Fatty acid-binding protein, heart

Overview
NameFatty acid-binding protein, heart
Smed IDSMED30022501
Length (bp)675
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fatty acid-binding protein, heart (SMED30022501) t-SNE clustered cells

Violin plots show distribution of expression levels for Fatty acid-binding protein, heart (SMED30022501) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fatty acid-binding protein, heart (SMED30022501) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fatty acid-binding protein, heart (SMED30022501) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022501

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022501SMESG000029500.1 dd_Smed_v4_599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022501SMESG000029500.1 dd_Smed_v6_599_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30022501SMESG000029500.1 dd_Smed_v6_599_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fatty acid-binding protein, heart vs. Ensembl Human
Match: FABP3 (fatty acid binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3557])

HSP 1 Score: 119.398 bits (298), Expect = 9.147e-34
Identity = 66/138 (47.83%), Postives = 87/138 (63.04%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            V+ F+G+W L  + NFD+YMK+LGVG+  R+V +   PT  I   GDI+ +KT STFKNTEI F+LG EF E TAD+  VKS V LDG  LVH Q K DG+  T+++  +D   +L +   T        VCTR Y+K
Sbjct:    2 VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQ-KWDGQETTLVRELIDGKLILTLTHGT-------AVCTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Human
Match: FABP3 (fatty acid binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3557])

HSP 1 Score: 119.013 bits (297), Expect = 1.215e-33
Identity = 66/138 (47.83%), Postives = 87/138 (63.04%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            V+ F+G+W L  + NFD+YMK+LGVG+  R+V +   PT  I   GDI+ +KT STFKNTEI F+LG EF E TAD+  VKS V LDG  LVH Q K DG+  T+++  +D   +L +   T        VCTR Y+K
Sbjct:    2 VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQ-KWDGQETTLVRELIDGKLILTLTHGT-------AVCTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Human
Match: FABP7 (fatty acid binding protein 7 [Source:HGNC Symbol;Acc:HGNC:3562])

HSP 1 Score: 118.627 bits (296), Expect = 1.975e-33
Identity = 66/139 (47.48%), Postives = 85/139 (61.15%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            VE F  +W L ++ NFD YMKALGVG+  R+VGN   PT  I+ EGD V+I+T STFKNTEI FQLG+EF E TAD+   KS V LDG+ LVH Q K DG+    ++   D   ++ +          +VV  R Y+K 
Sbjct:    2 VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQ-KWDGKETNFVREIKDGKMVMTLTF-------GDVVAVRHYEKA 132          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Human
Match: FABP4 (fatty acid binding protein 4 [Source:HGNC Symbol;Acc:HGNC:3559])

HSP 1 Score: 118.242 bits (295), Expect = 2.731e-33
Identity = 63/116 (54.31%), Postives = 82/116 (70.69%), Query Frame = 2
Query:  146 EKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLV 493
            + F+G+W L S++NFD+YMK +GVG+  RKV     P   I++ GD++ IK+ STFKNTEI F LG+EF EVTAD+  VKST+ LDG VLVH Q K DG+  TI KR  + D L+V
Sbjct:    3 DAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQ-KWDGKSTTI-KRKREDDKLVV 116          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Human
Match: PMP2 (peripheral myelin protein 2 [Source:HGNC Symbol;Acc:HGNC:9117])

HSP 1 Score: 117.087 bits (292), Expect = 5.941e-33
Identity = 71/137 (51.82%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  149 KFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            KF+G+W L S++NFD+YMKALGVG   RK+GN   PT  I+ +GDI+ I+T STFKNTEI F+LG+EF E TADN   KS V L    L   Q + DG+  TI ++ ++      MV E K  KG  VVCTR Y+KV
Sbjct:    4 KFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQ-RWDGKETTIKRKLVNGK----MVAECKM-KG--VVCTRIYEKV 132          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Celegans
Match: lbp-6 (Fatty acid-binding protein homolog 6 [Source:UniProtKB/Swiss-Prot;Acc:O01812])

HSP 1 Score: 100.523 bits (249), Expect = 7.624e-27
Identity = 55/136 (40.44%), Postives = 81/136 (59.56%), Query Frame = 2
Query:  146 EKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVK-EDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKY 550
            ++F+G W L  ++NF+ YMK +GVG I RK   ++ PT  I +EGD+      STFKNT + F+LG+EF E T D  TVKS V  +    +H Q K +D +  +I+ R+L+ D  L+  LE+ +     VV  R+Y
Sbjct:    3 QEFVGRWKLIHSENFEEYMKEVGVGLITRKAAANLKPTLEIKVEGDLWYSNQYSTFKNTTLSFKLGQEFDETTPDGRTVKSVVNFENGKFIHIQKKIKDSDKESIITRWLEGDK-LITTLESGS-----VVSRREY 132          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Celegans
Match: lbp-7 (Fatty acid-binding protein homolog 7 [Source:UniProtKB/Swiss-Prot;Acc:O02323])

HSP 1 Score: 85.8853 bits (211), Expect = 3.276e-21
Identity = 45/136 (33.09%), Postives = 76/136 (55.88%), Query Frame = 2
Query:  152 FIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVK-EDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            FIG W L  T+NFD YMK +GVG I RK    + P   I ++G+       STFKNT++ F+LG+EF E + D+ T  S    +   L H+Q K ++    +++  +L++  L+      +  +  +V+C R++++
Sbjct:    7 FIGRWKLVQTENFDEYMKEIGVGLITRKAAAHLKPILEIRLDGETWNFDQFSTFKNTKLSFKLGEEFVENSPDDRTYNSLFTFENGKLTHRQNKIKENHKSSVLTTWLENGKLI------QTYQSGDVICRREWER 136          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Celegans
Match: lbp-5 (Fatty acid-binding protein homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:O01814])

HSP 1 Score: 85.1149 bits (209), Expect = 5.782e-21
Identity = 41/117 (35.04%), Postives = 70/117 (59.83%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVK-EDGEIRTIMKRYLDSDDLL 490
             E+F+G W L  ++NF++Y+K +GVG ++RK   +  PT  I + G+   +   STFKNT + F LG EF E T D    KST+ ++   +VH Q + +D +  +++ R+ + + L+
Sbjct:    3 AEQFVGRWKLVESENFEDYLKEVGVGLLLRKAACAAKPTLEIKVNGNKWHVNQLSTFKNTTLEFTLGVEFDETTPDGRQFKSTITIEDGKVVHVQKRIKDSDHDSVITRWFEGEKLI 119          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Celegans
Match: lbp-9 (Fatty acid-binding protein homolog 9 [Source:UniProtKB/Swiss-Prot;Acc:Q965W1])

HSP 1 Score: 76.6406 bits (187), Expect = 1.645e-17
Identity = 44/153 (28.76%), Postives = 77/153 (50.33%), Query Frame = 2
Query:  101 YFIICHLKIKMSSEVEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            +F   H  ++        +G W   S++NFD Y+K +GVG+ +R +     P     + GD   + + STFKN  ++++LG    E TAD   V S   ++ + LV  +  + G   + ++RY+++  L+++   T N     V CTR Y+K 
Sbjct:    5 FFKTAHCALRNMPIQTDLVGKWNFVSSENFDEYLKEVGVGWAIRTIATKTKPALEFAVNGDEWTMNSNSTFKNYTLKWKLGTASDEKTADGRDVSSVFSIENDHLVQIETGKGGGKDSRIERYIENGKLVIVC--TCNG----VKCTRVYEKA 151          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Celegans
Match: lbp-8 (Lipid Binding Protein [Source:UniProtKB/TrEMBL;Acc:O02324])

HSP 1 Score: 75.8702 bits (185), Expect = 2.302e-17
Identity = 39/139 (28.06%), Postives = 76/139 (54.68%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELD-GNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            +++FIG W L  ++NF+ Y+K +GVG ++RK  +  SPT  I ++GD       STFKN ++ F++ ++F E+  D  +  + V  + G  + H+   ++    ++   +L++  LL      +  +   V+C R++ K
Sbjct:    4 MKEFIGRWKLVHSENFEEYLKEIGVGLLIRKAASLTSPTLEIKLDGDTWHFNQYSTFKNNKLAFKIREKFVEIAPDERSYNTLVTFENGKFISHQDKIKENHHSSVFTTWLENGKLL------QTYQSGSVICRREFVK 136          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Fly
Match: fabp (gene:FBgn0037913 transcript:FBtr0100321)

HSP 1 Score: 89.7373 bits (221), Expect = 1.104e-22
Identity = 61/137 (44.53%), Postives = 83/137 (60.58%), Query Frame = 2
Query:  152 FIGS-WGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            F+G  + LD ++NFD YMK LGVG + RK+GNS+SPT  + +EGD   + TTSTFK + I F+LG EF E T D   VKS + LDGN L  +Q  +  +  TI++ + D++  L+  L   N     V C R YK V
Sbjct:    3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDEETLDGRNVKSIITLDGNKLTQEQ--KGDKPTTIVREFTDNE--LITTLTIGN-----VKCVRVYKAV 130          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Fly
Match: fabp (gene:FBgn0037913 transcript:FBtr0100323)

HSP 1 Score: 86.2705 bits (212), Expect = 4.414e-21
Identity = 53/117 (45.30%), Postives = 74/117 (63.25%), Query Frame = 2
Query:  152 FIGS-WGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMV 499
            F+G  + LD ++NFD YMK LGVG + RK+GNS+SPT  + +EGD   + TTSTFK + I F+LG EF E T D   VKS + LDGN L  +Q    G+  T + R    ++L+ ++
Sbjct:    3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDEETLDGRNVKSIITLDGNKLTQEQ---KGDKPTTIVREFTDNELITLI 116          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Fly
Match: fabp (gene:FBgn0037913 transcript:FBtr0100320)

HSP 1 Score: 69.3218 bits (168), Expect = 4.628e-15
Identity = 52/121 (42.98%), Postives = 71/121 (58.68%), Query Frame = 2
Query:  197 YMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            +  + GVG + RK+GNS+SPT  + +EGD   + TTSTFK + I F+LG EF E T D   VKS + LDGN L  +Q K D +  TI++ + D++  L+  L   N K     C R YK V
Sbjct:    6 HHSSFGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDEETLDGRNVKSIITLDGNKLTQEQ-KGD-KPTTIVREFTDNE--LITTLTIGNVK-----CVRVYKAV 117          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Zebrafish
Match: fabp7b (fatty acid binding protein 7, brain, b [Source:ZFIN;Acc:ZDB-GENE-040614-4])

HSP 1 Score: 116.316 bits (290), Expect = 7.706e-33
Identity = 62/111 (55.86%), Postives = 77/111 (69.37%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLD 475
            V+ F G+W L S+DNFD YMK+LG+G+  R+VGN   PT  I+ EG+ V+IKT STFKNTEI F LG+EF E TAD+   KSTV L GN LVH Q K DG+  T ++   D
Sbjct:    2 VDAFCGTWKLVSSDNFDEYMKSLGIGFATRQVGNVTKPTLVISKEGEKVVIKTQSTFKNTEISFTLGEEFEETTADDRHCKSTVLLKGNQLVHVQ-KWDGKETTFIREIKD 111          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Zebrafish
Match: fabp3 (fatty acid binding protein 3, muscle and heart [Source:ZFIN;Acc:ZDB-GENE-020318-2])

HSP 1 Score: 116.316 bits (290), Expect = 7.848e-33
Identity = 62/140 (44.29%), Postives = 87/140 (62.14%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVK 562
             + FIG+W L  + NFD YMK +GVG+  R+V N   PT  I+ EGD+  +KT STFK+TEI F+LG+EF E TAD+  VKS + LDG  L+H Q K DG+  T+++   D++  L + L        ++V TR Y K +
Sbjct:    2 ADAFIGTWNLKESKNFDEYMKGIGVGFATRQVANMTKPTTIISKEGDVFTLKTVSTFKSTEINFKLGEEFDETTADDRKVKSVITLDGGKLLHVQ-KWDGKETTLLREVSDNNLTLTLTL-------GDIVSTRHYVKAE 133          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Zebrafish
Match: fabp7a (fatty acid binding protein 7, brain, a [Source:ZFIN;Acc:ZDB-GENE-000627-1])

HSP 1 Score: 109.768 bits (273), Expect = 2.654e-30
Identity = 59/121 (48.76%), Postives = 79/121 (65.29%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLE 505
            V+ F  +W L  + NFD YMK+LGVG+  R+VGN   PT  I+ EGD V+IKT STFKNTEI F+LG+EF E TAD+  VKSTV L+G+ LV  Q + DG+    ++   D   ++ +  E
Sbjct:    2 VDAFCATWKLVDSQNFDEYMKSLGVGFATRQVGNVTKPTIVISHEGDKVVIKTLSTFKNTEISFKLGEEFDETTADDRHVKSTVSLEGDNLVQVQ-RWDGKETKFVREIKDGKMVMTLTFE 121          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Zebrafish
Match: fabp7a (fatty acid binding protein 7, brain, a [Source:ZFIN;Acc:ZDB-GENE-000627-1])

HSP 1 Score: 108.227 bits (269), Expect = 7.410e-30
Identity = 57/101 (56.44%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGE 445
            V+ F  +W L  + NFD YMK+LGVG+  R+VGN   PT  I+ EGD V+IKT STFKNTEI F+LG+EF E TAD+  VKSTV L+G+ LV  Q + DG+
Sbjct:    2 VDAFCATWKLVDSQNFDEYMKSLGVGFATRQVGNVTKPTIVISHEGDKVVIKTLSTFKNTEISFKLGEEFDETTADDRHVKSTVSLEGDNLVQVQ-RWDGK 101          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Zebrafish
Match: fabp11a (fatty acid binding protein 11a [Source:ZFIN;Acc:ZDB-GENE-040912-132])

HSP 1 Score: 88.9669 bits (219), Expect = 3.622e-22
Identity = 46/112 (41.07%), Postives = 71/112 (63.39%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINM-EGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLD 475
            V+KF+G+W + ++DNFD YMKA+GVG+  R+VGN   P   + + E  ++ +K+ STFK TEI+F+L + F E TAD+    + + ++   LV KQ   DG+  TI +   D
Sbjct:    2 VDKFVGTWKMTTSDNFDEYMKAIGVGFATRQVGNRTKPNLVVCVDEQGLICMKSQSTFKTTEIKFKLNEPFEETTADDRKTTTVMTIENGKLVQKQT-WDGKESTIEREVSD 112          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Xenopus
Match: fabp7 (fatty acid binding protein 7, brain [Source:NCBI gene;Acc:548661])

HSP 1 Score: 114.775 bits (286), Expect = 4.610e-32
Identity = 63/139 (45.32%), Postives = 86/139 (61.87%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            V+ F  +W L  + NFD YMKALGVG+  R+VGN   PT  IN EGD V+I+T STFKNTE+ F+LG+EF E TAD+   KSTV L+G+ LVH Q K DG+    ++   D   ++ +          ++V  R+Y+K 
Sbjct:    2 VDVFCATWKLIDSQNFDEYMKALGVGFATRQVGNVTKPTVIINQEGDKVVIRTQSTFKNTEVSFKLGEEFDEATADDRNCKSTVTLEGDKLVHVQ-KWDGKETKFVREIKDGKMIMTLTF-------GDIVSVRQYEKA 132          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Xenopus
Match: mbtd1 (mbt domain containing 1 [Source:Xenbase;Acc:XB-GENE-949653])

HSP 1 Score: 104.76 bits (260), Expect = 3.403e-28
Identity = 62/139 (44.60%), Postives = 88/139 (63.31%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            +E+F G+W L  + NFD YMK LGVG+  R++GN   PT  I+++GD V ++T STFKNTE+ F+L +EF E TAD+   KS V ++   + H Q K DG+  TI+ R +D D L++ +  T  D    VV TR Y+K 
Sbjct:    1 MERFAGTWRLVESKNFDEYMKGLGVGFATRQIGNVTKPTTIISLDGDKVKVQTQSTFKNTEVSFKLNEEFDECTADDRKCKSFVTIEDGKMKHVQ-KWDGK-ETILIREVDGDKLVLTL--TLGD----VVSTRHYEKA 131          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Xenopus
Match: pmp2 (peripheral myelin protein 2 [Source:NCBI gene;Acc:100135411])

HSP 1 Score: 96.6709 bits (239), Expect = 4.765e-25
Identity = 57/140 (40.71%), Postives = 80/140 (57.14%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVK 562
            VE+F+G+W L  +  FD YM++LGVG+  RK G    P   I++ GD +++KT ST K T++ F+LG+EF E TADN   K+ +  D  VL   Q K DG+  TI +   +    LV+     N     V C R Y+KVK
Sbjct:    2 VEQFVGTWKLTDSQGFDEYMQSLGVGFATRKAGAMAKPNVIISVNGDKILLKTESTLKTTDMTFKLGEEFDETTADNRNTKTLITCDSGVLNQVQ-KWDGKETTIQREIKNGQ--LVVTCTMGN-----VKCVRTYEKVK 133          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Xenopus
Match: pmp2 (peripheral myelin protein 2 [Source:NCBI gene;Acc:100135411])

HSP 1 Score: 92.4337 bits (228), Expect = 1.718e-23
Identity = 49/118 (41.53%), Postives = 74/118 (62.71%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVM 496
            VE+F+G+W L  +  FD YM++LGVG+  RK G    P   I++ GD +++KT ST K T++ F+LG+EF E TADN   K+ +  D  VL   Q K DG+  T ++R + +  L+V+
Sbjct:    2 VEQFVGTWKLTDSQGFDEYMQSLGVGFATRKAGAMAKPNVIISVNGDKILLKTESTLKTTDMTFKLGEEFDETTADNRNTKTLITCDSGVLNQVQ-KWDGK-ETTIQREIKNGQLVVV 117          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Xenopus
Match: ENSXETT00000055814.1 (fatty acid-binding protein, brain-like [Source:NCBI gene;Acc:100495473])

HSP 1 Score: 82.0333 bits (201), Expect = 2.578e-19
Identity = 44/114 (38.60%), Postives = 68/114 (59.65%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTD--NFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDS 478
            +E    +W L  TD  NFD Y+ AL V ++ RK   ++ P   I+ EG+++ I++ STFKN E+ F+L +EF E T D    K+TV L+  VLV +Q K +G+  T+ +   D+
Sbjct:    1 MEALCAAWALVETDKENFDRYLTALDVPFMARKAAGALKPDVIISKEGNVIKIRSESTFKNHELCFKLNEEFDEPTPDGRKTKTTVTLENGVLVQRQ-KWNGKESTVTREVKDN 113          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Mouse
Match: Fabp3 (fatty acid binding protein 3, muscle and heart [Source:MGI Symbol;Acc:MGI:95476])

HSP 1 Score: 114.775 bits (286), Expect = 3.633e-32
Identity = 64/138 (46.38%), Postives = 85/138 (61.59%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
             + F+G+W L  + NFD+YMK+LGVG+  R+V +   PT  I   GD + IKT STFKNTEI FQLG EF EVTAD+  VKS V LDG  L+H Q K +G+  T+ +  +D   +L +   +       VV TR Y+K
Sbjct:    2 ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQ-KWNGQETTLTRELVDGKLILTLTHGS-------VVSTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Mouse
Match: Fabp4 (fatty acid binding protein 4, adipocyte [Source:MGI Symbol;Acc:MGI:88038])

HSP 1 Score: 112.849 bits (281), Expect = 2.405e-31
Identity = 60/116 (51.72%), Postives = 79/116 (68.10%), Query Frame = 2
Query:  146 EKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLV 493
            + F+G+W L S++NFD+YMK +GVG+  RKV     P   I++ GD+V I++ STFKNTEI F+LG EF E+TAD+  VKS + LDG  LV  Q K DG+  TI KR  D D L+V
Sbjct:    3 DAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKVKSIITLDGGALVQVQ-KWDGKSTTI-KRKRDGDKLVV 116          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Mouse
Match: Pmp2 (peripheral myelin protein 2 [Source:MGI Symbol;Acc:MGI:102667])

HSP 1 Score: 110.923 bits (276), Expect = 1.099e-30
Identity = 66/137 (48.18%), Postives = 87/137 (63.50%), Query Frame = 2
Query:  149 KFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            KF+G+W L S+++FD+YMKALGVG   RK+GN   PT  I+ +GD + I+T S FKNTEI F+LG+EF E TADN   KS V L+   L   Q K DG+   I +  LD   ++  ++     KG  VVCTR Y+KV
Sbjct:    4 KFLGTWKLVSSEHFDDYMKALGVGLANRKLGNLAKPTVIISKKGDYITIRTESAFKNTEISFKLGQEFDETTADNRKAKSIVTLERGSLKQVQ-KWDGKETAIRRTLLDGRMVVECIM-----KG--VVCTRIYEKV 132          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Mouse
Match: Fabp7 (fatty acid binding protein 7, brain [Source:MGI Symbol;Acc:MGI:101916])

HSP 1 Score: 106.301 bits (264), Expect = 6.556e-29
Identity = 54/101 (53.47%), Postives = 68/101 (67.33%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGE 445
            V+ F  +W L  + NFD YMKALGVG+  R+VGN   PT  I+ EG  V+I+T  TFKNTEI FQLG+EF E + D+   KS V LDG+ L+H Q K DG+
Sbjct:    2 VDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFEETSIDDRNCKSVVRLDGDKLIHVQ-KWDGK 101          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Mouse
Match: Fabp7 (fatty acid binding protein 7, brain [Source:MGI Symbol;Acc:MGI:101916])

HSP 1 Score: 107.842 bits (268), Expect = 9.620e-29
Identity = 54/101 (53.47%), Postives = 68/101 (67.33%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGE 445
            V+ F  +W L  + NFD YMKALGVG+  R+VGN   PT  I+ EG  V+I+T  TFKNTEI FQLG+EF E + D+   KS V LDG+ L+H Q K DG+
Sbjct:    2 VDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFEETSIDDRNCKSVVRLDGDKLIHVQ-KWDGK 101          
BLAST of Fatty acid-binding protein, heart vs. UniProt/SwissProt
Match: sp|Q99P61|FABPH_ICTTR (Fatty acid-binding protein, heart OS=Ictidomys tridecemlineatus OX=43179 GN=FABP3 PE=2 SV=3)

HSP 1 Score: 125.561 bits (314), Expect = 1.932e-35
Identity = 69/138 (50.00%), Postives = 89/138 (64.49%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            V+ F+G+W L  + NFD+YMK+LGVG+  R+V +   PT  I   GD +I+KT STFKNTEI FQLGKEF E TAD+  VKSTV LDG  LVH Q K DG+  T+++   D   +L +   +       VVCTR Y+K
Sbjct:    2 VDAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTIILKTQSTFKNTEISFQLGKEFDETTADDRKVKSTVTLDGGKLVHVQ-KWDGQETTLVRELNDGKLILTLTHGS-------VVCTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. UniProt/SwissProt
Match: sp|P10790|FABPH_BOVIN (Fatty acid-binding protein, heart OS=Bos taurus OX=9913 GN=FABP3 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.067e-34
Identity = 68/138 (49.28%), Postives = 89/138 (64.49%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            V+ F+G+W L  + NFD+YMK+LGVG+  R+VGN   PT  I + GD VIIKT STFKNTEI F+LG EF E TAD+  VKS V LDG  LVH Q K +G+  ++++  +D   +L +   T        VCTR Y+K
Sbjct:    2 VDAFVGTWKLVDSKNFDDYMKSLGVGFATRQVGNMTKPTTIIEVNGDTVIIKTQSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHVQ-KWNGQETSLVREMVDGKLILTLTHGT-------AVCTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. UniProt/SwissProt
Match: sp|Q4TZH2|FABPH_BOSMU (Fatty acid-binding protein, heart OS=Bos mutus grunniens OX=30521 GN=FABP3 PE=3 SV=3)

HSP 1 Score: 123.635 bits (309), Expect = 1.067e-34
Identity = 68/138 (49.28%), Postives = 89/138 (64.49%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            V+ F+G+W L  + NFD+YMK+LGVG+  R+VGN   PT  I + GD VIIKT STFKNTEI F+LG EF E TAD+  VKS V LDG  LVH Q K +G+  ++++  +D   +L +   T        VCTR Y+K
Sbjct:    2 VDAFVGTWKLVDSKNFDDYMKSLGVGFATRQVGNMTKPTTIIEVNGDTVIIKTQSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHVQ-KWNGQETSLVREMVDGKLILTLTHGT-------AVCTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. UniProt/SwissProt
Match: sp|P86412|MYP2_PIG (Myelin P2 protein OS=Sus scrofa OX=9823 GN=PMP2 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 4.175e-33
Identity = 70/137 (51.09%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  149 KFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            KF+G+W L S++NFD+YMKALGVG   RK+GN   P   I+ +GDI+ I+T STFKNTEI F+LG+EF E TADN   KS V L    L   Q K DG+  TI ++ +D      MV+E K    ++VVCTR Y+KV
Sbjct:    4 KFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPRVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKAKSVVTLARGSLNQVQ-KWDGKETTIKRKLVDGK----MVVECKM---KDVVCTRIYEKV 132          
BLAST of Fatty acid-binding protein, heart vs. UniProt/SwissProt
Match: sp|P02691|MYP2_RABIT (Myelin P2 protein OS=Oryctolagus cuniculus OX=9986 GN=PMP2 PE=1 SV=3)

HSP 1 Score: 119.398 bits (298), Expect = 4.266e-33
Identity = 71/137 (51.82%), Postives = 91/137 (66.42%), Query Frame = 2
Query:  149 KFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            KF+G+W L S++NFD+YMKALGVG   RK+GN   P   I+ +GDI+ I+T STFKNTEI F+LG+EF E TADN   KS + L+   L   Q K DG+  TI ++ +D      MV+E K  KG  VVCTR Y+KV
Sbjct:    4 KFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPNVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIITLERGALNQVQ-KWDGKETTIKRKLVDGK----MVVECKM-KG--VVCTRIYEKV 132          
BLAST of Fatty acid-binding protein, heart vs. TrEMBL
Match: Q8WR15 (Cellular retinoic acid/retinol binding protein OS=Metapenaeus ensis OX=32278 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.850e-35
Identity = 71/139 (51.08%), Postives = 95/139 (68.35%), Query Frame = 2
Query:  149 KFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQV--KEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            KF G + ++S++NFD +MKALGVG +MRK+GN+ +PT  I  +GD   +KT +TFK TEI+F+LG+EF E TAD   VKSTV +DGN LVHKQ   KE  E  +I+ R    D +L   +E K D   ++VCTR YK+V
Sbjct:    3 KFEGKFRMESSENFDEFMKALGVGLVMRKMGNAATPTVEITKDGDTYSLKTVTTFKTTEIKFKLGEEFEETTADGRVVKSTVTMDGNKLVHKQTGDKEKKEKDSILTREFSDDQML---MECKVD---DIVCTRVYKRV 135          
BLAST of Fatty acid-binding protein, heart vs. TrEMBL
Match: A0A2Y9IX40 (fatty acid-binding protein, heart isoform X2 OS=Enhydra lutris kenyoni OX=391180 GN=LOC111142855 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.497e-33
Identity = 70/138 (50.72%), Postives = 90/138 (65.22%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            V+ F+G+W L  + NFD+YMK+LGVG+  R+V N   PT  I M GD +I+KT STFKNTEI F+LG EF E TAD+  VKSTV LDG  LVH Q K DG+  T+++  +D    L++ L   N      VCTR Y+K
Sbjct:    2 VDAFVGTWKLVDSKNFDDYMKSLGVGFATRQVANMTKPTTVIEMNGDTIILKTHSTFKNTEINFKLGVEFDETTADDRKVKSTVTLDGGKLVHVQ-KWDGQETTLVRELVDGK--LILTLTHGN-----AVCTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. TrEMBL
Match: A0A5N5KKZ2 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00134870 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.879e-33
Identity = 72/140 (51.43%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDL-LVMVLETKNDKGEEVVCTRKYKKV 559
             E F+G+W L  + NFD YMKALGVG+  R+VG+   PT  I+++GD V +KT STFKNTEI+F+LG+EF E TAD+  VKS V LDGN LVH Q K DG+  T + R +D + L L + L        +VVCTR Y K 
Sbjct:    2 AETFVGTWNLKESKNFDEYMKALGVGFATRQVGSMTKPTTIISVDGDAVTLKTVSTFKNTEIKFKLGEEFDETTADDRKVKSLVTLDGNKLVHVQ-KWDGK-ETSLVREVDGNSLTLTLTL-------GDVVCTRSYVKA 132          
BLAST of Fatty acid-binding protein, heart vs. TrEMBL
Match: A0A452RV25 (Fatty acid binding protein 3 OS=Ursus americanus OX=9643 GN=FABP3 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 5.084e-33
Identity = 68/138 (49.28%), Postives = 89/138 (64.49%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            V+ F+G+W L  + NFD+YMK++GVG+  R+V N   PT  I M GD +IIKT STFKNTEI F+LG EF E TAD+  VKSTV LDG  LVH Q K DG+  T+++  +D   +L +   +        VCTR Y+K
Sbjct:    2 VDAFVGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTVIEMNGDTIIIKTHSTFKNTEISFKLGVEFDETTADDRKVKSTVTLDGGKLVHVQ-KWDGQETTLVRELVDGKLILTLTHGS-------AVCTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. TrEMBL
Match: A0A3Q7XDR9 (fatty acid-binding protein, heart OS=Ursus arctos horribilis OX=116960 GN=FABP3 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 5.084e-33
Identity = 68/138 (49.28%), Postives = 89/138 (64.49%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            V+ F+G+W L  + NFD+YMK++GVG+  R+V N   PT  I M GD +IIKT STFKNTEI F+LG EF E TAD+  VKSTV LDG  LVH Q K DG+  T+++  +D   +L +   +        VCTR Y+K
Sbjct:    2 VDAFVGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTVIEMNGDTIIIKTHSTFKNTEISFKLGVEFDETTADDRKVKSTVTLDGGKLVHVQ-KWDGQETTLVRELVDGKLILTLTHGS-------AVCTRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Cavefish
Match: fabp3 (fatty acid-binding protein, heart [Source:NCBI gene;Acc:103031913])

HSP 1 Score: 123.25 bits (308), Expect = 1.570e-35
Identity = 68/139 (48.92%), Postives = 91/139 (65.47%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDL-LVMVLETKNDKGEEVVCTRKYKK 556
             E F+G+W L  + NFD+YMKALGVG+  R+VG+   PT  I++EGD++ +KT STFK TEI F+LG+EF E TAD+  VKS V +DG  +VH Q K DG+  T + R +D + L L + L        +VVCTR Y K
Sbjct:    2 AEAFVGTWNLKESKNFDDYMKALGVGFATRQVGSMTKPTTIISLEGDVITLKTVSTFKTTEINFKLGEEFDETTADDRKVKSLVTVDGGKMVHVQ-KWDGK-ETTLVREVDGNSLTLTLTL-------GDVVCTRHYTK 131          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Cavefish
Match: fabp7a (fatty acid-binding protein, brain [Source:NCBI gene;Acc:103044720])

HSP 1 Score: 117.087 bits (292), Expect = 4.106e-33
Identity = 69/139 (49.64%), Postives = 86/139 (61.87%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            V+ F  +W L  + NFD YMKALGVG+  R+VGN   PT  ++ EGD +IIKT STFKNTEI F+LG+EF E TAD+  VKSTV LDG+ LVH Q K DG+    ++   D    +VM L       E V   R Y+K 
Sbjct:    2 VDSFCATWKLVDSQNFDEYMKALGVGFATRQVGNVTKPTIVVSQEGDKIIIKTLSTFKNTEISFKLGEEFDETTADDRNVKSTVTLDGDKLVHVQ-KWDGKETKFIRELKDGK--MVMTLNF-----EGVQAVRTYEKA 132          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Cavefish
Match: fabp7a (fatty acid-binding protein, brain [Source:NCBI gene;Acc:103044720])

HSP 1 Score: 115.931 bits (289), Expect = 1.077e-32
Identity = 62/117 (52.99%), Postives = 79/117 (67.52%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLV 493
            V+ F  +W L  + NFD YMKALGVG+  R+VGN   PT  ++ EGD +IIKT STFKNTEI F+LG+EF E TAD+  VKSTV LDG+ LVH Q K DG+    ++   D   ++V
Sbjct:    2 VDSFCATWKLVDSQNFDEYMKALGVGFATRQVGNVTKPTIVVSQEGDKIIIKTLSTFKNTEISFKLGEEFDETTADDRNVKSTVTLDGDKLVHVQ-KWDGKETKFIRELKDGKMVMV 117          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Cavefish
Match: fabp11a (myelin P2 protein-like [Source:NCBI gene;Acc:103022454])

HSP 1 Score: 90.5077 bits (223), Expect = 6.953e-23
Identity = 47/112 (41.96%), Postives = 71/112 (63.39%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGD-IVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLD 475
            V+KF+G+W + S+DNFD YMKALGVG+  R+VGN   P   ++++   ++ +K+ S FK TEI+F+L + F E TAD+    + V L+   LV KQ   DG+  T+ +   D
Sbjct:    2 VDKFVGTWKMISSDNFDEYMKALGVGFATRQVGNRTKPNLLVSVDDQGLISMKSQSAFKTTEIKFKLNESFEETTADDRKTTTVVTLENGKLVQKQT-WDGKETTLEREVTD 112          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Cavefish
Match: crabp1a (cellular retinoic acid-binding protein 1 [Source:NCBI gene;Acc:103037725])

HSP 1 Score: 83.5741 bits (205), Expect = 4.038e-20
Identity = 52/140 (37.14%), Postives = 79/140 (56.43%), Query Frame = 2
Query:  152 FIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQH--INMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADN--CTVKSTVELDGNVLVHKQVKEDGE-IRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            F G+W + S++NFD  +KALGV  ++RKV  + +   H  I  +G+   IKT++T + TEI F +G+EF E T D   C   +T E D N +  KQ   DG+  +T   R L  D+L+++         ++VVCTR Y +
Sbjct:    5 FAGTWKMKSSENFDELLKALGVNAMLRKVAGAAAAKPHVEIRQDGEQFYIKTSTTVRTTEINFHVGEEFDEETVDGRKCKSLATWETD-NKIYCKQTLVDGDGPKTFWSRELRGDELILIF------GADDVVCTRIYMR 137          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Sea Lamprey
Match: FABP3 (fatty acid binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3557])

HSP 1 Score: 98.2117 bits (243), Expect = 1.370e-26
Identity = 58/139 (41.73%), Postives = 77/139 (55.40%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
             E+F G+W LD + NFD YMKA+GVG+  R V     PT  I   GD + +KT STFKNTE+  +LG+ F E TAD   V+S V ++   LV  Q K DG+  T + R L   D L++     N     VV +R Y + 
Sbjct:    2 AEQFFGTWDLDESRNFDEYMKAIGVGFATRHVAGMSKPTTIIGGSGDRICLKTLSTFKNTEVELRLGEPFEETTADERRVQSVVTVEEGKLVQVQ-KWDGK-ETRLVRELSGPDKLILTCTMGN-----VVASRIYHRA 133          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Sea Lamprey
Match: fabp7a (fatty acid binding protein 7, brain, a [Source:ZFIN;Acc:ZDB-GENE-000627-1])

HSP 1 Score: 95.9005 bits (237), Expect = 1.181e-25
Identity = 53/138 (38.41%), Postives = 83/138 (60.14%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
             E + G+W L ++ NFD+YMKA+G+ + +RK+GN   P Q I  +G+ V IK  S+FKNTE+  +LG+EF E+TAD   V+S + + G+ LV  Q  ++ E  +I+ R L    L++        +  +V C R Y+K
Sbjct:    2 AEAYCGTWRLTNSVNFDSYMKAIGISFAVRKIGNMTKPIQEIISDGENVTIKNMSSFKNTEVVCKLGEEFKEMTADGREVQSVISMQGDKLVQVQKWDNKE--SILTRELKDGKLILTC------RIGDVECVRTYEK 131          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Sea Lamprey
Match: FABP3 (fatty acid binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3557])

HSP 1 Score: 91.6633 bits (226), Expect = 5.463e-24
Identity = 59/140 (42.14%), Postives = 80/140 (57.14%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGD-IVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            VE   G+W L  + NFD Y+   GV    RKVG+   PT  I+  GD  V +KT S FKNTE+ F+LG+EF E TAD+  VKSTV  +G  +VH Q + DG   T + R L  D +++        +  +VV TR Y++V
Sbjct:    2 VEALCGTWTLVDSKNFDEYLTMQGVSMATRKVGSLTKPTVTISTCGDGTVTVKTVSAFKNTELTFRLGEEFEETTADDRKVKSTVTQEGGRVVHVQ-RWDGR-ETQLIRELQGDQMIMTC------RVGDVVSTRTYERV 133          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Sea Lamprey
Match: crabp2b (cellular retinoic acid binding protein 2, b [Source:ZFIN;Acc:ZDB-GENE-050208-52])

HSP 1 Score: 62.7734 bits (151), Expect = 4.545e-13
Identity = 41/139 (29.50%), Postives = 71/139 (51.08%), Query Frame = 2
Query:  152 FIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTE-VTADNCTVKSTVELDGN---VLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKK 556
            F G+W L +++NF+ Y+  LGV ++ +K+     PT HI+ +GD   I+  S+F+  E  F +G+EF E        ++S V+  G      + + V  +G+     +  ++ D  LV+ L  KN     V C+R + K
Sbjct:    4 FTGTWKLKTSENFEEYLHTLGVSHVTKKISTCSRPTVHISQDGDNFHIR-VSSFRTAESNFTVGQEFEEDGPWQGLRLRSLVKWAGPGKLSCIQRPVSGEGQPIFWTREIVNGD--LVLNLTFKN-----VSCSRVFAK 134          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Medaka
Match: fabp3 (fatty acid-binding protein, heart [Source:NCBI gene;Acc:101156833])

HSP 1 Score: 117.472 bits (293), Expect = 2.502e-33
Identity = 67/140 (47.86%), Postives = 92/140 (65.71%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVK 562
             E F+G+W +  ++ FD YMKALGVG+  RKVGN   PT  I+M+GD V +KT ST KNTE+ F+LG+EF E TAD+  VKS V L+   LVH Q K DG+  T + R ++ ++L + +  T  D    VVCTR+Y+K +
Sbjct:    2 AEAFVGTWNMKESEKFDEYMKALGVGFATRKVGNLTKPTTIISMDGDRVTVKTQSTIKNTELTFKLGEEFDETTADDRKVKSIVTLEDGKLVHVQ-KWDGK-ETSLVREVNGNNLTLTL--TMGD----VVCTRRYEKAE 133          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Medaka
Match: fabp7 (fatty acid binding protein 7 [Source:NCBI gene;Acc:100144367])

HSP 1 Score: 112.464 bits (280), Expect = 1.897e-31
Identity = 58/101 (57.43%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGE 445
            V+ F  +W L  ++NFD YMKALGVG+  R+VGN   PT  I+ EGD V+I+T STFKNTEI F+LG+EF E T D+   KSTV LDG+ LVH Q K DG+
Sbjct:    2 VDAFCATWKLVDSENFDEYMKALGVGFATRQVGNVTKPTVTISHEGDKVVIRTQSTFKNTEISFKLGEEFDETTVDDRNCKSTVTLDGDKLVHVQ-KWDGK 101          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Medaka
Match: fabp7a (fatty acid-binding protein, brain [Source:NCBI gene;Acc:101157499])

HSP 1 Score: 105.531 bits (262), Expect = 9.395e-29
Identity = 55/117 (47.01%), Postives = 76/117 (64.96%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLV 493
            V+ F  +W L  + NFD YMKALGVG+  R+VGN   PT  I+ +GD V++KT STF+NTE+  +LG+EF E T D+  VKST  +DG+  VH Q K DG+  T ++   D   ++V
Sbjct:    2 VDSFCATWKLVDSQNFDEYMKALGVGFATRQVGNVTKPTIVISQDGDKVVVKTQSTFRNTELSAKLGEEFDETTPDDRHVKSTFTMDGDKFVHTQ-KWDGKETTFVREIKDGKMVMV 117          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Medaka
Match: fabp11b (fatty acid-binding protein, adipocyte [Source:NCBI gene;Acc:101164089])

HSP 1 Score: 98.5969 bits (244), Expect = 5.137e-26
Identity = 58/140 (41.43%), Postives = 83/140 (59.29%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGD-IVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKV 559
            VE+F G+W L S++NFD YMKA+G+G+  R++GN   P   I +  D ++ +K  STFK TEI+F+LG+EF E T D   VKST  LD   LV KQ   DG+  T ++R +    L+   +       ++VV  R Y+K 
Sbjct:    2 VEQFAGTWTLASSENFDEYMKAVGMGFATRQMGNITKPNLVIQVGADGLISMKAESTFKTTEIKFRLGEEFDETTVDGRNVKSTFTLDNGKLVQKQ-NWDGKTST-LEREIQEGKLIAKCIM------DDVVAVRTYEKA 133          
BLAST of Fatty acid-binding protein, heart vs. Ensembl Medaka
Match: fabp11a (fatty acid-binding protein, heart-like [Source:NCBI gene;Acc:111948214])

HSP 1 Score: 90.8929 bits (224), Expect = 5.984e-23
Identity = 43/96 (44.79%), Postives = 64/96 (66.67%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVI-IKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQ 427
             EKF+G+W + S++NFD+YMKA+GVG+  R+VGN   P   +++E    I +K+ STFK TE++F+L + F E TAD+    + + LD   LV KQ
Sbjct:    2 AEKFVGTWKMISSENFDDYMKAIGVGFATRQVGNRTKPNLVVSIEDQGTISMKSQSTFKTTEVKFKLNEPFEETTADDRKTTTVITLDNGKLVQKQ 97          
BLAST of Fatty acid-binding protein, heart vs. Planmine SMEST
Match: SMESG000029500.1 (SMESG000029500.1)

HSP 1 Score: 296.204 bits (757), Expect = 1.058e-103
Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = 2
Query:  131 MSSEVEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVKEI 568
            MSSEVEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVKEI
Sbjct:    1 MSSEVEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVKEI 146          
BLAST of Fatty acid-binding protein, heart vs. Planmine SMEST
Match: SMESG000029500.1 (SMESG000029500.1)

HSP 1 Score: 252.292 bits (643), Expect = 1.748e-86
Identity = 129/146 (88.36%), Postives = 129/146 (88.36%), Query Frame = 2
Query:  131 MSSEVEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVKEI 568
            MSSEVEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDI                 LGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVKEI
Sbjct:    1 MSSEVEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDI-----------------LGKEFTEVTADNCTVKSTVELDGNVLVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVKEI 129          
BLAST of Fatty acid-binding protein, heart vs. Planmine SMEST
Match: SMESG000015143.1 (SMESG000015143.1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.831e-20
Identity = 50/128 (39.06%), Postives = 75/128 (58.59%), Query Frame = 2
Query:  143 VEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEGDIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNV-LVHKQVKEDGEIRTIMKRYLDSDDLLVMVLETKNDKG 523
            +E F+G W L +TDNF+ Y+K LGVG I+RK  ++  P Q I +   +  IKT +  KNTEI+F++ +EF E +AD+ T K+ V  + +   V  Q ++ G+    + R L  D+  VM LE  N K 
Sbjct:    1 MEAFVGKWQLTATDNFEAYLKELGVGMIIRKFASTSKPVQEITVVDGVTHIKTFTAMKNTEIKFKIDEEFDETSADDKTFKAIVRKESDTKFVQVQKRDKGD--NCITREL-VDNKYVMHLEFNNVKS 125          
The following BLAST results are available for this feature:
BLAST of Fatty acid-binding protein, heart vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FABP39.147e-3447.83fatty acid binding protein 3 [Source:HGNC Symbol;A... [more]
FABP31.215e-3347.83fatty acid binding protein 3 [Source:HGNC Symbol;A... [more]
FABP71.975e-3347.48fatty acid binding protein 7 [Source:HGNC Symbol;A... [more]
FABP42.731e-3354.31fatty acid binding protein 4 [Source:HGNC Symbol;A... [more]
PMP25.941e-3351.82peripheral myelin protein 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lbp-67.624e-2740.44Fatty acid-binding protein homolog 6 [Source:UniP... [more]
lbp-73.276e-2133.09Fatty acid-binding protein homolog 7 [Source:UniP... [more]
lbp-55.782e-2135.04Fatty acid-binding protein homolog 5 [Source:UniP... [more]
lbp-91.645e-1728.76Fatty acid-binding protein homolog 9 [Source:UniP... [more]
lbp-82.302e-1728.06Lipid Binding Protein [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fabp1.104e-2244.53gene:FBgn0037913 transcript:FBtr0100321[more]
fabp4.414e-2145.30gene:FBgn0037913 transcript:FBtr0100323[more]
fabp4.628e-1542.98gene:FBgn0037913 transcript:FBtr0100320[more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fabp7b7.706e-3355.86fatty acid binding protein 7, brain, b [Source:ZFI... [more]
fabp37.848e-3344.29fatty acid binding protein 3, muscle and heart [So... [more]
fabp7a2.654e-3048.76fatty acid binding protein 7, brain, a [Source:ZFI... [more]
fabp7a7.410e-3056.44fatty acid binding protein 7, brain, a [Source:ZFI... [more]
fabp11a3.622e-2241.07fatty acid binding protein 11a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fabp74.610e-3245.32fatty acid binding protein 7, brain [Source:NCBI g... [more]
mbtd13.403e-2844.60mbt domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
pmp24.765e-2540.71peripheral myelin protein 2 [Source:NCBI gene;Acc:... [more]
pmp21.718e-2341.53peripheral myelin protein 2 [Source:NCBI gene;Acc:... [more]
ENSXETT00000055814.12.578e-1938.60fatty acid-binding protein, brain-like [Source:NCB... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fabp33.633e-3246.38fatty acid binding protein 3, muscle and heart [So... [more]
Fabp42.405e-3151.72fatty acid binding protein 4, adipocyte [Source:MG... [more]
Pmp21.099e-3048.18peripheral myelin protein 2 [Source:MGI Symbol;Acc... [more]
Fabp76.556e-2953.47fatty acid binding protein 7, brain [Source:MGI Sy... [more]
Fabp79.620e-2953.47fatty acid binding protein 7, brain [Source:MGI Sy... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99P61|FABPH_ICTTR1.932e-3550.00Fatty acid-binding protein, heart OS=Ictidomys tri... [more]
sp|P10790|FABPH_BOVIN1.067e-3449.28Fatty acid-binding protein, heart OS=Bos taurus OX... [more]
sp|Q4TZH2|FABPH_BOSMU1.067e-3449.28Fatty acid-binding protein, heart OS=Bos mutus gru... [more]
sp|P86412|MYP2_PIG4.175e-3351.09Myelin P2 protein OS=Sus scrofa OX=9823 GN=PMP2 PE... [more]
sp|P02691|MYP2_RABIT4.266e-3351.82Myelin P2 protein OS=Oryctolagus cuniculus OX=9986... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8WR151.850e-3551.08Cellular retinoic acid/retinol binding protein OS=... [more]
A0A2Y9IX401.497e-3350.72fatty acid-binding protein, heart isoform X2 OS=En... [more]
A0A5N5KKZ21.879e-3351.43Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A452RV255.084e-3349.28Fatty acid binding protein 3 OS=Ursus americanus O... [more]
A0A3Q7XDR95.084e-3349.28fatty acid-binding protein, heart OS=Ursus arctos ... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fabp31.570e-3548.92fatty acid-binding protein, heart [Source:NCBI gen... [more]
fabp7a4.106e-3349.64fatty acid-binding protein, brain [Source:NCBI gen... [more]
fabp7a1.077e-3252.99fatty acid-binding protein, brain [Source:NCBI gen... [more]
fabp11a6.953e-2341.96myelin P2 protein-like [Source:NCBI gene;Acc:10302... [more]
crabp1a4.038e-2037.14cellular retinoic acid-binding protein 1 [Source:N... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
FABP31.370e-2641.73fatty acid binding protein 3 [Source:HGNC Symbol;A... [more]
fabp7a1.181e-2538.41fatty acid binding protein 7, brain, a [Source:ZFI... [more]
FABP35.463e-2442.14fatty acid binding protein 3 [Source:HGNC Symbol;A... [more]
crabp2b4.545e-1329.50cellular retinoic acid binding protein 2, b [Sourc... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fatty acid-binding protein, heart vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fabp32.502e-3347.86fatty acid-binding protein, heart [Source:NCBI gen... [more]
fabp71.897e-3157.43fatty acid binding protein 7 [Source:NCBI gene;Acc... [more]
fabp7a9.395e-2947.01fatty acid-binding protein, brain [Source:NCBI gen... [more]
fabp11b5.137e-2641.43fatty acid-binding protein, adipocyte [Source:NCBI... [more]
fabp11a5.984e-2344.79fatty acid-binding protein, heart-like [Source:NCB... [more]
back to top
BLAST of Fatty acid-binding protein, heart vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000029500.11.058e-103100.00SMESG000029500.1[more]
SMESG000029500.11.748e-8688.36SMESG000029500.1[more]
SMESG000015143.11.831e-2039.06SMESG000015143.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022501 ID=SMED30022501|Name=Fatty acid-binding protein, heart|organism=Schmidtea mediterranea sexual|type=transcript|length=675bp
AAAATATCAAAATTAAAAAGCATAACAAAATAATTAAGCTAATTGATATT
AAAAAAACCATACAAATTTAAATTTGGCACAAGTTAATTATTGCTTGTTT
TATTTCATAATTTGTCACTTGAAAATTAAAATGTCATCCGAAGTTGAAAA
GTTTATTGGGAGTTGGGGTTTAGATAGCACTGATAATTTTGATAATTATA
TGAAGGCACTTGGAGTTGGGTATATAATGAGAAAAGTAGGTAATTCAATT
TCACCTACACAACATATTAACATGGAAGGAGATATAGTAATTATTAAAAC
GACTTCAACTTTTAAAAATACAGAAATTCGGTTTCAGCTTGGTAAGGAGT
TTACAGAAGTAACTGCTGATAATTGCACGGTTAAATCAACTGTTGAGCTA
GATGGGAATGTTCTAGTTCATAAACAAGTTAAAGAAGATGGTGAAATTAG
AACTATTATGAAGCGGTACTTGGATTCTGATGATTTATTAGTGATGGTAC
TAGAAACTAAAAATGATAAAGGTGAAGAGGTGGTTTGTACCCGAAAATAC
AAAAAGGTGAAAGAAATATAAAACTTTTTGGAAAGTTCTTAAATAATGCT
TTTATAATGTCTTGTGCAATATTGGTGTTAATAAATTTATTTTGGTTGCA
TTTTTAAAAAATACATTCCCTGTCG
back to top

protein sequence of SMED30022501-orf-1

>SMED30022501-orf-1 ID=SMED30022501-orf-1|Name=SMED30022501-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MSSEVEKFIGSWGLDSTDNFDNYMKALGVGYIMRKVGNSISPTQHINMEG
DIVIIKTTSTFKNTEIRFQLGKEFTEVTADNCTVKSTVELDGNVLVHKQV
KEDGEIRTIMKRYLDSDDLLVMVLETKNDKGEEVVCTRKYKKVKEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0042750hibernation
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR031259ILBP
IPR000463Fatty_acid-bd
IPR000566Lipocln_cytosolic_FA-bd_dom
IPR012674Calycin
IPR011038Calycin-like
Vocabulary: molecular function
TermDefinition
GO:0008289lipid binding
GO:0005215transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000463Cytosolic fatty-acid bindingPRINTSPR00178FATTYACIDBPcoord: 8..30
score: 48.75
coord: 67..83
score: 42.28
IPR000463Cytosolic fatty-acid bindingPROSITEPS00214FABPcoord: 10..27
IPR000566Lipocalin/cytosolic fatty-acid binding domainPFAMPF00061Lipocalincoord: 10..142
e-value: 1.8E-17
score: 63.9
IPR012674CalycinGENE3DG3DSA:2.40.128.20coord: 2..143
e-value: 6.3E-43
score: 148.1
IPR012674CalycinSUPERFAMILYSSF50814Lipocalinscoord: 6..143
IPR031259Intracellular lipid binding proteinPANTHERPTHR11955FATTY ACID BINDING PROTEINcoord: 5..143