BLAST of SMED30022511 vs. UniProt/SwissProt
Match: sp|Q6P4Y0|CDKAL_XENTR (Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Xenopus tropicalis OX=8364 GN=cdkal1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.515e-11
Identity = 42/111 (37.84%), Postives = 62/111 (55.86%), Query Frame = -2
Query:    2 SLLPDIENLISNSDDED-KRIVPTDVILTHLKNRNVENAQFE---AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 295
            SLL DIE+++S +D +   R      I+   + RN    Q E   A+S +PGT  I+I+TWGCSHN+SD EYMAG +A     YG+ ++         L  SC++K   ++
Sbjct:    7 SLLDDIEDIVSATDPKPHDRQNARQNIVPRARKRNKNKIQEEEPPADSTIPGTQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYSITEQPEQADLWLLNSCTVKSPAED 113          
BLAST of SMED30022511 vs. UniProt/SwissProt
Match: sp|Q91WE6|CDKAL_MOUSE (Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Mus musculus OX=10090 GN=Cdkal1 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 7.306e-11
Identity = 37/94 (39.36%), Postives = 55/94 (58.51%), Query Frame = -2
Query:   29 LLPDIENLISNSDDEDK-RIVPTDVILTHLKNRNV-----ENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGS 292
            LL DIE++IS  D + + R      +   ++ RN      E  +  ++S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++ N S
Sbjct:    9 LLDDIEDIISQEDSKPQDRQFSRKHVFPKVRRRNTQKYLQEEPRPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKITENAS 98          
BLAST of SMED30022511 vs. UniProt/SwissProt
Match: sp|Q7K4W1|CDKAL_DROME (Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Drosophila melanogaster OX=7227 GN=CG6550 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 7.274e-9
Identity = 39/113 (34.51%), Postives = 62/113 (54.87%), Query Frame = -2
Query:    2 DIENLISNSDDEDK-RIVPTDVILTHLKNRN---VENAQFEA-------ESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS--------LNGSCSLKGDGDE 283
            DIE+LIS  D + + R      +    K R+   +E+ + E        ES +PGT  ++++TWGC+HN+SDSEYMAG +A     YG+++S        L  SC++K   ++
Sbjct:   15 DIEDLISADDVKPRERYENKKTVTVRAKKRSQIRLESQEEEEKPKPTIHESVIPGTQKVFVKTWGCAHNNSDSEYMAGQLAA----YGYRLSGKEEADLWLLNSCTVKNPSED 123          
BLAST of SMED30022511 vs. TrEMBL
Match: A0A2K6LW93 (MTTase N-terminal domain-containing protein OS=Rhinopithecus bieti OX=61621 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.929e-13
Identity = 39/92 (42.39%), Postives = 60/92 (65.22%), Query Frame = -2
Query:   41 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFE-----AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS 295
            +LL DIE+++S+ D   +D+  V  DV+   ++ RN +N Q E     ++S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++
Sbjct:    8 TLLGDIEDIVSHEDSKPQDRHFVRKDVV-PKVRRRNTQNLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKIT 94          
BLAST of SMED30022511 vs. TrEMBL
Match: A0A2K6RBL9 (CDK5 regulatory subunit associated protein 1 like 1 OS=Rhinopithecus roxellana OX=61622 GN=CDKAL1 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.929e-13
Identity = 39/92 (42.39%), Postives = 60/92 (65.22%), Query Frame = -2
Query:   41 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFE-----AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS 295
            +LL DIE+++S+ D   +D+  V  DV+   ++ RN +N Q E     ++S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++
Sbjct:    8 TLLGDIEDIVSHEDSKPQDRHFVRKDVV-PKVRRRNTQNLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKIT 94          
BLAST of SMED30022511 vs. TrEMBL
Match: Q4SH96 (Chromosome 8 SCAF14587, whole genome shotgun sequence OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00018273001 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.743e-12
Identity = 33/87 (37.93%), Postives = 59/87 (67.82%), Query Frame = -2
Query:   41 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS 295
            S++ DIE+++S++D   +D++   T +I    K ++  + + +A+S +PGT  I+++TWGCSHN+SD EYMAG +A      G+K++
Sbjct:    7 SVIEDIEDMVSSNDPTLQDRQSARTRIIPRSRKQKDGNHEELQADSLIPGTQKIWMKTWGCSHNNSDGEYMAGQLAA----SGYKIT 89          
BLAST of SMED30022511 vs. TrEMBL
Match: A0A2J8WND1 (CDKAL1 isoform 2 OS=Pongo abelii OX=9601 GN=CR201_G0009489 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.416e-11
Identity = 38/93 (40.86%), Postives = 56/93 (60.22%), Query Frame = -2
Query:   41 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFEAE------SYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS 295
            +LL DIE+++S  D   +D+  V  DV+   ++ RN +    E E      S +PG   I+I+TWGCSHN+SD EYMAG +A     YG+K++
Sbjct:    8 TLLDDIEDIVSQEDSKPQDRHFVRKDVV-PKVRRRNTQKYLQEEENRPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAA----YGYKIT 95          
BLAST of SMED30022511 vs. TrEMBL
Match: A0A3B4ZNF9 (MTTase N-terminal domain-containing protein OS=Stegastes partitus OX=144197 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.757e-11
Identity = 30/76 (39.47%), Postives = 52/76 (68.42%), Query Frame = -2
Query:   74 SLLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMA 295
            SL+ DIE+++S+SD    +++     +I    + + + + + +A+S +PGT  I+++TWGCSHN+SD EYMAG +A
Sbjct:    7 SLIEDIEDMVSSSDPTPHERQSARKSIIPRSRRKKELSDEELQADSLIPGTQKIWMKTWGCSHNNSDGEYMAGQLA 82          
BLAST of SMED30022511 vs. Ensembl Cavefish
Match: cdkal1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:21050])

HSP 1 Score: 62.003 bits (149), Expect = 1.663e-9
Identity = 31/89 (34.83%), Postives = 53/89 (59.55%), Query Frame = -2
Query:   26 DIENLISNSDD-EDKRIVPTDVILTHLKNRN--VENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGSC 283
            DIE++ S+ D    +R      ++  ++ R   +   + +A+S +PGT  ++++TWGCSHN+SD EYMAG +A      G+K  + G+C
Sbjct:   11 DIEDIASSHDPTAHQRQFSRQSVVPRVRKRKEHLPGEELQADSVIPGTQKVWVRTWGCSHNNSDGEYMAGQLAA----GGYK--MTGTC 93          
BLAST of SMED30022511 vs. Ensembl Nematostella
Match: EDO40392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7F5])

HSP 1 Score: 65.4698 bits (158), Expect = 4.752e-11
Identity = 37/99 (37.37%), Postives = 57/99 (57.58%), Query Frame = -2
Query:   23 SLLPDIENLISNSD-------DEDKRIVPTDVILTHLKNRNVENAQFE-AESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGSCS 295
            S + DIE+ + + D       +  K ++P    L   K+R  E  +    +S +PGT  IY++TWGCSHN+SDSEYMAG +A     YG+K++ +  C+
Sbjct:    6 SEITDIEDFVIHEDVTPVSRTNARKDVLPKSRKLAK-KDRVKEEKEVPVGDSIIPGTQTIYVRTWGCSHNNSDSEYMAGQLAA----YGYKITDDEQCA 99          
BLAST of SMED30022511 vs. Ensembl Medaka
Match: cdkal1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:NCBI gene;Acc:101158380])

HSP 1 Score: 62.7734 bits (151), Expect = 1.017e-9
Identity = 34/109 (31.19%), Postives = 64/109 (58.72%), Query Frame = -2
Query:    2 LLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVEN-AQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 292
            ++ DIE+++S++D    +++    ++I    K + + N  + +A+S +PG   I+++TWGCSHN+SD EYMAG +A      G+K++         L  SC++K   ++
Sbjct:    8 VIEDIEDMVSSTDPTPHERQSARKNIIPRPKKKKELLNDEELQADSVIPGMQKIWMKTWGCSHNNSDGEYMAGQLAA----SGYKMTDDPAEADLWLLNSCTVKNPAED 112          
BLAST of SMED30022511 vs. Ensembl Medaka
Match: cdkal1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:NCBI gene;Acc:101158380])

HSP 1 Score: 62.7734 bits (151), Expect = 1.017e-9
Identity = 34/109 (31.19%), Postives = 64/109 (58.72%), Query Frame = -2
Query:    2 LLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVEN-AQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 292
            ++ DIE+++S++D    +++    ++I    K + + N  + +A+S +PG   I+++TWGCSHN+SD EYMAG +A      G+K++         L  SC++K   ++
Sbjct:    8 VIEDIEDMVSSTDPTPHERQSARKNIIPRPKKKKELLNDEELQADSVIPGMQKIWMKTWGCSHNNSDGEYMAGQLAA----SGYKMTDDPAEADLWLLNSCTVKNPAED 112          
BLAST of SMED30022511 vs. Ensembl Medaka
Match: cdkal1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:NCBI gene;Acc:101158380])

HSP 1 Score: 62.7734 bits (151), Expect = 1.017e-9
Identity = 34/109 (31.19%), Postives = 64/109 (58.72%), Query Frame = -2
Query:    2 LLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVEN-AQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 292
            ++ DIE+++S++D    +++    ++I    K + + N  + +A+S +PG   I+++TWGCSHN+SD EYMAG +A      G+K++         L  SC++K   ++
Sbjct:    8 VIEDIEDMVSSTDPTPHERQSARKNIIPRPKKKKELLNDEELQADSVIPGMQKIWMKTWGCSHNNSDGEYMAGQLAA----SGYKMTDDPAEADLWLLNSCTVKNPAED 112          
BLAST of SMED30022511 vs. Ensembl Medaka
Match: cdkal1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:NCBI gene;Acc:101158380])

HSP 1 Score: 62.3882 bits (150), Expect = 1.187e-9
Identity = 34/109 (31.19%), Postives = 64/109 (58.72%), Query Frame = -2
Query:    2 LLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVEN-AQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 292
            ++ DIE+++S++D    +++    ++I    K + + N  + +A+S +PG   I+++TWGCSHN+SD EYMAG +A      G+K++         L  SC++K   ++
Sbjct:    8 VIEDIEDMVSSTDPTPHERQSARKNIIPRPKKKKELLNDEELQADSVIPGMQKIWMKTWGCSHNNSDGEYMAGQLAA----SGYKMTDDPAEADLWLLNSCTVKNPAED 112          
BLAST of SMED30022511 vs. Ensembl Medaka
Match: cdkal1 (CDK5 regulatory subunit associated protein 1 like 1 [Source:NCBI gene;Acc:101158380])

HSP 1 Score: 62.3882 bits (150), Expect = 1.276e-9
Identity = 34/109 (31.19%), Postives = 64/109 (58.72%), Query Frame = -2
Query:    2 LLPDIENLISNSDD--EDKRIVPTDVILTHLKNRNVEN-AQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVS---------LNGSCSLKGDGDE 292
            ++ DIE+++S++D    +++    ++I    K + + N  + +A+S +PG   I+++TWGCSHN+SD EYMAG +A      G+K++         L  SC++K   ++
Sbjct:    8 VIEDIEDMVSSTDPTPHERQSARKNIIPRPKKKKELLNDEELQADSVIPGMQKIWMKTWGCSHNNSDGEYMAGQLAA----SGYKMTDDPAEADLWLLNSCTVKNPAED 112          
BLAST of SMED30022511 vs. Planmine SMEST
Match: SMESG000011997.1 (SMESG000011997.1)

HSP 1 Score: 196.052 bits (497), Expect = 1.256e-53
Identity = 95/99 (95.96%), Postives = 95/99 (95.96%), Query Frame = -2
Query:    2 MSLLPDIENLISNSDDEDKRIVPTDVILTHLKNRNVENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGSCSLKGDGDE 298
            MSLLPDIENLISNSDDEDKRIVPTDVILTHLKNRNVENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEY    MAGILSKYGFKVSLNGSCSLKGDGDE
Sbjct:    1 MSLLPDIENLISNSDDEDKRIVPTDVILTHLKNRNVENAQFEAESYVPGTHHIYIQTWGCSHNSSDSEY----MAGILSKYGFKVSLNGSCSLKGDGDE 95          
BLAST of SMED30022511 vs. Planmine SMEST
Match: SMESG000001411.1 (SMESG000001411.1)

HSP 1 Score: 160.229 bits (404), Expect = 8.895e-46
Identity = 77/123 (62.60%), Postives = 96/123 (78.05%), Query Frame = 2
Query: 1445 QTRFSITSKICSIILVQQNNNKTLDVEKFRRDVAHYHNEVLKQSQRAELMIRKCRWMDETWTRPEQVKILSQQNELLKT*HSEMVAEINKLKKENYQLKLKETMRAEVGHHPSTFSSMNPSIT 1813
            +TR S  SKIC +ILV+ N  KT+D EKFRRD+AHYHNE LKQSQRAE MIR+C  M+ETWTRPEQ   L QQNEL+K   +EM+AE++KL+KEN QLKLKE +RAE+GH+ ST  ++  S+ 
Sbjct:    7 RTRDSTKSKICYVILVKSNQTKTIDAEKFRRDIAHYHNEALKQSQRAESMIRRCCRMEETWTRPEQATKLKQQNELIKNQDTEMMAELDKLRKENCQLKLKEAIRAEIGHNLSTVLNVEMSVA 129          
BLAST of SMED30022511 vs. Planmine SMEST
Match: SMESG000063433.1 (SMESG000063433.1)

HSP 1 Score: 112.079 bits (279), Expect = 1.844e-32
Identity = 52/78 (66.67%), Postives = 66/78 (84.62%), Query Frame = 2
Query: 1592 MIRKCRWMDETWTRPEQVKILSQQNELLKT*HSEMVAEINKLKKENYQLKLKETMRAEVGHHPSTFSSMNPSIT*PIS 1825
            MIR+CR M+ETWTRPEQ   L QQNELL+  H+EM A+++KLKKEN+QLKLKET+RAE+GHH ST S+++PS+  PIS
Sbjct:    1 MIRRCRRMEETWTRPEQATKLKQQNELLRNQHTEMRAKLDKLKKENHQLKLKETIRAEIGHHLSTVSNLDPSVAWPIS 78          

HSP 2 Score: 47.7506 bits (112), Expect = 1.844e-32
Identity = 27/51 (52.94%), Postives = 34/51 (66.67%), Query Frame = 1
Query: 1831 TPINAKNSNGPQPKPNHKSVTPAK-RREKRCRLKTARLLG*IKKFGPTSSD 1980
            TP N++ +   Q KPNHK    +K  RE+R RLK ARLLG IKKF P++ D
Sbjct:   81 TPTNSQRNRETQSKPNHKKCHSSKTERERRRRLKNARLLGQIKKFEPSAPD 131          
BLAST of SMED30022511 vs. Planmine SMEST
Match: SMESG000066834.1 (SMESG000066834.1)

HSP 1 Score: 122.094 bits (305), Expect = 7.904e-32
Identity = 58/93 (62.37%), Postives = 75/93 (80.65%), Query Frame = 2
Query: 1490 VQQNNNKTLDVEKFRRDVAHYHNEVLKQSQRAELMIRKCRWMDETWTRPEQVKILSQQNELLKT*HSEMVAEINKLKKENYQLKLKETMRAEV 1768
            + +N  +TLD+EKFR+DVA+YH++ L+QSQRAE MIR CR M+ETWTRPEQ K L+Q N LLK+ +SEM  E+ K+KKE+ QLKLKET R E+
Sbjct:   28 INKNQARTLDIEKFRQDVAYYHDKALEQSQRAEAMIRLCRRMEETWTRPEQAKKLTQHNNLLKSQYSEMAIELEKIKKEDQQLKLKETFRNEI 120          
BLAST of SMED30022511 vs. Planmine SMEST
Match: SMESG000069127.1 (SMESG000069127.1)

HSP 1 Score: 103.99 bits (258), Expect = 1.968e-30
Identity = 50/79 (63.29%), Postives = 66/79 (83.54%), Query Frame = 2
Query: 1592 MIRKCRWMDETWTRPEQVKILSQQNELLKT*HSEMVAEINKLKKENYQLKLKETMRAEVGHHPSTFSSMNPSIT*PISN 1828
            MIR+ R M+ETWTRPEQ   L QQNELLK  ++E++AE++KLKKEN QLKLKET+R E+GHHPST  +++PS++ PIS+
Sbjct:    1 MIRRYRRMEETWTRPEQATKLKQQNELLKNQNTEVMAELDKLKKENCQLKLKETIRVEIGHHPSTVLNVDPSVSWPISS 79          

HSP 2 Score: 48.9062 bits (115), Expect = 1.968e-30
Identity = 27/48 (56.25%), Postives = 34/48 (70.83%), Query Frame = 1
Query: 1840 NAKNSNGPQPKPNHKSVTPAK-RREKRCRLKTARLLG*IKKFGPTSSD 1980
            N + ++    KPNHK   P+K  R++R RLKTARLLG IKKFGP S+D
Sbjct:   84 NIQMNHDTSSKPNHKKCHPSKAERKRRRRLKTARLLGQIKKFGPLSAD 131          
The following BLAST results are available for this feature:
BLAST of SMED30022511 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CDKAL12.295e-1440.86CDK5 regulatory subunit associated protein 1 like ... [more]
CDKAL11.829e-1241.24CDK5 regulatory subunit associated protein 1 like ... [more]
CDKAL11.829e-1241.24CDK5 regulatory subunit associated protein 1 like ... [more]
back to top
BLAST of SMED30022511 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y92H12BL.45.515e-648.89pep chromosome:WBcel235:I:1376942:1385057:-1 gene:... [more]
back to top
BLAST of SMED30022511 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG65507.256e-1034.51gene:FBgn0034214 transcript:FBtr0086961[more]
back to top
BLAST of SMED30022511 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01090785.11.569e-1034.21pep chromosome:GRCz11:16:1471:4245:1 gene:ENSDARG0... [more]
back to top
BLAST of SMED30022511 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwf19l14.806e-1237.84CWF19 like cell cycle control factor 1 [Source:Xen... [more]
cwf19l15.189e-1237.84CWF19 like cell cycle control factor 1 [Source:Xen... [more]
cwf19l15.652e-1237.84CWF19 like cell cycle control factor 1 [Source:Xen... [more]
cwf19l15.717e-1237.84CWF19 like cell cycle control factor 1 [Source:Xen... [more]
cwf19l15.895e-1237.84CWF19 like cell cycle control factor 1 [Source:Xen... [more]
back to top
BLAST of SMED30022511 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdkal11.835e-1339.13CDK5 regulatory subunit associated protein 1-like ... [more]
Cdkal13.552e-1338.46CDK5 regulatory subunit associated protein 1-like ... [more]
Cdkal11.146e-1239.36CDK5 regulatory subunit associated protein 1-like ... [more]
Cdkal11.355e-1238.89CDK5 regulatory subunit associated protein 1-like ... [more]
Cdkal18.951e-1239.36CDK5 regulatory subunit associated protein 1-like ... [more]
back to top
BLAST of SMED30022511 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NS26|CDKAL_XENLA3.411e-1238.74Threonylcarbamoyladenosine tRNA methylthiotransfer... [more]
sp|Q5VV42|CDKAL_HUMAN8.785e-1241.24Threonylcarbamoyladenosine tRNA methylthiotransfer... [more]
sp|Q6P4Y0|CDKAL_XENTR2.515e-1137.84Threonylcarbamoyladenosine tRNA methylthiotransfer... [more]
sp|Q91WE6|CDKAL_MOUSE7.306e-1139.36Threonylcarbamoyladenosine tRNA methylthiotransfer... [more]
sp|Q7K4W1|CDKAL_DROME7.274e-934.51Threonylcarbamoyladenosine tRNA methylthiotransfer... [more]
back to top
BLAST of SMED30022511 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2K6LW934.929e-1342.39MTTase N-terminal domain-containing protein OS=Rhi... [more]
A0A2K6RBL94.929e-1342.39CDK5 regulatory subunit associated protein 1 like ... [more]
Q4SH963.743e-1237.93Chromosome 8 SCAF14587, whole genome shotgun seque... [more]
A0A2J8WND12.416e-1140.86CDKAL1 isoform 2 OS=Pongo abelii OX=9601 GN=CR201_... [more]
A0A3B4ZNF92.757e-1139.47MTTase N-terminal domain-containing protein OS=Ste... [more]
back to top
BLAST of SMED30022511 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdkal11.663e-934.83CDK5 regulatory subunit associated protein 1 like ... [more]
back to top
BLAST of SMED30022511 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022511 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022511 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403924.752e-1137.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30022511 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkal11.017e-931.19CDK5 regulatory subunit associated protein 1 like ... [more]
cdkal11.017e-931.19CDK5 regulatory subunit associated protein 1 like ... [more]
cdkal11.017e-931.19CDK5 regulatory subunit associated protein 1 like ... [more]
cdkal11.187e-931.19CDK5 regulatory subunit associated protein 1 like ... [more]
cdkal11.276e-931.19CDK5 regulatory subunit associated protein 1 like ... [more]
back to top
BLAST of SMED30022511 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011997.11.256e-5395.96SMESG000011997.1[more]
SMESG000001411.18.895e-4662.60SMESG000001411.1[more]
SMESG000063433.11.844e-3266.67SMESG000063433.1[more]
SMESG000066834.17.904e-3262.37SMESG000066834.1[more]
SMESG000069127.11.968e-3063.29SMESG000069127.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022511 ID=SMED30022511|Name=SMED30022511|organism=Schmidtea mediterranea sexual|type=transcript|length=2387bp
TTTCATCTCCATCCCCTTTTAATGAACATGAACCGTTTAAAGAAACCTTG
AATCCATATTTAGATAATATTCCAGCCATTATTCCAGCCATATATTCACT
ATCACTGCTATTATGCGAACAGCCCCACGTTTGAATATAAATATGATGCG
TACCTGGTACATAACTTTCTGCTTCAAATTGCGCATTTTCAACATTTCTA
TTTTTTAAATGAGTTAAAATAACATCCGTCGGAACAATTCTCTTATCTTC
ATCGTCACTATTTGAAATTAAATTTTCGATGTCAGGTAGCAGAGACATAA
GTCAATTTATAATAATTATTATGTTGGTAGATAAATACCTTTCATATATA
TTTTCAGGCGACCTTTCATGTCGACTAGGCATTCCCTAGATATCAATAGC
AAAAATTCAGATACGAATAAACTTTGTTAGACCTCGGTGAAAACCGATCA
TCATCAAGTCAATTATTTCTTTTAAATACACCCAGTAAAAACAAAAGAAA
ATAAAGAGTACCCAATATTTATTTGGTACATTTAAATAATCAACTATAAC
AAAAGAAAAACTATGAATTAAATTAGTCATAATCTTATTTTTATATATTC
AATAATTAATCATAATTTTGTTTTCTGTGATTTCACCGGAGTAAACAATC
TGATATATTGTAGCCGATGCTGCCACGAAAGAGAAGGGATAAATTTATCC
GATGAGCAAGTGGGACAATTTCGCAGATCTAGTATGACTAGTGTGGGGAA
ATTGTTGAACTGAATCGATCTAACCAATACATATTTATTAAAATTGAATA
AAACTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNTTTTAAAAGGGGTTGAGTTACATAGTTAAAAGAT
TTTTACCGTATTTTTGGGTCTAAATTAATTACCGAGGACCTCCCATAGAT
GCCACCCAACACCANNCTNNTNANNNNNNNNCTAATANAANTGAGNATCT
GAAATTAAAATCAATGAATCTTCATTATTTTCACATATTATCATCAAACA
CGATTTTCGATTACATCTAAAATTTGCTCAATTATATTAGTGCAACAAAA
TAATAACAAAACCCTTGACGTGGAAAAATTCAGGCGAGATGTCGCCCATT
ACCACAACGAGGTCCTGAAGCAGAGCCAGCGAGCTGAATTGATGATACGA
AAATGTCGTTGGATGGATGAAACCTGGACTCGACCAGAACAGGTAAAGAT
ATTGAGTCAACAGAATGAGTTATTAAAAACCTAACACTCCGAGATGGTAG
CCGAAATAAACAAATTAAAGAAGGAAAATTATCAGCTTAAGTTAAAAGAG
ACGATGAGGGCAGAAGTTGGGCACCATCCCAGCACGTTCTCGAGCATGAA
TCCAAGTATCACATGACCCATCTCAAACCCACTCCAATCAATGCCAAAAA
CAGTAACGGTCCACAACCAAAACCGAATCACAAAAGTGTCACCCCAGCAA
AGCGGAGAGAAAAAAGGTGCAGATTGAAGACCGCTCGTTTACTGGGTTAG
ATAAAGAAATTTGGACCAACATCTTCTGATAAACCCAGATAATATTGTGA
TATAATTAATAATTAATAAAATGTTCTGGGTTTTAAATCTATGTTCGTTT
TACAATAACTTAAATTATTTGATAAATAGTACCTTTAAATATAAATTAAG
TGATTGAATGATCGATATTATTCCAATTAAATTAGCAACAGAGGGACCCG
TAATAAAAGTGTGCATGAATACCTTCTATTGTAGCTCGTGAACCCAACGG
TTTTCTAGGGTATTAGCAGTCATGGTAATATGGCTCACATTTTACTAGAA
AACGCTCATTGGAATACATTTCCGACGTCATTTTTGACGGGTATCCAATG
GTTATACTTCTTGTGCGCGCATCTGGTGGGAACCCCTTGAAAGTGGCAGC
GAAAATCTTATATCTTTTGCTCATCAGGTGCCCAGCA
back to top

protein sequence of SMED30022511-orf-1

>SMED30022511-orf-1 ID=SMED30022511-orf-1|Name=SMED30022511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=99bp
MSLLPDIENLISNSDDEDKRIVPTDVILTHLKNRNVENAQFEAESYVPGT
HHIYIQTWGCSHNSSDSEYMAGIMAGILSKYGFKVSLNGSCSLKGDGDE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR013848Methylthiotransferase_N
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: biological process
TermDefinition
GO:0009451RNA modification