Tigger transposable element-derived protein 1

Overview
NameTigger transposable element-derived protein 1
Smed IDSMED30022502
Length (bp)2570
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tigger transposable element-derived protein 1 (SMED30022502) t-SNE clustered cells

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30022502) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tigger transposable element-derived protein 1 (SMED30022502) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30022502) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022502

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30022502 dd_Smed_v4_24713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 150.599 bits (379), Expect = 1.816e-37
Identity = 109/352 (30.97%), Postives = 175/352 (49.72%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFI-------NPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLP------LSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTG----NGTIAEISDEIIALAHSFGGEGFDTFNPNDIEELLT--DKALNDDEVIALTMXXX--XXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKELYKQ 1348
            WK+MP+RT+IA+ EK   GFKASKDR++LLL +NA+GD  LKP++I     PRALK+     LPV +  NSKA +   LFT WF   F          K+  F   +       +PR      +    +    F       ++QP+DQG+I+TFK +Y+++T+   L  ++++         L   WK FTILD I ++ ++   ++  TL   WK + P  +        ++ E+S +++ +A     E      P D+ ELL   DK L D+E+  +        E+E+    +  N V  T K +   + L +     F   D+N+ER+      L+N I+ Y+E++ +
Sbjct:  193 WKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYE----EINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLIDDYEGFKTSVEEVSADVVEIAKELELE----VEPEDVTELLQSHDKTLTDEELFLMDAQRKWFLEMESTPGEDAVNIVEMTTKDLEYYINLVDKAAAGFERIDSNFERSSTVGKMLSNSIACYREIFHE 536          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 100.523 bits (249), Expect = 2.494e-21
Identity = 75/251 (29.88%), Postives = 123/251 (49.00%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCF------FTRSGNISETKRS*F-*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWP---ECVTGNGTIAEISDEIIA--LAHSFGGEGFDTFN 1072
            WK +P+R  + K +    G K+ ++R++++ C+NA+G   LK  V+ K  +PR+ KS D   LPV++ +   AW+  ++F +WF   F      + RS  + E        S  +P +     +    Q    +       LIQP DQG+IAT K++Y     ++ L     E   L   WKK T+LD +  +A A N ++ +T++  WK I P   E  + +  + +IS   +A  L H+ G E   T N
Sbjct:  183 WKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENV--LRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNL----EEGNDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPMVEEKESLDFDVEDISVATVAAILQHTKGLENVTTEN 427          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 100.138 bits (248), Expect = 3.189e-21
Identity = 65/220 (29.55%), Postives = 108/220 (49.09%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFT------RSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNG 997
            WK +P+RT   ++++  SG ++S++RI ++ C+NA+G   L   V+ K  +PRA K  DL  LPV + +   AW+ +++F +WF+  F        +S  + E K      F   R           +    +       LIQP+ QG++AT K++Y       +L K  +E       WK  T+LD I  V+ A N ++S T+   WK ++P     +G
Sbjct:  183 WKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLE-KAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYY----RAGLLQKYMDEGNDPKIFWKNLTVLDAIYEVSRAWNMVKSSTITKAWKKLFPGNEENSG 397          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 100.138 bits (248), Expect = 3.189e-21
Identity = 65/220 (29.55%), Postives = 108/220 (49.09%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFT------RSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNG 997
            WK +P+RT   ++++  SG ++S++RI ++ C+NA+G   L   V+ K  +PRA K  DL  LPV + +   AW+ +++F +WF+  F        +S  + E K      F   R           +    +       LIQP+ QG++AT K++Y       +L K  +E       WK  T+LD I  V+ A N ++S T+   WK ++P     +G
Sbjct:  183 WKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLE-KAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYY----RAGLLQKYMDEGNDPKIFWKNLTVLDAIYEVSRAWNMVKSSTITKAWKKLFPGNEENSG 397          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 88.1965 bits (217), Expect = 2.011e-17
Identity = 57/195 (29.23%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  410 GFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFT------RSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWP 976
            G K  KDR+++L+C+NA+G   LKPL I K + PRA K   ++ LPV + A   AWV K +F++WF + F        R+  + E  ++      + R      +  +      F       L+QP++QGI   F +++I            N  +PL     ++ + D I  VA A N + S      W+ +WP
Sbjct:  208 GPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKG--IQHLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAVL-LLDSSRAHPQEAELVSSNVFTIFLPASVASLVQPMEQGIRRDFMRNFI------------NPPVPLQGPHARYNMNDAIFSVACAWNAVPSHVFRRAWRKLWP 387          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:Xenbase;Acc:XB-GENE-1014042])

HSP 1 Score: 71.633 bits (174), Expect = 3.764e-12
Identity = 56/217 (25.81%), Postives = 98/217 (45.16%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTR------SGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYST----KYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWP 976
            W+ +P +      +  +SG +  K+R+++L CSNA+G    + LVI K   PRA K   ++  PV + AN +A + + +F +WF+N F         S  +S+  +        P   +     +     D  ++          IQPLDQGI+  FK +Y     + +L +  N+ +  ++   K  I D I   A A +++    L   W+ + P
Sbjct:  360 WRHLPQKLVATAQKPPSSGLEDPKERLTVLACSNAAGTHKARLLVIGKSRNPRAFKG--VRVFPVTYTANKQAGITREIFQDWFENHFVPEARAHCMSVGLSQDAKVMLILDHCPTHPSAEFLVK-----DNVFAVCLPPDCTSFIQPLDQGILRLFKSNYKSEFLQRMLTEC-NKGMAGAQFQAKANIKDAIWTAALAWDKVDKQALIHGWRNLCP 568          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000046714.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460367.1:582927:585046:-1 gene:ENSXETG00000018570.1 transcript:ENSXETT00000046714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 3.446e-10
Identity = 33/79 (41.77%), Postives = 47/79 (59.49%), Query Frame = 2
Query:  365 MPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTE 601
            +P +T+  + E    G K SK R+++L  +NA G   LKPLVI K  +PR    K++  LP N+ AN+KAW+   LF E
Sbjct:  184 LPGKTFCFRGED-CHGGKLSKLRLTVLFTTNADGSEKLKPLVIGKSVKPRCF--KNVNTLPTNYTANTKAWMTTKLFEE 259          

HSP 2 Score: 23.8682 bits (50), Expect = 3.446e-10
Identity = 14/40 (35.00%), Postives = 21/40 (52.50%), Query Frame = 3
Query:  666 KVLLILDNAPGHVNIEH-NNVKILFIPPNTTSSFSHWIKE 782
            K+LL LD  P H    H +NVK++F    +     + IK+
Sbjct:  274 KILLFLDRCPAHPPSLHLHNVKLVFFSKKSCKQAWNQIKQ 313          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: apmapl (adipocyte plasma membrane associated protein LIKE [Source:Xenbase;Acc:XB-GENE-5754317])

HSP 1 Score: 55.4546 bits (132), Expect = 2.739e-7
Identity = 48/189 (25.40%), Postives = 81/189 (42.86%), Query Frame = 2
Query:  428 DRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFINPR------QCTWSCKYRT*QC*DT-----FYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCW 961
            D +++LL +N +G   LKPLV+ K   P +L+  +  + P  +  +  AWV + L  EWF   F      +   KR      +  +      QC         Q  D      F S      I  +DQG+I++FK+ Y +   E +   +  ++ P S+    F + D I     + N I++ ++  CW
Sbjct:  174 DEVTVLLAANLTGSHKLKPLVVGKLRDPPSLRHHNQDKFPAVYHYSRNAWVTQELLREWFLEEF------VPAVKRYLKRCCLQQKAVLLVNQCPGKPPEEDLQTADGNIRVLFLSKTTRSKIPSMDQGVISSFKQLYRR---ELLKLMVSCDSSP-SDFVTSFRLKDMIYLAGQSWNMIQAGSIEKCW 352          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 100.523 bits (249), Expect = 1.534e-21
Identity = 73/241 (30.29%), Postives = 112/241 (46.47%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFT------RSGNISETKRS*F*SF--INPRQCTWSCKYRT*QC*DTFYSTKY-----DKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEIS-DEIIALA 1036
            WK +P RT    +++    ++ S++RI ++ C+NA+G   L   V+ K  RPRA K  DL  LPV + +   AW+  ++  +WF+ CF        +S  + E K      F   +P +   S         D     KY       LIQP+ QG++ T K++Y       ++ K  +E       WK  T+LD I   + A N+IRS T+   WK ++P    GN     +S DE   LA
Sbjct:  183 WKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLRE-KAVLLLDFPAAHPAEELLSSD-------DGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYY----RAGLIQKYMDEGNDPKTFWKNLTVLDAIYEASRAWNQIRSNTITRAWKKLFP----GNEENPSVSIDEGAILA 407          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 98.5969 bits (244), Expect = 6.119e-21
Identity = 81/276 (29.35%), Postives = 132/276 (47.83%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCF------FTRSGNISETKRS*F-*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWP--ECVTGNGTIAEISDEIIA--LAHSFGGEGFDTFNPNDIEELL----TD---KALNDDEVI 1129
            WK +P+RT + K +    G    ++RI+++ C+NA+G   LK  V+ K  +PR+ KS D   LPV++ +   AW+  ++F +WF   F      + RS  + E        S  +P +     +    Q    +       LIQPL QG+IA  K++Y       +L+    E   L   WKK T+LD +  +A A N ++ +T++  WK I P  E   G     +IS   +A  L H+   +G +   P ++E+ L    T+   + L D E+I
Sbjct:  183 WKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENV--LRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNY----RAGLLHNNLEEGNDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKQILPAIEEKEGLDFDEDISGATVATILQHT---KGLENVTPENLEKWLEIDSTEPGYEVLTDSEII 449          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 83.5741 bits (205), Expect = 4.540e-16
Identity = 54/201 (26.87%), Postives = 89/201 (44.28%), Query Frame = 2
Query:  413 FKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFT------RSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNG 997
            FK  KDR+++L+C+NA+G   +KPL I K   PRA +   ++ LP+ + A   AWV K +F++WF + F        R+  + E  ++      + R  +   +  +      F  +    L+QP +QGI   F + +I            N  +       +  I D I +VA A N + S      W+ +WP      G
Sbjct:  209 FKQGKDRLTVLMCANATGSHRIKPLAIGKGGGPRAFRG--IQHLPIAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAIL-LLDHSRAHSQESELVSENVFTIFLPSSVTSLLQPTEQGIRRAFMRLFI------------NPPVAFQGFPTRHNINDAIVNVARAWNAVPSQVFQRAWRKLWPTVTFTEG 394          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd4 (tigger transposable element derived 4 [Source:MGI Symbol;Acc:MGI:2685264])

HSP 1 Score: 62.3882 bits (150), Expect = 1.652e-9
Identity = 56/211 (26.54%), Postives = 91/211 (43.13%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*D-TFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECV 985
            ++ +P  T+  K E  + G K  KDRI+L L +N  G   L  L+I K   PR  K   +K LPV + AN  AW+  A+F +W +             KR      I    C    + +  +  +  F+ +        ++QG+I + K  Y     +  L+ +E      S     F++LD ++            TL+LCW+A+ PE +
Sbjct:  189 YRMLPTNTFAFKGETCSVG-KLCKDRITLALGTNMDGSEKLPLLIIGKNRAPRCFKG--IKSLPVYYEANRTAWMTAAIFEQWMQKL----DEKFQAQKRR---VVIFVDSCPAHPEVKNLKSIELAFFPSCLSSGFAAMNQGVIKSLKIKYRHCLIKKFLSSVE------SSKEFTFSLLDAVD------------TLHLCWRAVTPETI 371          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd5 (tigger transposable element derived 5 [Source:MGI Symbol;Acc:MGI:2145902])

HSP 1 Score: 50.0618 bits (118), Expect = 7.646e-7
Identity = 29/98 (29.59%), Postives = 48/98 (48.98%), Query Frame = 2
Query:  344 NISG--WKRMP--ARTYIAKSEKRASGFKAS--KDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCF 619
            N++G  W+ +P  A T      K   G       DR+++LL +N +G   LKPLVI +   P +L+  +  + P ++  +  AW+ + L   WF   F
Sbjct:  247 NVTGLYWRLLPEQASTPGTGDSKEPGGCSRRWRSDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEF 344          

HSP 2 Score: 23.8682 bits (50), Expect = 7.646e-7
Identity = 10/26 (38.46%), Postives = 17/26 (65.38%), Query Frame = 3
Query:  618 FLPEVEIYLRQKGLDFKVLLILDNAP 695
            F+P V+ YLR+  L  K +L++ + P
Sbjct:  344 FVPGVKRYLRRSCLQQKAVLLVAHPP 369          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 8.722e-37
Identity = 109/352 (30.97%), Postives = 175/352 (49.72%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFI-------NPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLP------LSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTG----NGTIAEISDEIIALAHSFGGEGFDTFNPNDIEELLT--DKALNDDEVIALTMXXX--XXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKELYKQ 1348
            WK+MP+RT+IA+ EK   GFKASKDR++LLL +NA+GD  LKP++I     PRALK+     LPV +  NSKA +   LFT WF   F          K+  F   +       +PR      +    +    F       ++QP+DQG+I+TFK +Y+++T+   L  ++++         L   WK FTILD I ++ ++   ++  TL   WK + P  +        ++ E+S +++ +A     E      P D+ ELL   DK L D+E+  +        E+E+    +  N V  T K +   + L +     F   D+N+ER+      L+N I+ Y+E++ +
Sbjct:  193 WKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYE----EINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLIDDYEGFKTSVEEVSADVVEIAKELELE----VEPEDVTELLQSHDKTLTDEELFLMDAQRKWFLEMESTPGEDAVNIVEMTTKDLEYYINLVDKAAAGFERIDSNFERSSTVGKMLSNSIACYREIFHE 536          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q0VBL1|TIGD2_MOUSE (Tigger transposable element-derived protein 2 OS=Mus musculus OX=10090 GN=Tigd2 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.073e-20
Identity = 73/241 (30.29%), Postives = 112/241 (46.47%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFT------RSGNISETKRS*F*SF--INPRQCTWSCKYRT*QC*DTFYSTKY-----DKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEIS-DEIIALA 1036
            WK +P RT    +++    ++ S++RI ++ C+NA+G   L   V+ K  RPRA K  DL  LPV + +   AW+  ++  +WF+ CF        +S  + E K      F   +P +   S         D     KY       LIQP+ QG++ T K++Y       ++ K  +E       WK  T+LD I   + A N+IRS T+   WK ++P    GN     +S DE   LA
Sbjct:  183 WKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLRE-KAVLLLDFPAAHPAEELLSSD-------DGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYY----RAGLIQKYMDEGNDPKTFWKNLTVLDAIYEASRAWNQIRSNTITRAWKKLFP----GNEENPSVSIDEGAILA 407          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 1.198e-20
Identity = 75/251 (29.88%), Postives = 123/251 (49.00%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCF------FTRSGNISETKRS*F-*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWP---ECVTGNGTIAEISDEIIA--LAHSFGGEGFDTFN 1072
            WK +P+R  + K +    G K+ ++R++++ C+NA+G   LK  V+ K  +PR+ KS D   LPV++ +   AW+  ++F +WF   F      + RS  + E        S  +P +     +    Q    +       LIQP DQG+IAT K++Y     ++ L     E   L   WKK T+LD +  +A A N ++ +T++  WK I P   E  + +  + +IS   +A  L H+ G E   T N
Sbjct:  183 WKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENV--LRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNL----EEGNDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKKILPMVEEKESLDFDVEDISVATVAAILQHTKGLENVTTEN 427          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q4W5G0|TIGD2_HUMAN (Tigger transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=TIGD2 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.532e-20
Identity = 65/220 (29.55%), Postives = 108/220 (49.09%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFT------RSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNG 997
            WK +P+RT   ++++  SG ++S++RI ++ C+NA+G   L   V+ K  +PRA K  DL  LPV + +   AW+ +++F +WF+  F        +S  + E K      F   R           +    +       LIQP+ QG++AT K++Y       +L K  +E       WK  T+LD I  V+ A N ++S T+   WK ++P     +G
Sbjct:  183 WKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLE-KAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYY----RAGLLQKYMDEGNDPKIFWKNLTVLDAIYEVSRAWNMVKSSTITKAWKKLFPGNEENSG 397          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.280e-20
Identity = 81/276 (29.35%), Postives = 132/276 (47.83%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCF------FTRSGNISETKRS*F-*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWP--ECVTGNGTIAEISDEIIA--LAHSFGGEGFDTFNPNDIEELL----TD---KALNDDEVI 1129
            WK +P+RT + K +    G    ++RI+++ C+NA+G   LK  V+ K  +PR+ KS D   LPV++ +   AW+  ++F +WF   F      + RS  + E        S  +P +     +    Q    +       LIQPL QG+IA  K++Y       +L+    E   L   WKK T+LD +  +A A N ++ +T++  WK I P  E   G     +IS   +A  L H+   +G +   P ++E+ L    T+   + L D E+I
Sbjct:  183 WKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENV--LRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNY----RAGLLHNNLEEGNDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAWKQILPAIEEKEGLDFDEDISGATVATILQHT---KGLENVTPENLEKWLEIDSTEPGYEVLTDSEII 449          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A034WGK8 (Tigger transposable element-derived protein 1 OS=Bactrocera dorsalis OX=27457 GN=TIGD1 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.952e-70
Identity = 149/354 (42.09%), Postives = 201/354 (56.78%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIE-NETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAE---ISDEIIALAHSFGGEGFDTFNPNDIEELLTDKALNDDEVI---ALTMXXXXXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKELYKQLVTESRKSKQTFISNF 1396
            WK+MP+RTY+AK  K   GFK +K+RI+LLLCSNASGD++LKPL++NK  +PRALK  DLK+LPV+WMAN KAWV  +LF EWF+ CF         +K   F   +                   F       L+QPLDQGIIA  K +YIK ++  ILNK+E N  + +   WK F + +CI+ +  A+  I   TL+ CWK +W + V    +  E      EI  LA S GGEGFD  + +DI EL    AL+D E+I       + D E   +   E+  PV+ + KI+REGL    +LEN FI HD N ER  KF+ D  N +  Y++LYK++  E  KS++     F
Sbjct:  190 WKKMPSRTYVAKQTKSVHGFKTAKERITLLLCSNASGDKLLKPLLVNKNLKPRALKGMDLKKLPVHWMANKKAWVTASLFKEWFEKCFVPEVRGYMISKNLEFKVLLLIDNAPGHPVIEHPNVKVLFLPPNTTSLLQPLDQGIIAALKTYYIKHSFRFILNKLESNSAINVISAWKDFNVKNCIDCIKIAVKDITKTTLSKCWKNLWQDVVLQEESDNEGLVTYAEIFELAKSIGGEGFDDMDIDDINELFDLYALDDAEIIHAIDNNNNNDLENAEDGEDEDAPPVSLSSKILREGLDKAADLENHFIDHDPNDERLSKFRRDFKNAMECYQDLYKEMHKE--KSQRLLTDYF 541          

HSP 2 Score: 69.707 bits (169), Expect = 2.136e-8
Identity = 32/48 (66.67%), Postives = 39/48 (81.25%), Query Frame = 3
Query:  615 AFLPEVEIYLRQKGLDFKVLLILDNAPGHVNIEHNNVKILFIPPNTTS 758
             F+PEV  Y+  K L+FKVLL++DNAPGH  IEH NVK+LF+PPNTTS
Sbjct:  276 CFVPEVRGYMISKNLEFKVLLLIDNAPGHPVIEHPNVKVLFLPPNTTS 323          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4Y2HW32 (Tigger transposable element-derived protein 1 OS=Araneus ventricosus OX=182803 GN=TIGD1_37 PE=4 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 7.476e-70
Identity = 125/257 (48.64%), Postives = 159/257 (61.87%), Query Frame = 2
Query:  365 MPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGT---IAEISDEIIALAHSFGGEGFDTFNPNDIEELLTDKALNDDEV 1126
            MP+RT+IAKSEK ASG KA+K+RI+ LLCSNASG R+LKPL+INK   PRALK   L +LPV++MAN KAWV  A+FT W  +CF              F   +           +       F       L+QPLDQGIIA  K+HY+K T   IL K+EN+ + L E+WKKF+ILDCINH   A+ +I+  TLN  WKAIWPECV         + +S EIIAL H+  GEGF TF  ND+ E++ DK +ND ++
Sbjct:    1 MPSRTFIAKSEKTASGCKAAKNRITFLLCSNASGARMLKPLIINKALHPRALKGIHLAELPVHFMANKKAWVTSAVFTTWSNDCFVPEVEKYMTEMGLPFKVLLIVDYAPGHLFLQHLNVQAVFLPPNTTSLVQPLDQGIIANLKRHYVKLTLSYILKKLENDGISLIEVWKKFSILDCINHAIAAVAQIKQHTLNSYWKAIWPECVINRNVTENTSTLSSEIIALTHNISGEGFVTFRENDLVEMIKDKTVNDSDI 257          

HSP 2 Score: 65.0846 bits (157), Expect = 1.513e-7
Identity = 29/48 (60.42%), Postives = 39/48 (81.25%), Query Frame = 3
Query:  615 AFLPEVEIYLRQKGLDFKVLLILDNAPGHVNIEHNNVKILFIPPNTTS 758
             F+PEVE Y+ + GL FKVLLI+D APGH+ ++H NV+ +F+PPNTTS
Sbjct:   84 CFVPEVEKYMTEMGLPFKVLLIVDYAPGHLFLQHLNVQAVFLPPNTTS 131          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4Y2B316 (Tigger transposable element-derived protein 1 OS=Araneus ventricosus OX=182803 GN=TIGD1_66 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 9.572e-64
Identity = 129/336 (38.39%), Postives = 196/336 (58.33%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFI----NPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKI-ENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISD---EIIALAHSFGGEGFDTFNPNDIEELLTDKALNDDEVIALTMXXXXXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKEL 1339
            WK+MP RTY+++SE+  +GFKASK+RI++LLCSNASGD ++KP+VI++   PRA+KS D   LPV W A++K  V   +F +WF NCF +      + K   F   +     PR  T             F       LIQPL++ I  TF  +YIK  ++ I++++    TL ++ +W+ ++I+DC+  +  AI  I+  TLN CWK+IWP+ V     +  + +   EI+ LAH  GGEGFD    N++EEL+TD   N  + + +  D+    +  D  E+   +T     I +GL +   LENFFI +D N +R+LKF  +L+NC++ YK+L
Sbjct:  193 WKKMPRRTYLSQSERSNAGFKASKERITVLLCSNASGDYLMKPMVISRSLNPRAMKSLDKGNLPVYWKADNKTCVTVPIFRDWFYNCFVSDVELYVKEKNLSFKVLLLIDSAPRHPT---DLHHDNVKVVFLPPNTASLIQPLERSIFTTFNAYYIKHIFKRIVDEVNSGNTLSVTRVWENYSIVDCVELIKLAITEIKKSTLNACWKSIWPDVVVSGHDVPALENEYSEIMRLAHRVGGEGFDDMASNELEELMTDSEFNAAKQVEVVFDSTSSEDETDCDEKVPRLTLC--TIDKGLAMAKELENFFIQNDPNMDRSLKFARELHNCMASYKKL 523          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: T2M7L0 (Tigger transposable element-derived protein 1 (Fragment) OS=Hydra vulgaris OX=6087 GN=TIGD1 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 4.048e-60
Identity = 127/334 (38.02%), Postives = 197/334 (58.98%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*S-FINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIEN-ETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHSFGGEGFDTFNPNDIEELLTDKALNDDEVIALTMXXXXXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKELYKQL 1351
            WK++P+RT+I+ +EK+ASGFK+SK RI++  CSN SG  ++KP++IN F  PRA K+ ++ +LPV W AN KAW+ + LF +WF NCF  +  +    K   F    I     + S +         ++      LIQPLDQGII TFK +YI+  +E I +++E+ E   L E+WK+F+ILDC   V+ A   I+  TLN CW+ + P+ V     I+E   EI  +  SFG EGF      DIE+LL +++LN++E+  L  ++  E    ++   ++ + FT   +++GL L   LE     +D +  R+ KF+ +  NC++ YKE+ K+L
Sbjct:  277 WKKLPSRTHISINEKKASGFKSSKQRITIHKCSNLSGSLLIKPMIINNFLNPRAFKNVNMSELPVFWRANKKAWMTRELFKDWFYNCFVPQVESFMVEKNLSFRVLLILDNASSHSAEINHPNVKVLYFPPNCTSLIQPLDQGIIQTFKMYYIQIFFEVIFSRLEDQEWKTLLEVWKEFSILDCTRIVSLACTEIKQSTLNACWRPLLPQIVKKEDNISETVKEITRIVSSFGKEGFADIQVQDIEQLLQERSLNEEELAELIDESTSETFVEEDTNNKSALNFTYD-LKKGLDLAEELEFQLTQNDPSTIRSEKFKREFQNCLAPYKEVLKEL 609          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2A4JVK0 (HTH CENPB-type domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_10937 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.650e-59
Identity = 127/355 (35.77%), Postives = 200/355 (56.34%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFI-------NPRQC-TWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIE-NETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNG----TIAEISDEIIALAHSFGGEGFDTFNPNDIEELLTDKALNDDEVIALTMXXXXXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKELYKQLVTESRKSKQT 1381
            WKRMP + +I+KSEK A GFKA+KDR++LLLCSNASGD ++KPL++ +   PRAL++++   LPV W A+ KAWV  A+F +WF+NCF        ++K   F + +       +PR+  T     +      TF       L+QP+DQGII  FK +YI+ T++ IL+ +E N  + + E WKKF I  CI ++  ++  ++  TL  CWK +WP  + GN      I  ++  I  +A   G +GF+    +D++ELL  +  +  E     M     +E  + +     VTF  K + EGL++ N L +FF+  D + ER+L F+  + N  + Y+   K+L+  +++ K T
Sbjct:  196 WKRMPNKIFISKSEKSAPGFKAAKDRVTLLLCSNASGDCVIKPLMLYRCLNPRALQNQNKDNLPVFWRADKKAWVTSAVFCDWFRNCFVPEVETYLKSKNLDFKAVLVLDNAPGHPRELGTMHPNIKV-----TFLPPNTTALLQPMDQGIIQAFKLYYIRRTFKFILDNMECNPDMSVMECWKKFDIAKCIINIKESLQELKPHTLKSCWKKLWPVLMAGNEEESLQIQSLAANIAEIASEIGRDGFEQIESSDVQELLASQDEDLTETDLEEMINSQPMEEEEALTSTGNVTFNMKNLSEGLRMANELCDFFMKIDPSMERSLIFKRKIANATAEYQSELKELLKTAKQEKNT 545          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 8.760e-30
Identity = 93/349 (26.65%), Postives = 156/349 (44.70%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQ--PLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHSFGGEGFDTFNPNDIEELLTDKALNDDEVIALTMXXXXXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKELYKQLVTESRKSKQTFISNF 1396
            WKRMPA T++++ EK A GFKASKDR++LL+ +NA+GD  LKPL++     PRALK      LPV W +N K W+  ++F +W KN F                       C    KY    C       K   L+   P     ++   +H ++ T E I+   + +   + E W+ + I+D I+++  A N +   TLN CW  +W EC      + +  ++I  +       GF     +++E+     ++ +D+    T                   TFT + + E  +        +  +D N ER+ +    +   +S Y ELY   + + R++ ++ I+ F
Sbjct:  194 WKRMPASTFLSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRALKGCIKADLPVIWRSNKKGWITASVFLDWLKNHF-----------------------CPAIEKY----CKKKNLDHKALLLLNNAPGHPPTLSELSEH-VRGTMEQIVANTDKDVQTIREFWRSYNIMDAIDNINEAWNEVAQTTLNACWGKLWKECKHDLTGLQDPVNDIHRIVELARNAGF-----HEVEQRKGLVSVEEDDGAEATKTPTP--------------TFTLRNLAEANRRIEEGLAIYARNDPNQERSSEVNRVIRKAMSCYTELY---LEKQRQASESKINRF 492          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010132.1 (pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 gene:ENSPMAG00000009170.1 transcript:ENSPMAT00000010132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 4.708e-29
Identity = 41/88 (46.59%), Postives = 59/88 (67.05%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCF 619
            WKRMPA T++++ +K A GFKASKDR++LL+ +N +GD  LKPL++     PR LK      LP+ W +N K W+  ++F +W KN F
Sbjct:  191 WKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFLDWLKNHF 277          

HSP 2 Score: 40.4318 bits (93), Expect = 4.708e-29
Identity = 16/56 (28.57%), Postives = 28/56 (50.00%), Query Frame = 2
Query:  815 STYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPEC 982
            S +  I+   + +   + E W  + I+D I+++  A N +   TLN  W  +W EC
Sbjct:  312 SEHVKIVANTDKDVQIIREFWHSYNIMDAIDNINEAWNEVAQTTLNAYWGKLWKEC 367          

HSP 3 Score: 39.2762 bits (90), Expect = 4.708e-29
Identity = 15/28 (53.57%), Postives = 20/28 (71.43%), Query Frame = 3
Query:  618 FLPEVEIYLRQKGLDFKVLLILDNAPGH 701
            F P +E Y ++K LD K LL+ +NAPGH
Sbjct:  277 FCPAIEKYCKKKNLDLKALLLRNNAPGH 304          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001313.1 (pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gene:ENSPMAG00000001181.1 transcript:ENSPMAT00000001313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 4.904e-29
Identity = 41/88 (46.59%), Postives = 59/88 (67.05%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCF 619
            WKRMPA T++++ +K A GFKASKDR++LL+ +N +GD  LKPL++     PR LK      LP+ W +N K W+  ++F +W KN F
Sbjct:  192 WKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFLDWLKNHF 278          

HSP 2 Score: 40.4318 bits (93), Expect = 4.904e-29
Identity = 16/56 (28.57%), Postives = 28/56 (50.00%), Query Frame = 2
Query:  815 STYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPEC 982
            S +  I+   + +   + E W  + I+D I+++  A N +   TLN  W  +W EC
Sbjct:  313 SEHVKIVANTDKDVQIIREFWHSYNIMDAIDNINEAWNEVAQTTLNAYWGKLWKEC 368          

HSP 3 Score: 39.2762 bits (90), Expect = 4.904e-29
Identity = 15/28 (53.57%), Postives = 20/28 (71.43%), Query Frame = 3
Query:  618 FLPEVEIYLRQKGLDFKVLLILDNAPGH 701
            F P +E Y ++K LD K LL+ +NAPGH
Sbjct:  278 FCPAIEKYCKKKNLDLKALLLRNNAPGH 305          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006798.1 (pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 gene:ENSPMAG00000006139.1 transcript:ENSPMAT00000006798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 7.567e-27
Identity = 96/387 (24.81%), Postives = 163/387 (42.12%), Query Frame = 2
Query:  401 RASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SF---------------INPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQG-IIATFKKHYIKSTYESILNKIENETLP-LSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEIS---DEIIALAHSFGGEGFDTFNPNDIEELLTDKALNDDEVIALTMXXXXXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKELYKQLVTESRKSKQTFIS-NFAVHKSVSKQKRGEIDADFNETESLGSSSENEMIL 1498
            + +G  AS DR +      A     L  + +N+   PRALK      LPV+W AN  AW+   +  +WF   F   S      +   F                  INP                         L+QPLDQG +++TFK +Y++ T   +L   +    P + + WK + I D IN++ ++ + ++  T+N  W AIW ECV       E+S    +++ L    GGEGF     +D+ ELL   + N++  +   M      E  +     N    T K +   L   + L    +  D + ER+L+F+  LN+ I+ YKE++ Q     + +   F+   FA   + +    G   +  +   +  +S+ ++++L
Sbjct:  148 KVTGESASADREAA-----AKFPEELHAITVNRSLNPRALKGLSRNMLPVHWTANKMAWMTGQIMEDWFTQHFLVESERYCRKENLAFKVLLILDNAPGYPKHLANINPNVRV------------LLLPPNTASLLQPLDQGGVVSTFKAYYLRRTISQLLEGTDGPDKPTVRDCWKAYNIRDAINNIKSSWDDVKQSTMNCAWNAIWKECVIYLNCFPEMSTAVQDVVDLGRELGGEGFSDMREDDVLELL--DSYNEELTVDDLMSIAAADEAEEQEVVLNVKDMTSKKLTYFLSQADALAQTAMDMDPSLERSLQFKRALNSIIAPYKEVHAQKQRAKQCTMFQFLRLRFATPSTSTIDPAGPSTSTIDPAPTCSTSTASQLLL 515          

HSP 2 Score: 53.1434 bits (126), Expect = 1.914e-7
Identity = 29/51 (56.86%), Postives = 36/51 (70.59%), Query Frame = 3
Query:  618 FLPEVEIYLRQKGLDFKVLLILDNAPGH----VNIEHNNVKILFIPPNTTS 758
            FL E E Y R++ L FKVLLILDNAPG+     NI + NV++L +PPNT S
Sbjct:  215 FLVESERYCRKENLAFKVLLILDNAPGYPKHLANI-NPNVRVLLLPPNTAS 264          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003106.1 (pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 gene:ENSPMAG00000002845.1 transcript:ENSPMAT00000003106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 5.250e-22
Identity = 73/288 (25.35%), Postives = 131/288 (45.49%), Query Frame = 2
Query:  509 PRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*D-----TFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLP-LSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHSFGGEGFDTFNPNDIEELLTDKA--LNDDEVIALTMXXXXXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFFILHDTNYERALKFQCDLNNCISGYKELYKQ 1348
            PRALK      LPV W +N KA V  A+F EWF+  F         T    F + +        C   + +  D      F +     L+QP+DQG++++FK +Y++ T+   ++  + E  P L+E WK F+ILD + ++A +   ++   LN  W+ + PE V+      +  +E+        G+      P D+ ELL   A  L++++++ L     +E             + + K++ E  Q           +D N+ER+ K    + +  + Y+E+Y++
Sbjct:  184 PRALKGYTKNTLPVIWKSNPKARVTGAIFEEWFRVYFVPAVKEYCRTNNLAFKAILVLDNA--PCHPVSVEGFDPNIKVVFLTPNTTALLQPMDQGVMSSFKAYYLRQTFAQAISATDKEGGPTLTEFWKGFSILDAVKNIAASWKEMKQSNLNGVWRKLCPEFVSNFQGFTDTVEEVTENVVEMAGQLQLEVAPEDVGELLASHAHELSNEDLLQLEQQRLEEETQTQETPHP---SLSTKVLSEAFQHFETGMALLEKNDPNFERSSKASEIIRSGYTCYREIYRE 466          

HSP 2 Score: 48.1358 bits (113), Expect = 7.581e-6
Identity = 24/52 (46.15%), Postives = 36/52 (69.23%), Query Frame = 3
Query:  612 IAFLPEVEIYLRQKGLDFKVLLILDNAPGH-VNIE--HNNVKILFIPPNTTS 758
            + F+P V+ Y R   L FK +L+LDNAP H V++E    N+K++F+ PNTT+
Sbjct:  218 VYFVPAVKEYCRTNNLAFKAILVLDNAPCHPVSVEGFDPNIKVVFLTPNTTA 269          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 54.299 bits (129), Expect = 1.134e-7
Identity = 51/216 (23.61%), Postives = 91/216 (42.13%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFINPRQCTWSCKYRT*QC*DTFYSTKYDKLIQP----------LDQGIIATFKKHYIKSTYESILNKIENETLPLS--EIWKKFTILDCINHVANAINRIRSMTLNLCWKA 967
            ++ +P +  + ++E        S +R+++ LC N  G+   KPLVI     P      D + LPV W AN +AW+  ++F +W +     R     + +   F     P   T               + K   LI+P          L QGI+  F+  Y +    S L K+++   P S  ++ ++ T LD    +A  ++ I   T+  C+++
Sbjct:  173 YRALPDKNLVPETES------TSTERLTVTLCCNMDGE-FEKPLVIGPTANPPCFAKLDSECLPVIWRANRRAWITTSIFADWLRT--LDRKMRQKDRRILLFLDNSPPHPPTLQ-----------LTNVKLVFLIKPSNNTVNQLQPLTQGIVEAFRMAYRRKVLFSTLAKLDDSNSPRSAKQLMQEITELDACFWIAATLDEISGSTMMNCFES 368          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.532 bits (397), Expect = 1.549e-40
Identity = 92/275 (33.45%), Postives = 148/275 (53.82%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFI---NPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIE-NETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISDEI--------IALAHSFGGEGFDTFNPNDIEELLT--DKALNDDEVIALT 1138
            WK++P       S+ +ASGF+  KDR++L++C NA+G  ++KP +I++   PRALK+K++  LPV WM N+ AW+ KAL   WFK CF          K   F   +   N         +   Q    F       LIQP+DQGII TFK  Y ++T + +++ ++ ++     + W+++TI  C+ H+  A   ++S TLN CW+ +WPE V  N T + + DEI        ++LA    G+GFD    +D+  L+    + L D+++  +T
Sbjct:  167 WKQIP-------SQAKASGFRGQKDRVTLVMCGNAAG-FMIKPGLISRLKNPRALKNKNMSALPVYWMHNTMAWMTKALNLNWFKGCFIPEVKGYLTEKGLDFKVLLLIDNAGGFADDLSHDGVQI--EFLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHLVDAMDSDQNFSFKDYWREYTIASCLQHIQRAHQEMKSETLNGCWEKLWPEAVH-NPTESRL-DEIHRSVVETAVSLAKRLRGDGFDEITSDDVNSLIDAHSQPLTDEDLAEMT 429          

HSP 2 Score: 61.2326 bits (147), Expect = 2.642e-9
Identity = 28/49 (57.14%), Postives = 39/49 (79.59%), Query Frame = 3
Query:  615 AFLPEVEIYLRQKGLDFKVLLILDNAPGHV-NIEHNNVKILFIPPNTTS 758
             F+PEV+ YL +KGLDFKVLL++DNA G   ++ H+ V+I F+PPNT+S
Sbjct:  245 CFIPEVKGYLTEKGLDFKVLLLIDNAGGFADDLSHDGVQIEFLPPNTSS 293          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 1.717e-40
Identity = 87/233 (37.34%), Postives = 131/233 (56.22%), Query Frame = 2
Query:  356 WKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLVINKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNISETKRS*F*SFI---NPRQCTWSCKYRT*QC*DTFYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIE-NETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTG--NGTIAEISDEIIALA 1036
            WKRMP+RT+I + E +A GFKA KDR++L+ C NA+G  ++KP +I +   PRALK+K+   L V WM N+KAW+ KAL  +WFKNCF  +       K   F   +   N         Y   Q    F       LIQP+DQGII  FK  Y ++T + +++ ++ ++   L + W+ +TI  C+ ++  AI  +++ TLN CWK +WPE V     G++ E+    +  A
Sbjct:  121 WKRMPSRTFIMQEEAKAPGFKAQKDRLTLVKCGNAAG-FMIKPGLIYRSKNPRALKNKNKDDLHVCWMYNAKAWMTKALNLDWFKNCFIPQVKCYLRGKGLDFKVLLLVDNAGGHADDLAYDCVQI--KFLPPNTTSLIQPMDQGIIRAFKALYTRNTLQHLVDAMDSDQDSSLKDYWRGYTIASCLQNIQRAIQEMKTETLNACWKKLWPEAVQNPTGGSLDEVHRSAVDAA 350          

HSP 2 Score: 65.4698 bits (158), Expect = 8.128e-11
Identity = 29/49 (59.18%), Postives = 40/49 (81.63%), Query Frame = 3
Query:  615 AFLPEVEIYLRQKGLDFKVLLILDNAPGHV-NIEHNNVKILFIPPNTTS 758
             F+P+V+ YLR KGLDFKVLL++DNA GH  ++ ++ V+I F+PPNTTS
Sbjct:  206 CFIPQVKCYLRGKGLDFKVLLLVDNAGGHADDLAYDCVQIKFLPPNTTS 254          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 215.312 bits (547), Expect = 1.104e-63
Identity = 104/120 (86.67%), Postives = 108/120 (90.00%), Query Frame = 2
Query:  734 FYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHSFGGEGFDTFNPNDIEEL 1093
            F       LIQPLDQGIIA FKK+YIKSTYESIL KIENETLPLS+IWKKFTILDCINHVANAIN+IR MTLNLCWKAIWPECVTGNGTIAEISDEIIALAH FGGEGF+TFN NDIEEL
Sbjct:   47 FIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESIL-KIENETLPLSKIWKKFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHLFGGEGFETFNQNDIEEL 165          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 215.312 bits (547), Expect = 7.310e-63
Identity = 104/120 (86.67%), Postives = 108/120 (90.00%), Query Frame = 2
Query:  734 FYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHSFGGEGFDTFNPNDIEEL 1093
            F       LIQPLDQGIIA FKK+YIKSTYESIL KIENETLPLS+IWKKFTILDCINHVANAIN+IR MTLNLCWKAIWPECVTGNGTIAEISDEIIALAH FGGEGF+TFN NDIEEL
Sbjct:  108 FIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESIL-KIENETLPLSKIWKKFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHLFGGEGFETFNQNDIEEL 226          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 215.312 bits (547), Expect = 9.210e-63
Identity = 104/120 (86.67%), Postives = 108/120 (90.00%), Query Frame = 2
Query:  734 FYSTKYDKLIQPLDQGIIATFKKHYIKSTYESILNKIENETLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHSFGGEGFDTFNPNDIEEL 1093
            F       LIQPLDQGIIA FKK+YIKSTYESIL KIENETLPLS+IWKKFTILDCINHVANAIN+IR MTLNLCWKAIWPECVTGNGTIAEISDEIIALAH FGGEGF+TFN NDIEEL
Sbjct:  116 FIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESIL-KIENETLPLSKIWKKFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGNGTIAEISDEIIALAHLFGGEGFETFNQNDIEEL 234          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000032104.1 (SMESG000032104.1)

HSP 1 Score: 101.679 bits (252), Expect = 9.180e-24
Identity = 48/113 (42.48%), Postives = 74/113 (65.49%), Query Frame = 2
Query:  797 KKHYIKSTYESILNKIENET-LPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGNGTIAEISDE---IIALAHSFGGEGFDTFNPNDIEELLTDKALNDDE 1123
            + +YI+ T++ IL+++++++ L +S++WK FTILDC+  VA A+  +R  TLN  WK IWPE V  N  I  + DE   I+ LAHS GGEGF+     D++E L +  L ++E
Sbjct:  120 QAYYIRQTFKKILDEMDSDSSLTVSQVWKNFTILDCVKIVALAVEELRPSTLNGSWKPIWPEVVLLNNRIQPVVDEYRAIVDLAHSLGGEGFEDLAIQDVKEFLVEPNLGEEE 232          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000034930.1 (SMESG000034930.1)

HSP 1 Score: 102.834 bits (255), Expect = 4.723e-22
Identity = 56/150 (37.33%), Postives = 87/150 (58.00%), Query Frame = 2
Query:  824 ESILNKIENE-TLPLSEIWKKFTILDCINHVANAINRIRSMTLNLCWKAIWPECVTGN----GTIAEISDEIIALAHSFGGEGFDTFNPNDIEELLTDKALNDDEVIALTMXXXXXXXXXXXXXXXXPVTFTEKIIREGLQLCNNLENFF 1258
            E + +K+EN+ +L + + WKKFTILD + H+  +  +I+  TL+ CWKA+WP+ V  N     ++ +   +II LAH+ GGEGFD     DI E++ D+ LN+D++I       +     D   E+ P  FT K +RE L +   L N+F
Sbjct: 1002 EELKHKLENDGSLLIIDAWKKFTILDSVRHIGISYRKIKKSTLHACWKAVWPDVVDENINLTVSLGQEYSDIIELAHTIGGEGFDDLAQRDINEVMEDQELNEDDLIEFVNKVSENDVETDVDVEDEPDPFTVKFVRERLAIGRKLGNYF 1151          
The following BLAST results are available for this feature:
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIGD11.816e-3730.97tigger transposable element derived 1 [Source:HGNC... [more]
JRKL2.494e-2129.88JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
TIGD23.189e-2129.55tigger transposable element derived 2 [Source:HGNC... [more]
TIGD23.189e-2129.55tigger transposable element derived 2 [Source:HGNC... [more]
JRK2.011e-1729.23Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kif63.764e-1225.81kinesin family member 6 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000046714.13.446e-1041.77pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
apmapl2.739e-725.40adipocyte plasma membrane associated protein LIKE ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tigd21.534e-2130.29tigger transposable element derived 2 [Source:MGI ... [more]
Jrkl6.119e-2129.35Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Jrk4.540e-1626.87jerky [Source:MGI Symbol;Acc:MGI:106214][more]
Tigd41.652e-926.54tigger transposable element derived 4 [Source:MGI ... [more]
Tigd57.646e-729.59tigger transposable element derived 5 [Source:MGI ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96MW7|TIGD1_HUMAN8.722e-3730.97Tigger transposable element-derived protein 1 OS=H... [more]
sp|Q0VBL1|TIGD2_MOUSE1.073e-2030.29Tigger transposable element-derived protein 2 OS=M... [more]
sp|Q9Y4A0|JERKL_HUMAN1.198e-2029.88Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|Q4W5G0|TIGD2_HUMAN1.532e-2029.55Tigger transposable element-derived protein 2 OS=H... [more]
sp|B2RRL2|JERKL_MOUSE4.280e-2029.35Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A034WGK83.952e-7042.09Tigger transposable element-derived protein 1 OS=B... [more]
A0A4Y2HW327.476e-7048.64Tigger transposable element-derived protein 1 OS=A... [more]
A0A4Y2B3169.572e-6438.39Tigger transposable element-derived protein 1 OS=A... [more]
T2M7L04.048e-6038.02Tigger transposable element-derived protein 1 (Fra... [more]
A0A2A4JVK01.650e-5935.77HTH CENPB-type domain-containing protein OS=Heliot... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005656.18.760e-3026.65pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000010132.14.708e-2946.59pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 g... [more]
ENSPMAT00000001313.14.904e-2946.59pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gen... [more]
ENSPMAT00000006798.17.567e-2724.81pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 g... [more]
ENSPMAT00000003106.15.250e-2225.35pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 g... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO447381.134e-723.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000036785.11.549e-4033.45pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
ENSORLT00000031980.11.717e-4037.34pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057528.11.104e-6386.67SMESG000057528.1[more]
SMESG000057528.17.310e-6386.67SMESG000057528.1[more]
SMESG000057528.19.210e-6386.67SMESG000057528.1[more]
SMESG000032104.19.180e-2442.48SMESG000032104.1[more]
SMESG000034930.14.723e-2237.33SMESG000034930.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022502 ID=SMED30022502|Name=Tigger transposable element-derived protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2570bp
GTGCCGGGAATCGTAGCGTGACTCGGGACGCATCGATCCATGAGTTATCT
AAAATAAATAGGTGGGTTTCATTGTTAAATCTCGTCTCTGTAACTCTTAA
TGGGTTAACCTATTGTAAGTATGATTCCGTAAATTGGGTCATGGAGGTTC
TGTGGGTTCAGGGAAGCTAATTATTCGGCTGTTCCGAAATAAAAATATAT
GTCTACTTTACAGGGTAGTTCACAAGCTCGTCTTCGTGATGGGGTTTCTA
CTACTTCGAGTCCTTCCAGCTCTCATATGTACCAGCGGTTTTTTGTCGGG
ATCATCTATTTGAAGTTTGAGTCACCTGATTTAAGTGAAGATGAATATCT
CCGGTTGGAAAAGAATGCCTGCTAGAACTTACATCGCCAAATCTGAAAAG
AGAGCTAGTGGATTCAAAGCAAGTAAAGATCGAATATCATTATTACTATG
TAGTAATGCATCAGGAGATAGAATATTGAAACCTCTAGTAATTAATAAAT
TTAATAGACCTCGTGCTTTAAAATCCAAGGATCTAAAACAGCTACCGGTA
AATTGGATGGCTAACAGTAAGGCCTGGGTGATTAAAGCTCTATTTACTGA
ATGGTTTAAAAATTGCTTTTTTACCAGAAGTGGAAATATATCTGAGACAA
AAAGGTCTTGATTTTAAAGTTTTATTAATCCTCGACAATGCACCTGGTCA
TGTAAATATAGAACATAACAATGTTAAGATACTTTTTATTCCACCAAATA
CGACAAGCTCATTCAGCCATTGGATCAAGGAATAATTGCAACCTTTAAAA
AACATTATATCAAAAGTACGTATGAAAGTATTTTGAATAAAATAGAAAAT
GAAACATTACCATTAAGCGAGATTTGGAAAAAATTTACAATTCTTGATTG
TATTAATCACGTTGCAAACGCTATAAATCGGATAAGGTCGATGACATTAA
ATTTATGTTGGAAAGCAATATGGCCTGAATGCGTCACAGGTAATGGAACT
ATTGCTGAAATATCAGATGAAATCATAGCTTTAGCGCATTCATTTGGCGG
GGAAGGGTTTGATACTTTCAACCCAAATGATATAGAAGAATTGCTAACAG
ATAAGGCATTAAATGATGATGAAGTTATTGCTTTAACTATGGATGCTGAC
GATGAACTAGAAAATAATGACAATGTGGAAGAAGAAAATCCTGTTACATT
TACGGAAAAAATAATTCGAGAAGGTCTACAACTCTGCAATAACCTAGAAA
ACTTTTTTATTCTTCATGATACAAATTATGAGCGAGCTTTGAAGTTTCAA
TGCGACCTGAACAATTGTATTTCTGGATATAAAGAACTGTATAAACAATT
AGTTACTGAATCAAGAAAATCCAAGCAAACTTTTATTTCTAATTTTGCTG
TACATAAAAGCGTATCAAAGCAGAAACGTGGTGAAATTGATGCTGATTTT
AATGAAACAGAATCGTTGGGGAGTTCTTCTGAAAACGAAATGATTTTGAA
CCACGTTTCAGAAAATTGGCGCGAAGATTATTATTCAGCAACGACAGTTG
TAATTAAAATAGATTTTACTTTAATGTAGGTATATGTGAATGATAGCGAA
ACTACTATTTTTTTTAATAAAATAATTAAAAAGTAATTATGTAGATATGT
GTATTTTTTTTCACTTTCCAAACTTTTTTATGCGATTTGATCATATATAT
AAATATTGACAGTTTCAAATTATGCAGTTTTTAAAATTCTTAGAACGCAT
CTCACCTTTTCTATAAAAGTCGTAGTTTTTTGTGCGACCTTCCGCAGAAC
CCATCTACCTCACAAAAAGAGGTTTAAGTGTATGTAGTTATGAATATAGG
TATATAGATATATAGATAAAAGATGCCATATAAATTTTAACAAATGGAGA
TGAAATTTTATGTATTTAATTATTGGTAAGTATTTTTTTCATTTTTTAAC
GCTGTATCAACAAATTCGAGTACCGCACAAATTTATTGAATTTATTGATT
TAGCCTTCTAAAAATGAACCGAAAAAAGATTGAATATTATCGATCAATAG
TGATGTAGATAAAAGATTTTACTAACAGAAACAAACAAAATTTAAGTGAC
ACACATAGACATGAAGCGAATTATGATTTTGAATTGAAAACTATTAAAAA
AATTAGTGAATAAATGCAGAAGTGTATATTGGTTTTATACAGAATATATA
ATAATTTCAATTGGAAATTAAAAGTTCTTAGATTCAACAATAGTAATTTA
TTGTCCTATGTCGAGAAGTGTTACATAATACCTTTATCATTGAAAATGTA
TTTAACCGGAGTAATTAGTACCAAATTCTGTTTCACTAAGTTTCTGGAAT
TATTACATATGGTAGTTTTTCGTTAGTCAATTATTTCACTTGGAAGTTTA
ATATAATCATATAAACTTCAAATATATATATATTCAGCAGACTTTCAATG
TTTCTCGACATACTGTTAATTATTTCATTTTACATTTAAAATTTTTATAT
TTATAAAATTTTCATCGTGTAAAAATTTATTTATTCTTGATTTATTTATA
AACTTTATTCATTTTTTCCC
back to top

protein sequence of SMED30022502-orf-1

>SMED30022502-orf-1 ID=SMED30022502-orf-1|Name=SMED30022502-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MTLNLCWKAIWPECVTGNGTIAEISDEIIALAHSFGGEGFDTFNPNDIEE
LLTDKALNDDEVIALTMDADDELENNDNVEEENPVTFTEKIIREGLQLCN
NLENFFILHDTNYERALKFQCDLNNCISGYKELYKQLVTESRKSKQTFIS
NFAVHKSVSKQKRGEIDADFNETESLGSSSENEMILNHVSENWREDYYSA
TTVVIKIDFTLM*
back to top

protein sequence of SMED30022502-orf-2

>SMED30022502-orf-2 ID=SMED30022502-orf-2|Name=SMED30022502-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MNISGWKRMPARTYIAKSEKRASGFKASKDRISLLLCSNASGDRILKPLV
INKFNRPRALKSKDLKQLPVNWMANSKAWVIKALFTEWFKNCFFTRSGNI
SETKRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004875DDE_SF_endonuclease_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding