SMED30022498

Overview
NameSMED30022498
Smed IDSMED30022498
Length (bp)663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022498 (SMED30022498) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022498 (SMED30022498) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022498 (SMED30022498) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022498 (SMED30022498) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30022498 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002967:69917..70524 -2066
v31.003357:20410..21067 -1675
v31.027082:2201..2827 -1385
v31.002967:69912..70542 -722
Homology
BLAST of SMED30022498 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 119.783 bits (299), Expect = 2.798e-31
Identity = 55/146 (37.67%), Postives = 90/146 (61.64%), Query Frame = -1
Query:  160 FIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 597
            +IE+G + + DG +  PQ +IC  V AN ++K +KL+RH ++ H     +P EFF RK  ELK++         I    L+ S+  A  +A+ K  YTI +TL+K C++++C ++ G+    K+  +PLSNDTI RRI +++N++E
Sbjct:  741 YIEFGFVAVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDME 886          

HSP 2 Score: 34.6538 bits (78), Expect = 2.798e-31
Identity = 17/46 (36.96%), Postives = 31/46 (67.39%), Query Frame = -3
Query:   17 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLL 154
            +I++++   Y+++Q+DE   I+N  ILL+YVR+E     DI+E+  
Sbjct:  889 LIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEH--DDDIKEEFF 932          
BLAST of SMED30022498 vs. Ensembl Human
Match: ZMYM6 (zinc finger MYM-type containing 6 [Source:HGNC Symbol;Acc:HGNC:13050])

HSP 1 Score: 98.9821 bits (245), Expect = 3.114e-31
Identity = 50/130 (38.46%), Postives = 79/130 (60.77%), Query Frame = -1
Query:  160 PQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 549
            PQ VIC  + ++ ++K   L  H  T H   + KPV+FF +K  E++ + SS KK + +E  L+K S+  AF  A  KK ++I + L+KP + ++CS++ G     K+ +IPLSN TI  RI ++S +IE
Sbjct:  766 PQCVICGEILSSENMKPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTAASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIE 895          

HSP 2 Score: 55.0694 bits (131), Expect = 3.114e-31
Identity = 22/51 (43.14%), Postives = 42/51 (82.35%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            +IQK++++ ++A+Q+DES+ ISN  +LL Y+R+ DY  +D++E+LL C+++
Sbjct:  898 LIQKVRESKWFALQIDESSEISNITLLLCYIRFIDYDCRDVKEELLFCIEM 948          
BLAST of SMED30022498 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 119.398 bits (298), Expect = 3.197e-31
Identity = 55/146 (37.67%), Postives = 90/146 (61.64%), Query Frame = -1
Query:  160 FIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 597
            +IE+G + + DG +  PQ +IC  V AN ++K +KL+RH ++ H     +P EFF RK  ELK++         I    L+ S+  A  +A+ K  YTI +TL+K C++++C ++ G+    K+  +PLSNDTI RRI +++N++E
Sbjct:  590 YIEFGFVAVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDME 735          

HSP 2 Score: 34.6538 bits (78), Expect = 3.197e-31
Identity = 17/46 (36.96%), Postives = 31/46 (67.39%), Query Frame = -3
Query:   17 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLL 154
            +I++++   Y+++Q+DE   I+N  ILL+YVR+E     DI+E+  
Sbjct:  738 LIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEH--DDDIKEEFF 781          
BLAST of SMED30022498 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 100.523 bits (249), Expect = 1.460e-26
Identity = 53/151 (35.10%), Postives = 91/151 (60.26%), Query Frame = -1
Query:  160 EKFIEYGCIVIKDGHIDLP--QYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENK-LLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 603
            E ++ +G      G+ D P  Q V+C+ + +NSSL  +KL+RH  T H  YK K + FF +  D  +  +    K V+ +N+   + S+  ++HIA   +A+TIG+ L+KPC +D+   +F +++  KI+++ LSN T+ RRI D++ +IE
Sbjct:  112 ESYLSFGFTYF--GNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIE 260          

HSP 2 Score: 38.1206 bits (87), Expect = 1.460e-26
Identity = 18/38 (47.37%), Postives = 27/38 (71.05%), Query Frame = -3
Query:   11 YAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCC 124
            +++Q+DES  +S  A+LL++VRY    +K IEE LL C
Sbjct:  273 FSLQLDESADVSGLAVLLVFVRYR--FNKSIEEDLLLC 308          
BLAST of SMED30022498 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 100.523 bits (249), Expect = 1.460e-26
Identity = 53/151 (35.10%), Postives = 91/151 (60.26%), Query Frame = -1
Query:  160 EKFIEYGCIVIKDGHIDLP--QYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENK-LLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 603
            E ++ +G      G+ D P  Q V+C+ + +NSSL  +KL+RH  T H  YK K + FF +  D  +  +    K V+ +N+   + S+  ++HIA   +A+TIG+ L+KPC +D+   +F +++  KI+++ LSN T+ RRI D++ +IE
Sbjct:  112 ESYLSFGFTYF--GNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIE 260          

HSP 2 Score: 38.1206 bits (87), Expect = 1.460e-26
Identity = 18/38 (47.37%), Postives = 27/38 (71.05%), Query Frame = -3
Query:   11 YAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCC 124
            +++Q+DES  +S  A+LL++VRY    +K IEE LL C
Sbjct:  273 FSLQLDESADVSGLAVLLVFVRYR--FNKSIEEDLLLC 308          
BLAST of SMED30022498 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 46.595 bits (109), Expect = 2.449e-8
Identity = 40/142 (28.17%), Postives = 69/142 (48.59%), Query Frame = -1
Query:  157 PQYVICESVSANSSLKANKLQRHFHTNHGPYKGK-PVEFFLRK------RDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMED----ICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIEA 549
            P  +IC++  + S  KA+ L+RHF + H     + P    LRK      + + + +   F+KF      +   S+  A++IAR KK Y  G+  +K C+ D    +C +   +  +  +  + LS  T+ +RI DI N +E 
Sbjct:   37 PFCLICQT--SLSHFKASNLERHFTSLHSAVAREFPKGSELRKHKVKTLKGQAEKQTQLFRKFSKHSETVTLASYQLAWNIARAKKPYLEGE-FVKKCLSDAVAILCPE--NENLKRSVKDLQLSRHTVEQRISDIDNSVET 173          

HSP 2 Score: 29.6462 bits (65), Expect = 2.449e-8
Identity = 17/50 (34.00%), Postives = 30/50 (60.00%), Query Frame = -3
Query:   17 SNIIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKD--IEEKLL 160
            ++++  LQK  Y++I +DES  + +     I+VR   + S+D  I E+LL
Sbjct:  173 THLLSDLQKCQYFSIALDESCDVQDKPQFAIFVR---FVSEDCTIREELL 219          
BLAST of SMED30022498 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 43.8986 bits (102), Expect = 1.749e-7
Identity = 40/137 (29.20%), Postives = 68/137 (49.64%), Query Frame = -1
Query:  163 DLPQYVICESVSANSSLKANKLQRHFHTNHGP----YKGKPVEFFLRK-RDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAK-INSIPLSNDTIGRRIIDISNEI 555
            D PQ ++C      SS K   ++RH+ T HG     Y G+     ++  + +L  +++ F    + +   +K S   A  IA+ K  ++ G TL+K C   + ++ FG E  AK + SI LS+ T+ R I  I+  +
Sbjct:   42 DKPQCLVC--AQTISSCKEYNVKRHYTTLHGAKYAKYTGEARLTIIKDLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSSG-TLVKTCALKM-AEAFGNETMAKTVESISLSHQTVARHICTINQHL 174          

HSP 2 Score: 30.0314 bits (66), Expect = 1.749e-7
Identity = 13/31 (41.94%), Postives = 21/31 (67.74%), Query Frame = -3
Query:   50 LQKTLYYAIQMDESTHISNNAILLIYVRYED 142
            L+   Y++I +DEST I++   L+I+VR  D
Sbjct:  182 LRSAPYFSIALDESTDITDTCQLVIFVRSVD 212          
BLAST of SMED30022498 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.8986 bits (102), Expect = 1.862e-7
Identity = 40/137 (29.20%), Postives = 68/137 (49.64%), Query Frame = -1
Query:  163 DLPQYVICESVSANSSLKANKLQRHFHTNHGP----YKGKPVEFFLRK-RDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAK-INSIPLSNDTIGRRIIDISNEI 555
            D PQ ++C      SS K   ++RH+ T HG     Y G+     ++  + +L  +++ F    + +   +K S   A  IA+ K  ++ G TL+K C   + ++ FG E  AK + SI LS+ T+ R I  I+  +
Sbjct:   42 DKPQCLVC--AQTISSCKEYNVKRHYTTLHGAKYAKYTGEARLTIIKDLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSSG-TLVKTCALKM-AEAFGNETMAKTVESISLSHQTVARHICTINQHL 174          

HSP 2 Score: 30.0314 bits (66), Expect = 1.862e-7
Identity = 13/31 (41.94%), Postives = 21/31 (67.74%), Query Frame = -3
Query:   50 LQKTLYYAIQMDESTHISNNAILLIYVRYED 142
            L+   Y++I +DEST I++   L+I+VR  D
Sbjct:  182 LRSAPYFSIALDESTDITDTCQLVIFVRSVD 212          
BLAST of SMED30022498 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 94.7449 bits (234), Expect = 1.231e-27
Identity = 57/165 (34.55%), Postives = 92/165 (55.76%), Query Frame = -1
Query:  160 AKKAKLETNYDYCDKEKFIEYGCIV--IKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 648
            AK+ +++ +  Y    ++I +G I+    +     PQ VIC  V  + S+    L  H    H   + KPV+FF  K  E++ + SS KK + +E  L+K S+  AF IA   K ++I + L+KP + ++CS++ G     K+ +IPLSN TIG RI  +S++IE
Sbjct:  657 AKRRRVDFSQTY--NAEYIRFGFIICSGSEESSPSPQCVICGEVLPSESVMPVSLSNHLKAKHSDLENKPVDFFEEKSLEMECQNSSLKKCLLVEESLVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIE 819          

HSP 2 Score: 47.3654 bits (111), Expect = 1.231e-27
Identity = 19/51 (37.25%), Postives = 38/51 (74.51%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            ++QK++++ ++A+Q+DES+  +   +LL YVR+ DY   D++E+LL C ++
Sbjct:  822 LLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEM 872          
BLAST of SMED30022498 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 94.7449 bits (234), Expect = 1.263e-27
Identity = 57/165 (34.55%), Postives = 92/165 (55.76%), Query Frame = -1
Query:  160 AKKAKLETNYDYCDKEKFIEYGCIV--IKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 648
            AK+ +++ +  Y    ++I +G I+    +     PQ VIC  V  + S+    L  H    H   + KPV+FF  K  E++ + SS KK + +E  L+K S+  AF IA   K ++I + L+KP + ++CS++ G     K+ +IPLSN TIG RI  +S++IE
Sbjct:  565 AKRRRVDFSQTY--NAEYIRFGFIICSGSEESSPSPQCVICGEVLPSESVMPVSLSNHLKAKHSDLENKPVDFFEEKSLEMECQNSSLKKCLLVEESLVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIE 727          

HSP 2 Score: 46.9802 bits (110), Expect = 1.263e-27
Identity = 19/51 (37.25%), Postives = 38/51 (74.51%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            ++QK++++ ++A+Q+DES+  +   +LL YVR+ DY   D++E+LL C ++
Sbjct:  730 LLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEM 780          
BLAST of SMED30022498 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 92.4337 bits (228), Expect = 5.182e-24
Identity = 55/148 (37.16%), Postives = 80/148 (54.05%), Query Frame = -1
Query:  163 EKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDEL-KAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEI 603
            E F++YG        I+ PQ VIC  V +  S+K NKL+RHF + H  + GK   +F  K D L KA+  +  K        ++ S+  A  IAR  K +T  + LL P  +D    + G EF  K++++ LSNDT+ RRI D+S +I
Sbjct:  171 EGFLQYGFTSTITVGIERPQCVICGVVLSAESMKPNKLKRHFESKHSSFAGKDTNYFRSKADGLKKARPDTGSKSNKQNVAAVETSYLVALRIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADI 318          

HSP 2 Score: 37.3502 bits (85), Expect = 5.182e-24
Identity = 17/40 (42.50%), Postives = 27/40 (67.50%), Query Frame = -3
Query:    2 AIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 121
            +IQ+DEST ++N   L++YVRY +    D +++ LCC  L
Sbjct:  335 SIQLDESTDVANCLQLMVYVRYIN--DGDFKDEFLCCKPL 372          
BLAST of SMED30022498 vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.159e-30
Identity = 55/146 (37.67%), Postives = 90/146 (61.64%), Query Frame = -1
Query:  160 FIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 597
            +IE+G + + DG +  PQ +IC  V AN ++K +KL+RH ++ H     +P EFF RK  ELK++         I    L+ S+  A  +A+ K  YTI +TL+K C++++C ++ G+    K+  +PLSNDTI RRI +++N++E
Sbjct:  741 YIEFGFVAVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDME 886          

HSP 2 Score: 34.6538 bits (78), Expect = 1.159e-30
Identity = 17/46 (36.96%), Postives = 31/46 (67.39%), Query Frame = -3
Query:   17 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLL 154
            +I++++   Y+++Q+DE   I+N  ILL+YVR+E     DI+E+  
Sbjct:  889 LIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEH--DDDIKEEFF 932          
BLAST of SMED30022498 vs. UniProt/SwissProt
Match: sp|O95789|ZMYM6_HUMAN (Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.290e-30
Identity = 50/130 (38.46%), Postives = 79/130 (60.77%), Query Frame = -1
Query:  160 PQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 549
            PQ VIC  + ++ ++K   L  H  T H   + KPV+FF +K  E++ + SS KK + +E  L+K S+  AF  A  KK ++I + L+KP + ++CS++ G     K+ +IPLSN TI  RI ++S +IE
Sbjct:  766 PQCVICGEILSSENMKPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTAASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIE 895          

HSP 2 Score: 55.0694 bits (131), Expect = 1.290e-30
Identity = 22/51 (43.14%), Postives = 42/51 (82.35%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            +IQK++++ ++A+Q+DES+ ISN  +LL Y+R+ DY  +D++E+LL C+++
Sbjct:  898 LIQKVRESKWFALQIDESSEISNITLLLCYIRFIDYDCRDVKEELLFCIEM 948          
BLAST of SMED30022498 vs. UniProt/SwissProt
Match: sp|Q49AG3|ZBED5_HUMAN (Zinc finger BED domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBED5 PE=2 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 6.052e-26
Identity = 53/151 (35.10%), Postives = 91/151 (60.26%), Query Frame = -1
Query:  160 EKFIEYGCIVIKDGHIDLP--QYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENK-LLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 603
            E ++ +G      G+ D P  Q V+C+ + +NSSL  +KL+RH  T H  YK K + FF +  D  +  +    K V+ +N+   + S+  ++HIA   +A+TIG+ L+KPC +D+   +F +++  KI+++ LSN T+ RRI D++ +IE
Sbjct:  112 ESYLSFGFTYF--GNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIE 260          

HSP 2 Score: 38.1206 bits (87), Expect = 6.052e-26
Identity = 18/38 (47.37%), Postives = 27/38 (71.05%), Query Frame = -3
Query:   11 YAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCC 124
            +++Q+DES  +S  A+LL++VRY    +K IEE LL C
Sbjct:  273 FSLQLDESADVSGLAVLLVFVRYR--FNKSIEEDLLLC 308          
BLAST of SMED30022498 vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 6.735e-26
Identity = 53/151 (35.10%), Postives = 91/151 (60.26%), Query Frame = -1
Query:  160 EKFIEYGCIVIKDGHIDLP--QYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENK-LLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 603
            E ++ +G      G+ D P  Q V+C+ + +NSSL  +KL+RH  T H  YK K + FF +  D  +  +    K V+ +N+   + S+  ++HIA   +A+TIG+ L+KPC +D+   +F +++  KI+++ LSN T+ RRI D++ +IE
Sbjct:  113 ESYLSFGFTYF--GNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIE 261          

HSP 2 Score: 37.7354 bits (86), Expect = 6.735e-26
Identity = 18/38 (47.37%), Postives = 27/38 (71.05%), Query Frame = -3
Query:   11 YAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCC 124
            +++Q+DES  +S  A+LL++VRY    +K IEE LL C
Sbjct:  274 FSLQLDESADVSGLAVLLVFVRYR--FNKSIEEDLLLC 309          
BLAST of SMED30022498 vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.313e-26
Identity = 53/151 (35.10%), Postives = 91/151 (60.26%), Query Frame = -1
Query:  160 EKFIEYGCIVIKDGHIDLP--QYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENK-LLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 603
            E ++ +G      G+ D P  Q V+C+ + +NSSL  +KL+RH  T H  YK K + FF +  D  +  +    K V+ +N+   + S+  ++HIA   +A+TIG+ L+KPC +D+   +F +++  KI+++ LSN T+ RRI D++ +IE
Sbjct:  113 ESYLSFGFTYF--GNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIE 261          

HSP 2 Score: 37.7354 bits (86), Expect = 7.313e-26
Identity = 19/41 (46.34%), Postives = 28/41 (68.29%), Query Frame = -3
Query:    2 YAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 124
            +++Q+DES  +S  A+LL++VRY    +K IEE LL C  L
Sbjct:  274 FSLQLDESADVSGLAVLLVFVRYR--FNKSIEEDLLLCESL 312          
BLAST of SMED30022498 vs. TrEMBL
Match: J9LZ91 (DUF4371 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 1.232e-55
Identity = 86/162 (53.09%), Postives = 113/162 (69.75%), Query Frame = -1
Query:  160 KKAKLETNYDYCDKEKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 645
            KK K+  NY Y   +K+I YG   I +  +DLPQ VIC +V AN+SLK NKL RH  TNH  Y+ K  +FFLRKRDELK  + + K + +++   LKCS  AA HIAR KK Y IG+ L+KPCM DICS++FG E  +KI +IP+S+DTI +RI+ I+N+IE
Sbjct:   42 KKVKISMNYTYKYIDKYIGYGLTYINENGVDLPQGVICGNVLANASLKPNKLLRHLETNHNEYRNKTTDFFLRKRDELKINKKNIKSYTTVDKVYLKCSFIAAMHIARTKKPYNIGEKLIKPCMVDICSELFGNEHVSKIKNIPMSDDTIHKRILCIANDIE 203          

HSP 2 Score: 67.3958 bits (163), Expect = 1.232e-55
Identity = 32/51 (62.75%), Postives = 42/51 (82.35%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            +++K+ K+L+YAIQ+DEST ISN+AILLIYVRY D    DI+E+ LC LKL
Sbjct:  206 LVEKINKSLFYAIQLDESTDISNSAILLIYVRYIDDTFNDIKEEFLCTLKL 256          
BLAST of SMED30022498 vs. TrEMBL
Match: X1WPB8 (DUF4371 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.181e-54
Identity = 85/162 (52.47%), Postives = 112/162 (69.14%), Query Frame = -1
Query:  160 KKAKLETNYDYCDKEKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 645
            KK K+  NY Y   +K+I YG   I +  +DL Q VIC +V AN+SLK NKL RH  TNH  Y+ K  +FFLRKRDELK  + + K + +++   LKCS  AA HIAR KK Y IG+ L+KPCM DICS++FG E  +KI +IP+S+DTI +RI+ I+N+IE
Sbjct:   42 KKVKISMNYTYKYIDKYIGYGFTYINENGVDLSQGVICGNVLANASLKPNKLLRHLETNHNEYRNKTTDFFLRKRDELKINKKNIKSYTTVDKVYLKCSFIAAMHIARTKKPYNIGEKLIKPCMVDICSELFGNEHVSKIKNIPMSDDTIHKRILCIANDIE 203          

HSP 2 Score: 67.0106 bits (162), Expect = 2.181e-54
Identity = 32/51 (62.75%), Postives = 42/51 (82.35%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            +++K+ K+L+YAIQ+DEST ISN+AILLIYVRY D    DI+E+ LC LKL
Sbjct:  206 LVEKINKSLFYAIQLDESTDISNSAILLIYVRYIDDTFNDIKEEFLCTLKL 256          
BLAST of SMED30022498 vs. TrEMBL
Match: A0A2S2QIN0 (SCAN domain-containing protein 3 (Fragment) OS=Sipha flava OX=143950 GN=SCAND3_1 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.295e-47
Identity = 87/165 (52.73%), Postives = 112/165 (67.88%), Query Frame = -1
Query:  160 KKAKLET---NYDYCDKEKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 645
            KK KL +   NYD    E++IEYG   +++ +IDLPQ +IC  V AN+SLK NKL RH  TNH  YK +  +FFLRK  E K  +   K F + + K LKCS+ AA HIA+ KKAYTI + LLKPCM DI +++FG E+  KINSIP+SNDTI RRI  ++ +IE
Sbjct:   41 KKVKLTSKILNYD----ERYIEYGLTYLRENNIDLPQCIICSMVLANASLKPNKLLRHLETNHVHYKNRNKDFFLRKLHEFKESKKIIKSFPTEDKKYLKCSYLAAMHIAKSKKAYTICEKLLKPCMIDIFTELFGSEYATKINSIPMSNDTISRRINVMAVDIE 201          
BLAST of SMED30022498 vs. TrEMBL
Match: A0A2S2R2G6 (SCAN domain-containing protein 3 OS=Sipha flava OX=143950 GN=SCAND3_13 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.116e-45
Identity = 75/150 (50.00%), Postives = 101/150 (67.33%), Query Frame = -1
Query:  160 KEKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKL-LKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 606
            K+ ++EYG   + +   D+PQ VIC    AN+SLK NKL RH  T+H  YK    +FFLRK +ELK  +     + ++E+K+ LKCS+ AA HIA+ KK Y+IG+ LLKPCM DIC+++F  E   KI  IP+SNDTI RRI  +SN+IE
Sbjct:   53 KDSYVEYGFTYLNENGKDVPQCVICGMTLANASLKPNKLIRHMETSHAQYKNNTRDFFLRKFEELKKNKKMINTY-TVEDKIYLKCSYLAALHIAKSKKPYSIGEKLLKPCMIDICTELFSNEHVTKIKKIPMSNDTISRRINTMSNDIE 201          

HSP 2 Score: 63.1586 bits (152), Expect = 2.116e-45
Identity = 28/49 (57.14%), Postives = 39/49 (79.59%), Query Frame = -3
Query:    2 QKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 148
            +K++K+++YAIQ+DEST I+N AILL+YVRY D    DI+E+  CCL L
Sbjct:  206 EKIKKSIFYAIQLDESTDINNEAILLMYVRYVDTDLNDIQEEFFCCLNL 254          
BLAST of SMED30022498 vs. TrEMBL
Match: A0A2S2QDE8 (Zinc finger MYM-type protein 6 OS=Sipha flava OX=143950 GN=ZMYM6_0 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.615e-37
Identity = 68/164 (41.46%), Postives = 98/164 (59.76%), Query Frame = -1
Query:  160 KKAKLETNYDYCDKEKFIEYGCIVIKDGHIDLP--QYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 645
            KK     NY+    + +I+YG I       D+P  Q V+C  + +N ++K  KL RH  + H  +  KP++FF+RK  EL A++        ++  L+K S+  AF IA+CKK Y IG+TL+KPC+ D+ S+  G     K+N +PLSNDTI RRIIDIS +IE
Sbjct:   40 KKGTFVRNYN----DDYIKYGFICFSSDSNDIPKPQCVLCSVILSNEAMKPAKLIRHLESKHKEFNNKPIDFFIRKGKELTAQKKVMSATSKVDYSLVKASYLVAFRIAKCKKPYNIGETLIKPCLLDVTSEFLGPSATKKMNDLPLSNDTISRRIIDISVDIE 199          

HSP 2 Score: 52.373 bits (124), Expect = 1.615e-37
Identity = 23/51 (45.10%), Postives = 38/51 (74.51%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            +I K++ + +++IQ+DEST +S  AILL YVR+ D+ + ++ E LLCC +L
Sbjct:  202 VIDKIKLSKWFSIQLDESTDVSQKAILLCYVRFIDFQTSEMCEDLLCCCEL 252          
BLAST of SMED30022498 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 4.700e-24
Identity = 48/142 (33.80%), Postives = 84/142 (59.15%), Query Frame = -1
Query:  133 LPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIEN--KLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIEAI*FKNYRK 552
            LP  V+C  V AN +LK  KL+RH  T H  Y  KPVEFF  K  E ++++ + +   S  +  K ++ S+  A  IA+  K +TIG++L+ P  +++ S + G++   ++N I LS++T+ RRI ++++++     K  R+
Sbjct:   61 LPLCVVCSEVLANEALKTTKLRRHLETKHSEYASKPVEFFENKLKEYQSRKKTLELACSGTDHAKAVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRE 202          

HSP 2 Score: 43.8986 bits (102), Expect = 4.700e-24
Identity = 22/51 (43.14%), Postives = 38/51 (74.51%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            +I++++++ +YAIQ+DEST I+N + LL +VRYE   +++I E +L C  L
Sbjct:  196 LIKRVRESRFYAIQLDESTDIANLSNLLAFVRYEH--NREIFEDILFCKPL 244          
BLAST of SMED30022498 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 9.524e-24
Identity = 48/142 (33.80%), Postives = 84/142 (59.15%), Query Frame = -1
Query:  133 LPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIEN--KLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIEAI*FKNYRK 552
            LP  V+C  V AN +LK  KL+RH  T H  Y  KPVEFF  K  E ++++ + +   S  +  K ++ S+  A  IA+  K +TIG++L+ P  +++ S + G++   ++N I LS++T+ RRI ++++++     K  R+
Sbjct:  104 LPLCVVCSEVLANEALKPTKLRRHLETKHSEYASKPVEFFENKLKEYQSRKKTLELACSGTDNAKAVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRE 245          

HSP 2 Score: 43.1282 bits (100), Expect = 9.524e-24
Identity = 22/51 (43.14%), Postives = 38/51 (74.51%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            +I++++++ +YAIQ+DEST I+N + LL +VRYE   +++I E +L C  L
Sbjct:  239 LIKRVRESRFYAIQLDESTDIANLSNLLAFVRYEH--NREIFEDILFCKPL 287          
BLAST of SMED30022498 vs. Ensembl Cavefish
Match: ENSAMXT00000057314.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:4224188:4227217:-1 gene:ENSAMXG00000029268.1 transcript:ENSAMXT00000057314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 2.000e-18
Identity = 55/159 (34.59%), Postives = 80/159 (50.31%), Query Frame = -1
Query:  160 KEKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLK----------CSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 606
            +E FIEYG I   D      + + C    AN SLK   L+RH  T H    GKP EFFLRK++ L A +       +I++ LL+           S   +  IA+ KK +TIG+TL+KP    +   + G +   K   +PLSN+T+  RI  ++  +E
Sbjct:    9 QESFIEYGFIEAMDK--VRAECIFCRDKLANESLKPCNLKRHQTTKHPETVGKPKEFFLRKKELLVANRPQ-----NIKDSLLRAGSDHRQATIASFECSLLIAKDKKPHTIGETLIKPACIKMAERMCGPQVANKFKIVPLSNNTVKDRIDRMAGNVE 160          

HSP 2 Score: 33.4982 bits (75), Expect = 2.000e-18
Identity = 14/35 (40.00%), Postives = 27/35 (77.14%), Query Frame = -3
Query:   56 SNIIQKLQKTLYYAIQMDESTHISNNAILLIYVRY 160
            + +++KL KT  ++IQ+DE+T ++  AIL++Y +Y
Sbjct:  161 NTLVEKL-KTSPFSIQLDETTTVAEEAILIVYAQY 194          
BLAST of SMED30022498 vs. Ensembl Cavefish
Match: ENSAMXT00000051860.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:8744824:8748459:-1 gene:ENSAMXG00000029953.1 transcript:ENSAMXT00000051860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.004e-17
Identity = 43/122 (35.25%), Postives = 66/122 (54.10%), Query Frame = -1
Query:  184 PQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRI 549
            P  ++C ++ A  SLK +KL RH    H     KPVEFF RK  EL+ ++   +K  +   K LK +      IA+  K +T+G+  L+ C ++  S + GK    ++  IP+SNDT+  RI
Sbjct:   74 PTVLVCGNMLAKVSLKLSKLLRHLQAKHSTLWSKPVEFFERKLQELRGQKLVLQK-ATANQKALKAAFVILHWIAKTGKPHTLGEPFLQ-CAKETVSIMCGKCTADRLALIPVSNDTVANRI 193          

HSP 2 Score: 31.9574 bits (71), Expect = 3.004e-17
Identity = 12/23 (52.17%), Postives = 19/23 (82.61%), Query Frame = -3
Query:   65 TLYYAIQMDESTHISNNAILLIY 133
            ++Y+A+Q+DEST +S  A LL+Y
Sbjct:  201 SVYFALQLDESTDVSGEAQLLVY 223          
BLAST of SMED30022498 vs. Ensembl Cavefish
Match: ENSAMXT00000047230.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:8744824:8751336:-1 gene:ENSAMXG00000029953.1 transcript:ENSAMXT00000047230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.839e-16
Identity = 43/122 (35.25%), Postives = 66/122 (54.10%), Query Frame = -1
Query:  184 PQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRI 549
            P  ++C ++ A  SLK +KL RH    H     KPVEFF RK  EL+ ++   +K  +   K LK +      IA+  K +T+G+  L+ C ++  S + GK    ++  IP+SNDT+  RI
Sbjct:  192 PTVLVCGNMLAKVSLKLSKLLRHLQAKHSTLWSKPVEFFERKLQELRGQKLVLQK-ATANQKALKAAFVILHWIAKTGKPHTLGEPFLQ-CAKETVSIMCGKCTADRLALIPVSNDTVANRI 311          

HSP 2 Score: 30.8018 bits (68), Expect = 1.839e-16
Identity = 12/23 (52.17%), Postives = 19/23 (82.61%), Query Frame = -3
Query:   65 TLYYAIQMDESTHISNNAILLIY 133
            ++Y+A+Q+DEST +S  A LL+Y
Sbjct:  319 SVYFALQLDESTDVSGEAQLLVY 341          
BLAST of SMED30022498 vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 6.648e-28
Identity = 52/138 (37.68%), Postives = 78/138 (56.52%), Query Frame = -1
Query:  133 QYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIEAI*FKNYRK 546
            Q V C    +N +LK +KL+RH  T H    GKPV++F RK D L+ ++ S           LK S+  A  +A+ KKA+TI + L+ P   D+C ++ G+    K+ +IPLSND +  RI DI+++IE    +  RK
Sbjct:   36 QCVECGLTLSNEALKPSKLKRHLETKHPKLIGKPVDYFKRKDDGLQMQRRSIVSLTGDAKCALKASYLVARRVAQSKKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADIASDIEQQLLERIRK 173          

HSP 2 Score: 45.0542 bits (105), Expect = 6.648e-28
Identity = 18/51 (35.29%), Postives = 40/51 (78.43%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            ++++++K+ ++++Q+DEST ++N A+LL++VRY   +S  ++E +L C +L
Sbjct:  167 LLERIRKSPFFSLQLDESTDVTNAALLLVFVRYRWDSS--LQEDILFCGEL 215          
BLAST of SMED30022498 vs. Ensembl Medaka
Match: ENSORLT00000035512.1 (pep primary_assembly:ASM223467v1:11:22712371:22714941:1 gene:ENSORLG00000026495.1 transcript:ENSORLT00000035512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 2.006e-27
Identity = 61/160 (38.12%), Postives = 90/160 (56.25%), Query Frame = -1
Query:  163 KAKLETNYDYCDKEKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEI 642
            KAK+   YD    E ++  G  V   G  + P  ++C  + A  S+K NKL+RH  T H  +  KP+EFF RKR E   + S F    S+  + L  S+  A+ IA+CKK +TI + L+ P   D+ S +      AK+ ++PLSNDT+ RRI DI+N++
Sbjct:   26 KAKMR-KYD----EAYVALGFTVTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADKPLEFFQRKRAEYCQQSSRFVSATSVNQRALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLDDASAAKLKTVPLSNDTVARRINDIANDL 180          
BLAST of SMED30022498 vs. Ensembl Medaka
Match: ENSORLT00000040389.1 (pep primary_assembly:ASM223467v1:19:265767:268275:-1 gene:ENSORLG00000025045.1 transcript:ENSORLT00000040389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 2.025e-27
Identity = 56/147 (38.10%), Postives = 84/147 (57.14%), Query Frame = -1
Query:  163 EKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEI 603
            E ++  G  V   G  + P  ++C  + A  S+K NKL+RH  T H  +  KP+EFF RKR E   + S F    S+  + L  S+  A+ IA+CKK +TI + L+ P   D+ S +      AK+ ++PLSNDT+ RRI DI+N++
Sbjct:   34 EAYVALGFTVTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADKPLEFFQRKRAEYCQQSSRFVSATSVNQRALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLDDASAAKLKTVPLSNDTVARRINDIANDL 180          
BLAST of SMED30022498 vs. Ensembl Medaka
Match: ENSORLT00000028620.1 (pep primary_assembly:ASM223467v1:3:35179252:35181570:1 gene:ENSORLG00000028714.1 transcript:ENSORLT00000028620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 4.586e-26
Identity = 56/166 (33.73%), Postives = 87/166 (52.41%), Query Frame = -1
Query:  160 GSTAKKAKLETNYDYCDKEKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 657
             S + KAK    Y+      FI++G +          Q V C    +N +LK +KL+RH  T +    GKPV++F RK D L+ ++ S           LK S+  A  +A  KKA+TI + L+ P   D+C ++ G+    K+ +IPLSND +  RI D++++IE
Sbjct:   49 ASPSSKAKFIRKYN----PDFIKFGFVNGGSEAEPRAQCVECGLTLSNEALKPSKLKRHLETKYPKLIGKPVDYFKRKDDGLQMQRRSIVSLTGDAKCALKASYLVARRVALNKKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADMASDIE 210          

HSP 2 Score: 43.8986 bits (102), Expect = 4.586e-26
Identity = 18/51 (35.29%), Postives = 39/51 (76.47%), Query Frame = -3
Query:    2 IIQKLQKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 154
            ++ +++K+ ++++Q+DEST ++N A+LL++VRY   +S  ++E +L C +L
Sbjct:  213 LLGRIRKSPFFSLQLDESTDVTNAALLLVFVRYRWDSS--LQEDILFCGEL 261          
BLAST of SMED30022498 vs. Ensembl Medaka
Match: ENSORLT00000030788.1 (pep primary_assembly:ASM223467v1:17:2264135:2274164:1 gene:ENSORLG00000023031.1 transcript:ENSORLT00000030788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 3.388e-22
Identity = 48/126 (38.10%), Postives = 70/126 (55.56%), Query Frame = -1
Query:  184 DLPQYV--ICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRI 555
            D PQ +   C    AN+S+K   LQRH  T HG + GK  EFF RK  E K+ Q++ +K  +   K+L+ S+  +  +A+ KK +TI + LL P    +   +  KE      ++PLSNDT+ RRI
Sbjct:   21 DPPQALCFFCGEKLANASMKPAHLQRHLTTKHGCHVGKAPEFFRRKLSEFKSSQATMRKVSTTSVKVLEASYAVSLLVAKAKKPFTIAEDLLLPAAVVLAETMLDKESADTFKTVPLSNDTVCRRI 146          

HSP 2 Score: 34.2686 bits (77), Expect = 3.388e-22
Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = -3
Query:   11 YAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCC 124
            +++Q+DEST +S +A L+ +VRY D  + DI E +L C
Sbjct:  158 FSLQLDESTDVSGHAQLVAFVRYID--TDDICEHILFC 193          
BLAST of SMED30022498 vs. Planmine SMEST
Match: SMESG000030287.1 (SMESG000030287.1)

HSP 1 Score: 174.096 bits (440), Expect = 1.153e-51
Identity = 87/148 (58.78%), Postives = 108/148 (72.97%), Query Frame = -1
Query:  160 EKFIEYGCIVIKDGHIDLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIE 603
            +K+I YG     D  ID PQ VIC +V AN+SLK +KL RH  TNH  YK KP +FFLR+R ELKA + +F K+VS + K  KCS+ AA HIA+ KKAYTIG+ LLKPCM+D  +++FG E+  KIN IPLSNDTI RRI DISN++E
Sbjct:   78 DKYINYGFTCKNDNGIDFPQCVICGNVLANASLKPSKLLRHLETNHSEYKDKPKDFFLRERTELKADKLNFTKYVSSDKKYSKCSYLAAMHIAKSKKAYTIGEMLLKPCMKDKYNELFGPEYATKINQIPLSNDTIFRRINDISNDME 225          
BLAST of SMED30022498 vs. Planmine SMEST
Match: SMESG000030106.1 (SMESG000030106.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.540e-26
Identity = 51/123 (41.46%), Postives = 77/123 (62.60%), Query Frame = -1
Query:  193 DLPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFK-KFVSIENKL-LKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIG 555
            D PQ V+C  V ANS +   KL+RH  T H  Y+ KP +F  RK +ELK++++  +   +  EN+L LK S   ++HIA+ KK +TIG+ L+ P M + C  +F  +F ++I +IPLSND + 
Sbjct:   35 DCPQCVVCSEVLANSDMAPVKLKRHLETKHLQYQSKPKDFIKRKENELKSQKTVMQYTLLGTENELALKTSFLISYHIAKSKKNFTIGENLIMPGMVEACQIMFSDKFASQIKTIPLSNDAVA 157          
BLAST of SMED30022498 vs. Planmine SMEST
Match: SMESG000015406.1 (SMESG000015406.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.142e-24
Identity = 50/139 (35.97%), Postives = 81/139 (58.27%), Query Frame = -1
Query:  157 GHID---LPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENKLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISNEIEA 564
            G ID   +PQ V+C  +  NS++   K++RH  T H  +K K V+FF+ K DE+  K +             + S+  ++ IA   +A+TIG+TL+KPC  DI   IF ++   +I  +PLSNDT+ R+I D+++ I++
Sbjct:  133 GFIDANNVPQCVLCSKMFPNSAMVPAKMRRHLETIHPEFKHKQVDFFILKSDEINEKAT-------------EASYIVSYRIALAGEAHTIGETLIKPCAVDIAKCIFDEKSAKEITDVPLSNDTVARQIKDLASNIKS 258          

HSP 2 Score: 38.891 bits (89), Expect = 1.142e-24
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = -3
Query:    2 SNIIQKL---QKTLYYAIQMDESTHISNNAILLIYVRYEDYASKDIEEKLLCCLKL 160
            SNI  KL    K   +++QMDEST I+  AILL++VRY+   +   EE LL C  L
Sbjct:  254 SNIKSKLIFRLKNSNFSLQMDESTDIAGLAILLVFVRYQ--HTNLFEEDLLLCEPL 307          
BLAST of SMED30022498 vs. Planmine SMEST
Match: SMESG000079121.1 (SMESG000079121.1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.699e-23
Identity = 56/136 (41.18%), Postives = 79/136 (58.09%), Query Frame = -1
Query:  169 GHID---LPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIEN-KLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISN 564
            G ID   +PQ V+C     NS++   K+  H  T H  +K K V+FF+RKRDEL   QS         N K  + S+  ++ IA   +A+TIG+TL+KPC  DI   IF ++   +I  +PLSNDTI RRI D+++
Sbjct:   67 GFIDANNVPQCVLCSKSFPNSAMVPAKVCHHLETIHPEFKHKQVDFFIRKRDELLKSQSLIVSIFKTRNEKATEASYIVSYRIALAGEAHTIGETLIKPCAVDIAKCIFDEKSAKEITDVPLSNDTIARRIKDLAD 202          
BLAST of SMED30022498 vs. Planmine SMEST
Match: SMESG000079121.1 (SMESG000079121.1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.750e-23
Identity = 56/136 (41.18%), Postives = 79/136 (58.09%), Query Frame = -1
Query:  169 GHID---LPQYVICESVSANSSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIEN-KLLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIPLSNDTIGRRIIDISN 564
            G ID   +PQ V+C     NS++   K+  H  T H  +K K V+FF+RKRDEL   QS         N K  + S+  ++ IA   +A+TIG+TL+KPC  DI   IF ++   +I  +PLSNDTI RRI D+++
Sbjct:   67 GFIDANNVPQCVLCSKSFPNSAMVPAKVCHHLETIHPEFKHKQVDFFIRKRDELLKSQSLIVSIFKTRNEKATEASYIVSYRIALAGEAHTIGETLIKPCAVDIAKCIFDEKSAKEITDVPLSNDTIARRIKDLAD 202          
The following BLAST results are available for this feature:
BLAST of SMED30022498 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED92.798e-3137.67zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZMYM63.114e-3138.46zinc finger MYM-type containing 6 [Source:HGNC Sym... [more]
ZBED93.197e-3137.67zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED51.460e-2635.10zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED51.460e-2635.10zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
back to top
BLAST of SMED30022498 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022498 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022498 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AL928808.12.449e-828.17pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
back to top
BLAST of SMED30022498 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spag11.749e-729.20sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000016563.11.862e-729.20pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
back to top
BLAST of SMED30022498 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zmym61.231e-2734.55zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym61.263e-2734.55zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zbed55.182e-2437.16zinc finger, BED type containing 5 [Source:MGI Sym... [more]
back to top
BLAST of SMED30022498 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6R2W3|SCND3_HUMAN1.159e-3037.67SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
sp|O95789|ZMYM6_HUMAN1.290e-3038.46Zinc finger MYM-type protein 6 OS=Homo sapiens OX=... [more]
sp|Q49AG3|ZBED5_HUMAN6.052e-2635.10Zinc finger BED domain-containing protein 5 OS=Hom... [more]
sp|A4Z944|ZBED5_CANLF6.735e-2635.10Zinc finger BED domain-containing protein 5 OS=Can... [more]
sp|A4Z943|ZBED5_BOVIN7.313e-2635.10Zinc finger BED domain-containing protein 5 OS=Bos... [more]
back to top
BLAST of SMED30022498 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9LZ911.232e-5553.09DUF4371 domain-containing protein OS=Acyrthosiphon... [more]
X1WPB82.181e-5452.47DUF4371 domain-containing protein OS=Acyrthosiphon... [more]
A0A2S2QIN04.295e-4752.73SCAN domain-containing protein 3 (Fragment) OS=Sip... [more]
A0A2S2R2G62.116e-4550.00SCAN domain-containing protein 3 OS=Sipha flava OX... [more]
A0A2S2QDE81.615e-3741.46Zinc finger MYM-type protein 6 OS=Sipha flava OX=1... [more]
back to top
BLAST of SMED30022498 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044261.14.700e-2433.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051422.19.524e-2433.80pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000057314.12.000e-1834.59pep primary_assembly:Astyanax_mexicanus-2.0:1:4224... [more]
ENSAMXT00000051860.13.004e-1735.25pep primary_assembly:Astyanax_mexicanus-2.0:11:874... [more]
ENSAMXT00000047230.11.839e-1635.25pep primary_assembly:Astyanax_mexicanus-2.0:11:874... [more]
back to top
BLAST of SMED30022498 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022498 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022498 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022498 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000032459.16.648e-2837.68pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
ENSORLT00000035512.12.006e-2738.13pep primary_assembly:ASM223467v1:11:22712371:22714... [more]
ENSORLT00000040389.12.025e-2738.10pep primary_assembly:ASM223467v1:19:265767:268275:... [more]
ENSORLT00000028620.14.586e-2633.73pep primary_assembly:ASM223467v1:3:35179252:351815... [more]
ENSORLT00000030788.13.388e-2238.10pep primary_assembly:ASM223467v1:17:2264135:227416... [more]
back to top
BLAST of SMED30022498 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030287.11.153e-5158.78SMESG000030287.1[more]
SMESG000030106.11.540e-2641.46SMESG000030106.1[more]
SMESG000015406.11.142e-2435.97SMESG000015406.1[more]
SMESG000079121.11.699e-2341.18SMESG000079121.1[more]
SMESG000079121.11.750e-2341.18SMESG000079121.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022498 ID=SMED30022498|Name=SMED30022498|organism=Schmidtea mediterranea sexual|type=transcript|length=663bp
CTAGTTTTAAGCAACAGAGCAATTTTTCTTCTATGTCTTTGGAGGCATAA
TCTTCATATCTAACATATATAAGTAAAATAGCATTATTTGATATGTGTGT
GGATTCGTCCATCTGAATCGCGTAATACAAAGTTTTCTGTAGTTTTTGAA
TTATATTGCTTCAATCTCGTTAGATATATCAATTATTCGCCTACCAATTG
TGTCATTTGATAAAGGGATAGAATTAATTTTTGCTTCAAATTCTTTACCA
AATATATCGCTGCAGATGTCTTCCATGCAAGGTTTTAATAATGTTTTACC
AATTGTGTAGGCCTTTTTACATCTAGCAATATGAAAAGCTGCCGTGTGTG
AACACTTCAATAACTTATTTTCAATGGATACGAATTTTTTGAAACTTGAT
TGTTTTGCTTTCAATTCATCACGTTTCCTCAGAAAAAATTCAACAGGTTT
GCCTTTGTACGGCCCATGATTTGTATGAAAATGTCTTTGCAATTTATTGG
CTTTCAAGGACGAATTTGCCGAAACGCTTTCACAAATTACGTACTGCGGT
AAATCGATGTGGCCATCTTTTATGACTATACAACCGTATTCAATAAATTT
TTCCTTGTCACAATAATCATAATTCGTTTCTAGTTTAGCTTTTTTTGCCG
TTGATCCACTTGC
back to top

protein sequence of SMED30022498-orf-1

>SMED30022498-orf-1 ID=SMED30022498-orf-1|Name=SMED30022498-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
ASGSTAKKAKLETNYDYCDKEKFIEYGCIVIKDGHIDLPQYVICESVSAN
SSLKANKLQRHFHTNHGPYKGKPVEFFLRKRDELKAKQSSFKKFVSIENK
LLKCSHTAAFHIARCKKAYTIGKTLLKPCMEDICSDIFGKEFEAKINSIP
LSNDTIGRRIIDISNEIEAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR45935:SF4PROTEIN ZBED8coord: 21..167
NoneNo IPR availablePANTHERPTHR45935FAMILY NOT NAMEDcoord: 21..167