SMED30022493

Overview
NameSMED30022493
Smed IDSMED30022493
Length (bp)1547
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022493 (SMED30022493) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022493 (SMED30022493) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022493 (SMED30022493) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022493 (SMED30022493) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022493

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022493SMESG000023169.1 SmedASXL_009226SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022493SMESG000023169.1 SmedASXL_009226SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022493 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000204:99874..101567 -7516
Homology
BLAST of SMED30022493 vs. Ensembl Human
Match: PRPF3 (pre-mRNA processing factor 3 [Source:HGNC Symbol;Acc:HGNC:17348])

HSP 1 Score: 327.791 bits (839), Expect = 4.516e-104
Identity = 182/421 (43.23%), Postives = 270/421 (64.13%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRA--ELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPA-----RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + FK++ K+   + ++   + +++DPR+    + R++R   F+  G   +   + R + +L+ L+  ++++ ++TGI  + +LA I PK+   E  IPEIEWWD Y+          +P    + E   K  +   ITNL+EHP +  PP+D+ T + L +  T+ ++ + + +   E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    ++VY+V+NLS+P+ +FKIE NA QL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++       +  +E       + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:  274 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDME---SNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYI----------IPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 681          
BLAST of SMED30022493 vs. Ensembl Celegans
Match: prp-3 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:Q21486])

HSP 1 Score: 295.434 bits (755), Expect = 1.156e-92
Identity = 189/447 (42.28%), Postives = 272/447 (60.85%), Query Frame = -3
Query:  121 NKSSKLEK-QARLALLAQKFKASNIPLLSSVTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTD-ESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTE--IPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQD--NRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVL 1443
            +K S++E+ +ARLA      K   +   S     +P  +A Q+A      K+  +Q T++  +P+    Y DPRI+ ++  R++R   F+  G   +  NK RA  +L+ L+  ++ + Q TGI   VKLA + P      E+ +P+IEWWD  L+ DK + Y ++P ++ M    ++Y     ++ L+EHPI  + P + +T+  + + LT  E KK+RRQ R E+ KE+ EKIRLGL K P PKV++SNLMRVLG EA+QDPTK+EA VR QM +R + HET NA+RKLT+++ RAKK  KL E+ +   +V+VY+VK+L+HPS +FK+E NA QL M+G + +H   NV+VVEG  K+QK +K LM+NRI W+ +   ++  AE  D P   N CE+IWEG VK   F          E  ARE F K  V QYWDL YS  VL
Sbjct:  179 DKKSRMEELKARLARTTVMAKIDAMVGNSGAGVMAPLPEAVQQAE-----KKVQQQITKESKEPEKLIEYLDPRIQARTADRRRRGFNFHEKGEFEKLANKQRAMAKLERLQNEVSSAAQSTGISSAVKLAMVTPTGTAKMENGVPDIEWWD-MLVLDK-VNYDEIPAENDM----ERYSQT--VSELVEHPISMRAPTEPLTQQYLKVYLTTKEKKKIRRQNRKEVLKEKTEKIRLGLEKAPEPKVKISNLMRVLGNEAIQDPTKMEAQVRKQMAERLKKHETLNAERKLTEDQKRAKKTKKLSEDTSTAVNVSVYRVKSLAHPSKKFKVETNAKQLQMSGAIMMHKAQNVIVVEGGPKQQKFYKNLMINRIKWSDEIIGQKKDAEK-DAPGERNLCEMIWEGQVKRRNFRDFTVHTATLEKQAREFFEKHGVAQYWDLCYSTTVL 611          
BLAST of SMED30022493 vs. Ensembl Fly
Match: Prp3 (gene:FBgn0036915 transcript:FBtr0074892)

HSP 1 Score: 301.212 bits (770), Expect = 6.136e-96
Identity = 193/428 (45.09%), Postives = 264/428 (61.68%), Query Frame = -3
Query:  115 NIPLLSSVTRYSPTLKANQRARQNQLFKEE--YKQNTQKKIQPQPNA-SYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKR-LTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEI--PXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNL-SHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1377
            NIP ++      PTLKAN RA++ ++F+ +    + ++     Q  A  Y+D RI  K T R KR L F+ PG   Q   + R + +L+ L+  +++  ++TGI    KLA I PK+ + D+  +P +EWWD        I  +DL   D     +   +    ITNLIEHP + KPP + +  +  P+ LTK E KKLRRQ R E  KEEQEKIRLGL  PP PK+R+SNLMRVLG+EAVQDPTK+E +VR QM +R++ HE AN  RKLT E+   KK  KL+E+ +    V+VY++++L  + S +FK+E NA QL MTG V L   C VVVVEG  K+QKK++RLML RI W +DN +   +  D P   N C L+WEG+ +   FG+++FK  P E  ARE F+K  VE YWDL+YS  VL+A
Sbjct:  116 NIPTVT------PTLKANIRAKKREVFQRQTGLGERSESGTSAQEEAIKYFDDRIALKPTVRTKRTLRFHEPGKFQQLAERMRMKSQLERLQNEISQIARKTGISSATKLALIAPKQDMPDD--VPAMEWWDSV------ILTQDLETVDDASGKIS--IRQTAITNLIEHPTQMKPPNEPLKPVYLPVFLTKKERKKLRRQNRREAWKEEQEKIRLGLVAPPEPKLRISNLMRVLGSEAVQDPTKMEQHVRDQMAKRQKAHEDANNARKLTSEQKSEKKQRKLREDTSCGVHVSVYRIRDLQDNQSKKFKVETNAKQLQMTGSVVLFRDCCVVVVEGGPKQQKKYRRLMLTRIKWEEDNAKG-NDGQDVP---NSCVLVWEGTSQRRHFGEIKFKIFPMEKMAREFFQKHQVEHYWDLAYSGAVLEA 523          
BLAST of SMED30022493 vs. Ensembl Fly
Match: Prp3 (gene:FBgn0036915 transcript:FBtr0074891)

HSP 1 Score: 301.982 bits (772), Expect = 2.012e-95
Identity = 193/428 (45.09%), Postives = 264/428 (61.68%), Query Frame = -3
Query:  115 NIPLLSSVTRYSPTLKANQRARQNQLFKEE--YKQNTQKKIQPQPNA-SYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKR-LTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEI--PXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNL-SHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1377
            NIP ++      PTLKAN RA++ ++F+ +    + ++     Q  A  Y+D RI  K T R KR L F+ PG   Q   + R + +L+ L+  +++  ++TGI    KLA I PK+ + D+  +P +EWWD        I  +DL   D     +   +    ITNLIEHP + KPP + +  +  P+ LTK E KKLRRQ R E  KEEQEKIRLGL  PP PK+R+SNLMRVLG+EAVQDPTK+E +VR QM +R++ HE AN  RKLT E+   KK  KL+E+ +    V+VY++++L  + S +FK+E NA QL MTG V L   C VVVVEG  K+QKK++RLML RI W +DN +   +  D P   N C L+WEG+ +   FG+++FK  P E  ARE F+K  VE YWDL+YS  VL+A
Sbjct:  186 NIPTVT------PTLKANIRAKKREVFQRQTGLGERSESGTSAQEEAIKYFDDRIALKPTVRTKRTLRFHEPGKFQQLAERMRMKSQLERLQNEISQIARKTGISSATKLALIAPKQDMPDD--VPAMEWWDSV------ILTQDLETVDDASGKIS--IRQTAITNLIEHPTQMKPPNEPLKPVYLPVFLTKKERKKLRRQNRREAWKEEQEKIRLGLVAPPEPKLRISNLMRVLGSEAVQDPTKMEQHVRDQMAKRQKAHEDANNARKLTSEQKSEKKQRKLREDTSCGVHVSVYRIRDLQDNQSKKFKVETNAKQLQMTGSVVLFRDCCVVVVEGGPKQQKKYRRLMLTRIKWEEDNAKG-NDGQDVP---NSCVLVWEGTSQRRHFGEIKFKIFPMEKMAREFFQKHQVEHYWDLAYSGAVLEA 593          
BLAST of SMED30022493 vs. Ensembl Zebrafish
Match: prpf3 (PRP3 pre-mRNA processing factor 3 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-040823-3])

HSP 1 Score: 328.561 bits (841), Expect = 1.761e-104
Identity = 194/417 (46.52%), Postives = 274/417 (65.71%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDS---VTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDN-RRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T   PTLKAN RA + + F+++ K+     ++   + SY+DPR+      + K+   F+  G   +   + R + +L+ L+  +A++ ++TGI  + KLA I PK+   E +IP IEWWD Y++     F+ +L        N+D+ V +  +TNL+EHP +  PP+D+   VT + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    + VY+++NL +P+ +FK+E NANQL +TG V LH   N+VVVEG  K QKKFKRLML RI W++ N +R      DE  R N C L+WEG+ K   +G+++FK CPTE  ARE F+K   E YWDL+ S+ VL+
Sbjct:  285 LTHRMPTLKANIRAVKREQFRQQLKEKPSDDLE---STSYFDPRVALAPALKPKKGFRFHEQGRFEKIAQRIRTKAQLEKLQMEIAQAAKKTGIQASTKLALIAPKKELGEGEIPNIEWWDSYILP----FHINLSAHT----NLDE-VEMHGVTNLVEHPTQMAPPVDTDKPVT-LGVYLTKKEQKKLRRQTRREGQKEVQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKEKKVKKLKEDLSHGVHIAVYRIRNLHNPAKKFKVEANANQLYLTGTVVLHKDVNIVVVEGGPKAQKKFKRLMLTRIKWDEPNSKRDEHHDDDESRRNNRCSLVWEGTSKERNYGEVKFKQCPTENMAREHFKKHGTEHYWDLALSQSVLE 688          
BLAST of SMED30022493 vs. Ensembl Zebrafish
Match: prpf3 (PRP3 pre-mRNA processing factor 3 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-040823-3])

HSP 1 Score: 328.946 bits (842), Expect = 1.923e-104
Identity = 194/417 (46.52%), Postives = 274/417 (65.71%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDS---VTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDN-RRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T   PTLKAN RA + + F+++ K+     ++   + SY+DPR+      + K+   F+  G   +   + R + +L+ L+  +A++ ++TGI  + KLA I PK+   E +IP IEWWD Y++     F+ +L        N+D+ V +  +TNL+EHP +  PP+D+   VT + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    + VY+++NL +P+ +FK+E NANQL +TG V LH   N+VVVEG  K QKKFKRLML RI W++ N +R      DE  R N C L+WEG+ K   +G+++FK CPTE  ARE F+K   E YWDL+ S+ VL+
Sbjct:  292 LTHRMPTLKANIRAVKREQFRQQLKEKPSDDLE---STSYFDPRVALAPALKPKKGFRFHEQGRFEKIAQRIRTKAQLEKLQMEIAQAAKKTGIQASTKLALIAPKKELGEGEIPNIEWWDSYILP----FHINLSAHT----NLDE-VEMHGVTNLVEHPTQMAPPVDTDKPVT-LGVYLTKKEQKKLRRQTRREGQKEVQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKEKKVKKLKEDLSHGVHIAVYRIRNLHNPAKKFKVEANANQLYLTGTVVLHKDVNIVVVEGGPKAQKKFKRLMLTRIKWDEPNSKRDEHHDDDESRRNNRCSLVWEGTSKERNYGEVKFKQCPTENMAREHFKKHGTEHYWDLALSQSVLE 695          
BLAST of SMED30022493 vs. Ensembl Zebrafish
Match: prpf3 (PRP3 pre-mRNA processing factor 3 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-040823-3])

HSP 1 Score: 328.946 bits (842), Expect = 1.923e-104
Identity = 194/417 (46.52%), Postives = 274/417 (65.71%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDS---VTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDN-RRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T   PTLKAN RA + + F+++ K+     ++   + SY+DPR+      + K+   F+  G   +   + R + +L+ L+  +A++ ++TGI  + KLA I PK+   E +IP IEWWD Y++     F+ +L        N+D+ V +  +TNL+EHP +  PP+D+   VT + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    + VY+++NL +P+ +FK+E NANQL +TG V LH   N+VVVEG  K QKKFKRLML RI W++ N +R      DE  R N C L+WEG+ K   +G+++FK CPTE  ARE F+K   E YWDL+ S+ VL+
Sbjct:  292 LTHRMPTLKANIRAVKREQFRQQLKEKPSDDLE---STSYFDPRVALAPALKPKKGFRFHEQGRFEKIAQRIRTKAQLEKLQMEIAQAAKKTGIQASTKLALIAPKKELGEGEIPNIEWWDSYILP----FHINLSAHT----NLDE-VEMHGVTNLVEHPTQMAPPVDTDKPVT-LGVYLTKKEQKKLRRQTRREGQKEVQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKEKKVKKLKEDLSHGVHIAVYRIRNLHNPAKKFKVEANANQLYLTGTVVLHKDVNIVVVEGGPKAQKKFKRLMLTRIKWDEPNSKRDEHHDDDESRRNNRCSLVWEGTSKERNYGEVKFKQCPTENMAREHFKKHGTEHYWDLALSQSVLE 695          
BLAST of SMED30022493 vs. Ensembl Xenopus
Match: PRPF3 (pre-mRNA processing factor 3 [Source:NCBI gene;Acc:447950])

HSP 1 Score: 337.035 bits (863), Expect = 2.008e-108
Identity = 200/423 (47.28%), Postives = 278/423 (65.72%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPID--SVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQ--------DNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T   PTLKAN RA + + FK++ K+   + ++     +++DPR+   S+ R+KR   F+  G   +   + R + +L+ L+  +A++ ++TGI  + +LA I PK+   E +IPEIEWWD +++ +      +L E     E + K  +   ITNL+EHP +  PP+D  +   + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEA+QDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    VTVY ++NLS+PS +FKIE NANQL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++        DN  +  E+V    + N C L+WEG+ K  +FG M+FK CPTE  ARE F+K   E YWDL+ SK VL+
Sbjct:  200 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDLEAN---TFFDPRVSIASSQRQKRLFKFHEKGKFEKIAQRLRTKSQLEKLQAEIAQAAKKTGIQTSTRLALIAPKKELREGEIPEIEWWDSFIIPNGT----ELTE-----EALLKREDFHGITNLVEHPAQLSPPVDRDAPVTLGIYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAIQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKEKKVKKLKEDISQGIHVTVYSIRNLSNPSKKFKIEANANQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLSRIKWDEQTTNTKGNDNDESDEESV---TKTNRCTLVWEGTTKERSFGDMKFKQCPTENMAREHFKKHGAEHYWDLALSKSVLE 607          
BLAST of SMED30022493 vs. Ensembl Xenopus
Match: PRPF3 (pre-mRNA processing factor 3 [Source:NCBI gene;Acc:447950])

HSP 1 Score: 335.88 bits (860), Expect = 2.702e-107
Identity = 196/423 (46.34%), Postives = 276/423 (65.25%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPID--SVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQ--------DNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T   PTLKAN RA + + FK++ K+   + ++     +++DPR+   S+ R+KR   F+  G   +   + R + +L+ L+  +A++ ++TGI  + +LA I PK+   E +IPEIEWWD +++ ++ +  ++               +   ITNL+EHP +  PP+D  +   + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEA+QDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    VTVY ++NLS+PS +FKIE NANQL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++        DN  +  E+V    + N C L+WEG+ K  +FG M+FK CPTE  ARE F+K   E YWDL+ SK VL+
Sbjct:  274 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDLEAN---TFFDPRVSIASSQRQKRLFKFHEKGKFEKIAQRLRTKSQLEKLQAEIAQAAKKTGIQTSTRLALIAPKKELREGEIPEIEWWDSFIIPNEALLKRE---------------DFHGITNLVEHPAQLSPPVDRDAPVTLGIYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAIQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKEKKVKKLKEDISQGIHVTVYSIRNLSNPSKKFKIEANANQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLSRIKWDEQTTNTKGNDNDESDEESV---TKTNRCTLVWEGTTKERSFGDMKFKQCPTENMAREHFKKHGAEHYWDLALSKSVLE 675          
BLAST of SMED30022493 vs. Ensembl Xenopus
Match: PRPF3 (pre-mRNA processing factor 3 [Source:NCBI gene;Acc:447950])

HSP 1 Score: 299.286 bits (765), Expect = 2.133e-93
Identity = 189/415 (45.54%), Postives = 261/415 (62.89%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPID--SVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T   PTLKAN RA + + FK++ K+   + ++     +++DPR+   S+ R+KR   F+  G   +   + R + +L+ L+  +A++ ++TGI  + +LA I PK+   E +IPEIEWWD +++ +      +L E     E + K  +   ITNL+EHP +  PP+D  +   + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEA+QDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    VTVY ++NLS+PS +FKIE NANQL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W  D +    +   E   L    +I              F  CPTE  ARE F+K   E YWDL+ SK VL+
Sbjct:  271 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDLEAN---TFFDPRVSIASSQRQKRLFKFHEKGKFEKIAQRLRTKSQLEKLQAEIAQAAKKTGIQTSTRLALIAPKKELREGEIPEIEWWDSFIIPNGT----ELTE-----EALLKREDFHGITNLVEHPAQLSPPVDRDAPVTLGIYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAIQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKEKKVKKLKEDISQGIHVTVYSIRNLSNPSKKFKIEANANQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLSRIKW--DEQTTNTKGNGESQCLISLPIIM-----------TNFLICPTENMAREHFKKHGAEHYWDLALSKSVLE 660          
BLAST of SMED30022493 vs. Ensembl Xenopus
Match: PRPF3 (pre-mRNA processing factor 3 [Source:NCBI gene;Acc:447950])

HSP 1 Score: 244.973 bits (624), Expect = 1.925e-73
Identity = 153/327 (46.79%), Postives = 218/327 (66.67%), Query Frame = -3
Query:  382 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPID--SVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGN 1356
            +T   PTLKAN RA + + FK++ K+   + ++     +++DPR+   S+ R+KR   F+  G   +   + R + +L+ L+  +A++ ++TGI  + +LA I PK+   E +IPEIEWWD +++ +      +L E     E + K  +   ITNL+EHP +  PP+D  +   + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEA+QDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    VTVY ++NLS+PS +FKIE NANQL +TG+V LH   NVVVVEG 
Sbjct:  271 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDLEAN---TFFDPRVSIASSQRQKRLFKFHEKGKFEKIAQRLRTKSQLEKLQAEIAQAAKKTGIQTSTRLALIAPKKELREGEIPEIEWWDSFIIPNGT----ELTE-----EALLKREDFHGITNLVEHPAQLSPPVDRDAPVTLGIYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAIQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKEKKVKKLKEDISQGIHVTVYSIRNLSNPSKKFKIEANANQLYLTGVVVLHKDVNVVVVEGG 585          
BLAST of SMED30022493 vs. Ensembl Mouse
Match: Prpf3 (pre-mRNA processing factor 3 [Source:MGI Symbol;Acc:MGI:1918017])

HSP 1 Score: 329.331 bits (843), Expect = 1.024e-104
Identity = 182/421 (43.23%), Postives = 271/421 (64.37%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRA--ELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPA-----RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + FK++ K+   + ++   + +++DPR+    + R++R   F+  G   +   + R + +L+ L+  ++++ ++TGI  + +LA I PK+   E  IPEIEWWD Y+          +P    + E   K  +   ITNL+EHP +  PP+D+ T + L +  T+ ++ + + +   E QKE QEK+RLGL+ PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    ++VY+V+NLS+P+ +FKIE NA QL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++       +  +E       + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:  274 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDME---SNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYI----------IPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLTPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 681          
BLAST of SMED30022493 vs. Ensembl Mouse
Match: Prpf3 (pre-mRNA processing factor 3 [Source:MGI Symbol;Acc:MGI:1918017])

HSP 1 Score: 329.331 bits (843), Expect = 1.024e-104
Identity = 182/421 (43.23%), Postives = 271/421 (64.37%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRA--ELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPA-----RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + FK++ K+   + ++   + +++DPR+    + R++R   F+  G   +   + R + +L+ L+  ++++ ++TGI  + +LA I PK+   E  IPEIEWWD Y+          +P    + E   K  +   ITNL+EHP +  PP+D+ T + L +  T+ ++ + + +   E QKE QEK+RLGL+ PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    ++VY+V+NLS+P+ +FKIE NA QL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++       +  +E       + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:  274 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDME---SNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYI----------IPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLTPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 681          
BLAST of SMED30022493 vs. Ensembl Mouse
Match: Prpf3 (pre-mRNA processing factor 3 [Source:MGI Symbol;Acc:MGI:1918017])

HSP 1 Score: 71.633 bits (174), Expect = 8.157e-15
Identity = 33/65 (50.77%), Postives = 44/65 (67.69%), Query Frame = -3
Query:  115 EAVDEPA--RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 303
            E  DE A  + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:   48 EESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 112          
BLAST of SMED30022493 vs. UniProt/SwissProt
Match: sp|Q5ZJ85|PRPF3_CHICK (U4/U6 small nuclear ribonucleoprotein Prp3 OS=Gallus gallus OX=9031 GN=PRPF3 PE=2 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 2.132e-106
Identity = 192/422 (45.50%), Postives = 272/422 (64.45%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLM-NDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRA--ELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPA-----RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + FK++ K+   + ++   + +Y+D R+      R+KR   F+  G   +   + R + +LK L+  ++++ ++TGI  + KLA I PK+   E +IPEIEWWD Y++ N  D+       K G     D+Y     ITNL+EHP +  PP+DS T + L +  T+ ++ + + +   E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ +AKK+ KL+E+ +    + VY+V+NLS+P+ +FKIE NA QL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++       E  DE       + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:  274 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDME---SNTYFDLRVSITPAQRQKRTFKFHEKGKFEKIAQRLRTKAQLKKLQAEISQAARKTGIHTSTKLALITPKKELKEGEIPEIEWWDSYIIPNGLDL-------KGGTSSKKDEYFG---ITNLVEHPAQLNPPVDSDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKAKKIKKLKEDVSQGVHIAVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGEDDDESDEESVKKTNKCSLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 682          
BLAST of SMED30022493 vs. UniProt/SwissProt
Match: sp|Q922U1|PRPF3_MOUSE (U4/U6 small nuclear ribonucleoprotein Prp3 OS=Mus musculus OX=10090 GN=Prpf3 PE=1 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 7.162e-104
Identity = 182/421 (43.23%), Postives = 271/421 (64.37%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRA--ELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPA-----RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + FK++ K+   + ++   + +++DPR+    + R++R   F+  G   +   + R + +L+ L+  ++++ ++TGI  + +LA I PK+   E  IPEIEWWD Y+          +P    + E   K  +   ITNL+EHP +  PP+D+ T + L +  T+ ++ + + +   E QKE QEK+RLGL+ PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    ++VY+V+NLS+P+ +FKIE NA QL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++       +  +E       + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:  274 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDME---SNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYI----------IPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLTPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 681          
BLAST of SMED30022493 vs. UniProt/SwissProt
Match: sp|O43395|PRPF3_HUMAN (U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 2.169e-103
Identity = 182/421 (43.23%), Postives = 270/421 (64.13%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRA--ELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPA-----RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + FK++ K+   + ++   + +++DPR+    + R++R   F+  G   +   + R + +L+ L+  ++++ ++TGI  + +LA I PK+   E  IPEIEWWD Y+          +P    + E   K  +   ITNL+EHP +  PP+D+ T + L +  T+ ++ + + +   E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    ++VY+V+NLS+P+ +FKIE NA QL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++       +  +E       + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:  274 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDME---SNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYI----------IPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 681          
BLAST of SMED30022493 vs. UniProt/SwissProt
Match: sp|Q2KIA6|PRPF3_BOVIN (U4/U6 small nuclear ribonucleoprotein Prp3 OS=Bos taurus OX=9913 GN=PRPF3 PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 2.239e-103
Identity = 182/421 (43.23%), Postives = 270/421 (64.13%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRA--ELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPA-----RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + FK++ K+   + ++   + +++DPR+    + R++R   F+  G   +   + R + +L+ L+  ++++ ++TGI  + +LA I PK+   E  IPEIEWWD Y+          +P    + E   K  +   ITNL+EHP +  PP+D+ T + L +  T+ ++ + + +   E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    ++VY+V+NLS+P+ +FKIE NA QL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++       +  +E       + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:  274 LTHRMPTLKANIRAVKREQFKQQLKEKPSEDME---SNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYI----------IPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 681          
BLAST of SMED30022493 vs. UniProt/SwissProt
Match: sp|Q5R5F1|PRPF3_PONAB (U4/U6 small nuclear ribonucleoprotein Prp3 OS=Pongo abelii OX=9601 GN=PRPF3 PE=2 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 4.523e-103
Identity = 181/421 (42.99%), Postives = 270/421 (64.13%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRA--ELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPA-----RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + F+++ K+   + ++   + +++DPR+    + R++R   F+  G   +   + R + +L+ L+  ++++ ++TGI  + +LA I PK+   E  IPEIEWWD Y+          +P    + E   K  +   ITNL+EHP +  PP+D+ T + L +  T+ ++ + + +   E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    ++VY+V+NLS+P+ +FKIE NA QL +TG+V LH   NVVVVEG  K QKKFKRLML+RI W++       +  +E       + N C L+WEG+ K  +FG+M+FK CPTE  ARE F+K   E YWDL+ S+ VL++
Sbjct:  274 LTHRMPTLKANIRAVKREQFRQQLKEKPSEDME---SNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYI----------IPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLES 681          
BLAST of SMED30022493 vs. TrEMBL
Match: A0A3R7GNA4 (U4/U6 small nuclear ribonucleoprotein Prp3 OS=Clonorchis sinensis OX=79923 GN=PRPF3 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 1.086e-144
Identity = 229/424 (54.01%), Postives = 308/424 (72.64%), Query Frame = -3
Query:  106 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPN---ASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPE--KDGMLENVDKYVNLDWITNLIEHPIKAKPP--IDSVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQAEGE 1356
            +T Y+PTLKAN RA++ Q FKE  +  TQKK  PQ N    +Y+DPR+  K+  R KR L F  PG  I+   + R +++L+ L++S+A++ +RTGI    KL+ IQPKR+ DES++P +EWWD Y++ D    Y  L +  ++G+  +V   +N  WITNL+EHPIK KPP  +    EIPLLLTK E KK+RRQ R E QKE QEK+RLGL  PP PKVRL+NLMRVLG++AVQDP+K+EAYVR+QME RKR HE ANA RKLTKE++R K++ K++E+ +    V+VY+VK+ S+PSHRFK+E NANQLLMTG+VALHS CNVVVVEG  ++Q+KF+RLML+RI W++  R       +  +   GC+L+W+G+V   AF K++F+ CPTE++AREQFRK DVE YWDL YS  +L+A G+
Sbjct:  130 LTHYTPTLKANLRAQRAQQFKEVLQTTTQKK--PQKNLTATAYFDPRLSMKAARRPKRQLSFYEPGKFIKLAQRMRTKQQLELLQQSVAQAVKRTGIASAAKLSTIQPKRVVDESEVPTLEWWDAYILKDGVTAYSALDDAAEEGLPTSV--ILNKAWITNLVEHPIKLKPPRELSKPPEIPLLLTKKERKKVRRQNRQEAQKERQEKVRLGLMPPPEPKVRLANLMRVLGSDAVQDPSKVEAYVRAQMESRKRAHEAANAARKLTKEQARYKRIKKIKEDTSQAVHVSVYRVKDFSNPSHRFKVETNANQLLMTGLVALHSDCNVVVVEGGPRQQRKFERLMLHRIKWHETKRGRDEGNQNANSAEPGCQLVWKGTVGQRAFDKVQFRACPTELFAREQFRKRDVEHYWDLCYSGAILEATGQ 549          
BLAST of SMED30022493 vs. TrEMBL
Match: A0A4S2M644 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003447 PE=4 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 3.393e-144
Identity = 228/424 (53.77%), Postives = 308/424 (72.64%), Query Frame = -3
Query:  106 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPN---ASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPE--KDGMLENVDKYVNLDWITNLIEHPIKAKPP--IDSVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQAEGE 1356
            +T Y+PTLKAN RA++ Q FKE  +  TQKK  PQ N    +Y+DPR+  K+  R KR L F  PG  I+   + R +++L+ L++S+A++ +RTGI    KL+ IQPKR+ DES++P +EWWD Y++ D    Y  L +  ++G+  +V   +N  WITNL+EHPIK KPP  +    EIPLLLTK E KK+RRQ R E QKE QEK+RLGL  PP PKVRL+NLMRVLG++AVQDP+K+EAYVR+QME RKR HE ANA RKLTKE++R K++ K++E+ +    V+VY+VK+ S+PSHRFK+E NANQLLMTG+VALH+ CNVVVVEG  ++Q+KF+RLML+RI W++  R       +  +   GC+L+W+G+V   AF K++F+ CPTE++AREQFRK DVE YWDL YS  +L+A G+
Sbjct:  130 LTHYTPTLKANLRAQRAQQFKEVLQTTTQKK--PQKNLTATAYFDPRLSTKAARRPKRQLSFYEPGKFIKLAQRMRTKQQLELLQQSVAQAVKRTGIASAAKLSTIQPKRVVDESEVPTLEWWDAYILKDGVTAYSALDDAAEEGLPTSV--ILNKAWITNLVEHPIKLKPPRELSKPPEIPLLLTKKERKKVRRQNRQEAQKERQEKVRLGLMPPPEPKVRLANLMRVLGSDAVQDPSKVEAYVRAQMESRKRAHEAANAARKLTKEQARYKRIKKIKEDTSQAVHVSVYRVKDFSNPSHRFKVETNANQLLMTGLVALHTDCNVVVVEGGPRQQRKFERLMLHRIKWHETKRGRDEGNQNANSTEPGCQLVWKGTVGQRAFDKVQFRACPTELFAREQFRKRDVEHYWDLCYSGAILEATGQ 549          
BLAST of SMED30022493 vs. TrEMBL
Match: A0A183NSS4 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS5160 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 1.881e-141
Identity = 229/427 (53.63%), Postives = 296/427 (69.32%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNAS-YYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPID--SVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPA-----------EAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T Y+PTLKAN RA++ Q FKE  +  TQKK Q    ++ ++DPR++ K+  R KR L F+ PG  ++   + R + +L+ L+ES+A++ ++TGI    KL+ IQPKR  DE+ IP +EWWD Y++ +    Y  L E       V   VN  WIT+L+EHP+K KPP D     EIPLLLTK E KKLRRQ R E Q+E+QEK+RLGL  PP PKVRL+NLMRVLG++AVQDP+K+EAYVR+QME RKR HE ANA RKLTKE++R K++ K++E+      V VY+VK+ S+PSHRFK+E NANQLLMTG+VALHS CNVVVVEG  K+Q+KF+RLML RI W +  R                A  E     GC LIW+G+VK  AF K++FK CPTE+YAREQFRK DVE YWDL+YS  +L+
Sbjct:  124 LTHYTPTLKANLRAKRAQQFKEVLQTTTQKKPQKSSVSTMFFDPRLRVKAASRPKRQLSFHEPGKFVKMAQRMRTKFQLQVLQESVAQAVRKTGIASAAKLSTIQPKRSVDETDIPLLEWWDAYILKEGVTSYSTLDELAIHGLPVSAAVNKAWITSLVEHPVKLKPPTDLSKPPEIPLLLTKKERKKLRRQNRQEAQREKQEKVRLGLMPPPEPKVRLANLMRVLGSDAVQDPSKVEAYVRAQMESRKRAHEAANAARKLTKEQARYKRIKKIREDTTHAVHVAVYRVKDFSNPSHRFKVETNANQLLMTGLVALHSDCNVVVVEGGPKQQRKFQRLMLCRIKWREGKRGTAGNPSGSFAHEDRAATSELDSDTGCRLIWKGTVKQRAFDKIQFKACPTELYAREQFRKRDVEHYWDLAYSGAILE 550          
BLAST of SMED30022493 vs. TrEMBL
Match: A0A430QCL5 (U4/U6 small nuclear ribonucleoprotein PRP3 OS=Schistosoma bovis OX=6184 GN=DC041_0004731 PE=4 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 3.338e-141
Identity = 230/430 (53.49%), Postives = 298/430 (69.30%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNAS-YYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPID--SVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNR--------------RAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T Y+PTLKAN RA++ Q FKE  +  TQKK Q    ++ ++DPR++ K+  R KR L F+ PG  ++   + R + +L+ L+ES+A++ ++TGI    KL+ IQPKR  DE+ IP +EWWD Y++ +    Y  L E       V   VN  WIT+L+EHP+K KPP D     EIPLLLTK E KKLRRQ R E Q+E+QEK+RLGL  PP PKVRL+NLMRVLG++AVQDP+K+EAYVR+QME RKR HE ANA RKLTKE++R K++ K++E+      V VY+VK+ S+PSHRFK+E NANQLLMTG+VALHS CNVVVVEG  K+Q+KF+RLML RI W +  R              RA    +D      GC LIW+G+VK  AF K++FK CPTE+YAREQFRK DVE YWDL+YS  +L+
Sbjct:  136 LTHYTPTLKANLRAKRAQQFKEVLQTTTQKKPQKSSVSTIFFDPRLRVKAASRPKRQLSFHEPGKFVKMAQRMRTKFQLQVLQESVAQAVRKTGIASAAKLSTIQPKRSVDETDIPLLEWWDAYILKEGVTSYSTLDELAIHGLPVSAAVNKAWITSLVEHPVKLKPPTDLSKPPEIPLLLTKKERKKLRRQNRQEAQREKQEKVRLGLMPPPEPKVRLANLMRVLGSDAVQDPSKVEAYVRAQMESRKRAHEAANAARKLTKEQARYKRIKKIREDTTHTVHVAVYRVKDFSNPSHRFKVETNANQLLMTGLVALHSDCNVVVVEGGPKQQRKFQRLMLCRIKWREGKRGTVGNPSGSFSHEDRAATSELDSD---TGCRLIWKGTVKQRAFDKIQFKACPTELYAREQFRKRDVEHYWDLAYSGAILE 562          
BLAST of SMED30022493 vs. TrEMBL
Match: A0A3Q0KGM3 (U4/U6-associated RNA splicing factor-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 4.380e-141
Identity = 230/430 (53.49%), Postives = 300/430 (69.77%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNAS-YYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPID--SVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNR--------------RAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T Y+PTLKAN RA++ Q FKE  +  TQKK Q    ++ ++DPR++ K+  R KR L F+ PG  ++   + R + +L+ L+ES+A++ ++TGI    KL+ IQPKR  DE+ IP +EWWD Y++ +    Y  L E       V   VN  WIT+L+EHP+K KPP D     EIPLLLTK E KKLRRQ R E Q+E+QEK+RLGL  PP PKVRL+NLMRVLG++AVQDP+K+EAYVR+QME RKR HE ANA RKLTKE++R K++ K++E+ +    V VY+VK+ S+PSHRFK+E NANQLLMTG+VALHS CNVVVVEG  K+Q+KF+RLML RI W +  R              RA    +D  +   GC LIW+G+VK  AF K++FK CPTE+YAREQFRK DVE YWDL+YS  +L+
Sbjct:  124 LTHYTPTLKANLRAKRAQQFKEVLQTTTQKKPQKSSVSTIFFDPRLRVKTASRPKRQLSFHEPGKFVKMAQRMRTKFQLQILQESVAQAVRKTGIASAAKLSTIQPKRSIDETDIPLLEWWDAYILKEGVTSYSTLDELAIHGLPVSAAVNKAWITSLVEHPVKLKPPTDLSKPPEIPLLLTKKERKKLRRQNRQEAQREKQEKVRLGLMPPPEPKVRLANLMRVLGSDAVQDPSKVEAYVRAQMESRKRAHEAANAARKLTKEQARYKRIKKIREDTSHAVHVAVYRVKDFSNPSHRFKVETNANQLLMTGLVALHSDCNVVVVEGGPKQQRKFQRLMLCRIKWREGKRGTVGNGSGSFAHEDRAATSELDNDS---GCRLIWKGTVKQRAFDKIQFKACPTELYAREQFRKRDVEHYWDLAYSGAILE 550          
BLAST of SMED30022493 vs. Ensembl Cavefish
Match: prpf3 (pre-mRNA processing factor 3 [Source:NCBI gene;Acc:103033241])

HSP 1 Score: 325.094 bits (832), Expect = 5.790e-103
Identity = 191/420 (45.48%), Postives = 273/420 (65.00%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDS---VTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDN-RRAPAEAVDEPA--RLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + F+++ K+     ++   + SY+DPR+      R +R   F+  G   +   + R + +L+ L+  +A++ ++TGI  + KLA I PK+   E ++P IEWWD Y++        ++     +L+ V+       +TNL+EHP +  PP+DS   VT + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKLT E+ + KK+ KL+E+ +    + VY+++NL +P+ +FK+E NANQL +TG V LH   N+VVVEG  K QKKFKRLMLNRI W + N +R   +  DE    + N C L+WEG+ K  +FG ++FK CPTE  ARE F+K   E YWD++ S+ +L++
Sbjct:  299 LTHRMPTLKANIRAVKREQFRQQLKEKPSDDLE---STSYFDPRMIVPPPQRARRGFKFHEQGRFEKIAQRIRTKTQLERLQMEIAQAAKKTGIQASTKLALIAPKKELGEGEVPFIEWWDSYILPSNVELSSEM-----VLDGVE----FHGVTNLVEHPAQMAPPVDSDKPVT-LGVYLTKKEQKKLRRQTRREGQKEVQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKEKKVKKLKEDLSQGVHIAVYRIRNLHNPAKKFKVEANANQLYLTGTVVLHKDVNIVVVEGGPKSQKKFKRLMLNRIKWEEHNSKRDDPDGSDEEGSKKTNKCTLVWEGTAKERSFGDVKFKQCPTENMAREHFKKHATEHYWDMALSQSILES 705          
BLAST of SMED30022493 vs. Ensembl Sea Lamprey
Match: prpf3 (PRP3 pre-mRNA processing factor 3 homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-040823-3])

HSP 1 Score: 344.739 bits (883), Expect = 2.362e-114
Identity = 199/426 (46.71%), Postives = 273/426 (64.08%), Query Frame = -3
Query:  118 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLM-----NDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPP-----IDSVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARL---NGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQ 1356
            +T   PTLKAN RA + Q FK++ K+   + ++ Q    +YDPR+  +   R +R   F+  G   +   + R + +L+ L+  +A++ ++TGI    KLA I PK+   + ++PE+EWWD Y++     +D D+  +        LE       LD ITNL+EHP +   P     ID    + + LTK E KKLRRQTR E QKE QEKIRLGL+ PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R R HE ANA RKL  E+ R KK+ KL+E+      ++VY++++L++PS +FKIE NANQL +TG V LH   NVVVVEG  K QKKF+RLM+NRI W +++    ++++    R    N C L+WEG+ K  +FG+M+FK CPTE  ARE FRK  VEQYWDL  S+ VL+
Sbjct:   37 LTHRMPTLKANIRAVRRQQFKQQLKERPTEDVEAQ---HFYDPRVPAEVASRPRRHFRFHDKGRFEKIAQRIRCKAQLEKLQSEIAQAAKKTGIQSATKLALIAPKKEQQDDEVPEVEWWDYYILPSSYDHDSDVHLE--------LEKG----QLDGITNLVEHPAQINSPSADTEIDKPVTLGIYLTKKERKKLRRQTRREAQKELQEKIRLGLAPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRLRAHEEANAARKLPVEQRREKKIKKLKEDTTSGVHISVYRIRDLTNPSKKFKIETNANQLFLTGGVVLHKDVNVVVVEGGPKSQKKFRRLMMNRIKWAEESNSKESDSLSSEIRRRKPNSCTLVWEGTAKERSFGEMKFKQCPTESLAREHFRKHGVEQYWDLCLSESVLE 447          
BLAST of SMED30022493 vs. Ensembl Yeast
Match: PRP3 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000002881])

HSP 1 Score: 82.0333 bits (201), Expect = 3.596e-17
Identity = 60/207 (28.99%), Postives = 96/207 (46.38%), Query Frame = -3
Query:  148 KIRLGLSKPPVPKVRLSNLMRVL-GTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIV--ALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQD-NRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYW 756
            KI+LGL   P PKV+LSN+M V    + + DPT  E  V+ Q++ RKR H   N +R     + R + +    E P       V++ KNL +P  RFK++ N+ +L + G+          +++V GN K  K ++ L++ RI WN+D         +      N     WEG ++   F     K C  +        + D E ++
Sbjct:  259 KIKLGLLPKPEPKVKLSNMMSVFENDQNITDPTAWEKVVKDQVDLRKRKHLEENERRHEDAIKRRKEAVNMNVEKPT-VYHCKVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEKSCKFYENLVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQDSLLRTLGQFDSEHFY 464          
BLAST of SMED30022493 vs. Ensembl Nematostella
Match: EDO39216 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAL9])

HSP 1 Score: 302.753 bits (774), Expect = 3.936e-95
Identity = 174/411 (42.34%), Postives = 248/411 (60.34%), Query Frame = -3
Query:  115 PTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPID--SVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1341
            PTLKAN RA++ + FK E      K  +     SY+DPR+   +  R KR   F+  G   Q   + R + +L+ L++ +A   ++TGI    KLA I P +  +E  IP+IEWWD  ++ D               +  D Y +L+ IT L+EHP++  PP +      +P++LT  E KK+R Q R E++KE  EKIRLGL  PP PKV++SNLMRVLG EAVQDPTK+EA+VR+QM QR++ HE ANA RKLT E  R K + KL+E+ +    V V++V +L  P  ++K++ NA QL +TG V +     +VVVEG  K  KKFKRLML+RI W ++ ++   +  DE  R N C L+WEG+ +  +F   +FK CP+E +ARE  +K  VE YWDL+  + +L+ 
Sbjct:  284 PTLKANIRAKKREQFKVE------KPSEDLTERSYFDPRVTVPAAVRPKRTFKFHEKGKFQQVAQRIRTKTQLEKLQKQIAAVAKKTGISSATKLALIAPNKDVEEKHIPDIEWWDRVIIPDG--------------KYSDNYPSLNGITALVEHPVQKHPPAEPKEPPTVPIMLTSKERKKMRTQRRREVEKERTEKIRLGLEPPPPPKVKISNLMRVLGNEAVQDPTKVEAHVRAQMAQRQKAHEAANAARKLTPEARRDKNVKKLKEDTSLGVHVAVFRVDDLHDPQRKYKVDINAQQLYLTGCVMVFKEMYLVVVEGGPKAVKKFKRLMLHRIKWAEERKQRHRDNDDEDRRPNQCALVWEGTNRERSFSDWKFKQCPSESFAREHLKKYGVEHYWDLARRESLLEG 674          
BLAST of SMED30022493 vs. Ensembl Medaka
Match: prpf3 (pre-mRNA processing factor 3 [Source:NCBI gene;Acc:101159943])

HSP 1 Score: 323.168 bits (827), Expect = 1.745e-102
Identity = 186/417 (44.60%), Postives = 275/417 (65.95%), Query Frame = -3
Query:  115 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDS---VTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQA 1356
            +T   PTLKAN RA + + F+++ K+     ++   + SY+D R+      R +R   F+ PG   +   + R + +L+ L+  ++++ ++TGI  + KLA I P++   + ++P IEWWD +++    +F    PE     +NV+ +     +TNL+EHP + +PP+D+   VT + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKL+ E+ + KK+ KL+E+  +   ++VY+++NL++P+ +FK+E NANQL +TG V LH   N+VVVEG  K QKKF++LML+RI W + + +     VD+  R N C LIWEG+ K  ++G+++FK CPTE  ARE F+K   E YWDL+ S  VL  
Sbjct:  286 LTHRMPTLKANIRAVKREQFRQQLKEKPSDDLE---STSYFDNRVLITPAQRLRRGFKFHEPGRFEKIAQRVRTKAQLERLQNEISQAAKKTGIQASTKLALIAPRKEIGDGEVPSIEWWDSFILPSNIVFK---PET--RFDNVEFF----GVTNLVEHPTQMRPPVDTDKPVT-LGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLSTEQRKEKKVKKLKEDLTNGVHISVYRIRNLTNPAKKFKVEANANQLYLTGTVVLHRDVNLVVVEGGPKSQKKFRKLMLHRIKWEEHSSKRDDPDVDDTKRNNKCWLIWEGTGKDRSYGEIKFKQCPTESMAREHFKKHGTEHYWDLALSHSVLDG 689          
BLAST of SMED30022493 vs. Ensembl Medaka
Match: prpf3 (pre-mRNA processing factor 3 [Source:NCBI gene;Acc:101159943])

HSP 1 Score: 273.478 bits (698), Expect = 7.319e-84
Identity = 166/376 (44.15%), Postives = 247/376 (65.69%), Query Frame = -3
Query:  238 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDS---VTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKA 1356
            +T   PTLKAN RA + + F+++ K+     ++   + SY+D R+      R +R   F+ PG   +   + R + +L+ L+  ++++ ++TGI  + KLA I P++   + ++P IEWWD +++    +F    PE     +NV+ +     +TNL+EHP + +PP+D+   VT + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKL+ E+ + KK+ KL+E+  +   ++VY+++NL++P+ +FK+E NANQL +TG V LH   N+VVVEG  K QKKF++LML+RI W + + +     VD+  R N C LIWE S  A
Sbjct:  286 LTHRMPTLKANIRAVKREQFRQQLKEKPSDDLE---STSYFDNRVLITPAQRLRRGFKFHEPGRFEKIAQRVRTKAQLERLQNEISQAAKKTGIQASTKLALIAPRKEIGDGEVPSIEWWDSFILPSNIVFK---PET--RFDNVEFF----GVTNLVEHPTQMRPPVDTDKPVT-LGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLSTEQRKEKKVKKLKEDLTNGVHISVYRIRNLTNPAKKFKVEANANQLYLTGTVVLHRDVNLVVVEGGPKSQKKFRKLMLHRIKWEEHSSKRDDPDVDDTKRNNKCWLIWEVSEHA 648          
BLAST of SMED30022493 vs. Ensembl Medaka
Match: prpf3 (pre-mRNA processing factor 3 [Source:NCBI gene;Acc:101159943])

HSP 1 Score: 273.478 bits (698), Expect = 7.319e-84
Identity = 166/376 (44.15%), Postives = 247/376 (65.69%), Query Frame = -3
Query:  238 VTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDS---VTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKA 1356
            +T   PTLKAN RA + + F+++ K+     ++   + SY+D R+      R +R   F+ PG   +   + R + +L+ L+  ++++ ++TGI  + KLA I P++   + ++P IEWWD +++    +F    PE     +NV+ +     +TNL+EHP + +PP+D+   VT + + LTK E KKLRRQTR E QKE QEK+RLGL  PP PKVR+SNLMRVLGTEAVQDPTK+EA+VR+QM +R++ HE ANA RKL+ E+ + KK+ KL+E+  +   ++VY+++NL++P+ +FK+E NANQL +TG V LH   N+VVVEG  K QKKF++LML+RI W + + +     VD+  R N C LIWE S  A
Sbjct:  286 LTHRMPTLKANIRAVKREQFRQQLKEKPSDDLE---STSYFDNRVLITPAQRLRRGFKFHEPGRFEKIAQRVRTKAQLERLQNEISQAAKKTGIQASTKLALIAPRKEIGDGEVPSIEWWDSFILPSNIVFK---PET--RFDNVEFF----GVTNLVEHPTQMRPPVDTDKPVT-LGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLSTEQRKEKKVKKLKEDLTNGVHISVYRIRNLTNPAKKFKVEANANQLYLTGTVVLHRDVNLVVVEGGPKSQKKFRKLMLHRIKWEEHSSKRDDPDVDDTKRNNKCWLIWEVSEHA 648          
BLAST of SMED30022493 vs. Planmine SMEST
Match: SMESG000023169.1 (SMESG000023169.1)

HSP 1 Score: 957.592 bits (2474), Expect = 0.000e+0
Identity = 482/483 (99.79%), Postives = 482/483 (99.79%), Query Frame = -3
Query:   97 MDNRKQVTQDQINDMLVKARQEVNNRTKMYELDQNKSSKLEKQARLALLAQKFKASNIPLLSSVTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPXXXXXXXXXXXXXXXRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQAEGELSC 1545
            MDNRKQVTQDQINDMLVKARQEVNNRTKMYELDQNKSSKLEKQARLALLAQKFKASNIPLLSSVTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPLLLTKTETKKLRRQTRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEA DEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQAEGELSC
Sbjct:    1 MDNRKQVTQDQINDMLVKARQEVNNRTKMYELDQNKSSKLEKQARLALLAQKFKASNIPLLSSVTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPNASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAKSTQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPEKDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPLLLTKTETKKLRRQTRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAYVRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVKNLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLMLNRIDWNQDNRRAPAEAADEPARLNGCELIWEGSVKAPAFGKMEFKNCPTEIYAREQFRKCDVEQYWDLSYSKEVLQAEGELSC 483          
The following BLAST results are available for this feature:
BLAST of SMED30022493 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PRPF34.516e-10443.23pre-mRNA processing factor 3 [Source:HGNC Symbol;A... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prp-31.156e-9242.28Yeast PRP (Splicing factor) related [Source:UniPr... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Prp36.136e-9645.09gene:FBgn0036915 transcript:FBtr0074892[more]
Prp32.012e-9545.09gene:FBgn0036915 transcript:FBtr0074891[more]
back to top
BLAST of SMED30022493 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prpf31.761e-10446.52PRP3 pre-mRNA processing factor 3 homolog (yeast) ... [more]
prpf31.923e-10446.52PRP3 pre-mRNA processing factor 3 homolog (yeast) ... [more]
prpf31.923e-10446.52PRP3 pre-mRNA processing factor 3 homolog (yeast) ... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PRPF32.008e-10847.28pre-mRNA processing factor 3 [Source:NCBI gene;Acc... [more]
PRPF32.702e-10746.34pre-mRNA processing factor 3 [Source:NCBI gene;Acc... [more]
PRPF32.133e-9345.54pre-mRNA processing factor 3 [Source:NCBI gene;Acc... [more]
PRPF31.925e-7346.79pre-mRNA processing factor 3 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Prpf31.024e-10443.23pre-mRNA processing factor 3 [Source:MGI Symbol;Ac... [more]
Prpf31.024e-10443.23pre-mRNA processing factor 3 [Source:MGI Symbol;Ac... [more]
Prpf38.157e-1550.77pre-mRNA processing factor 3 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of SMED30022493 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZJ85|PRPF3_CHICK2.132e-10645.50U4/U6 small nuclear ribonucleoprotein Prp3 OS=Gall... [more]
sp|Q922U1|PRPF3_MOUSE7.162e-10443.23U4/U6 small nuclear ribonucleoprotein Prp3 OS=Mus ... [more]
sp|O43395|PRPF3_HUMAN2.169e-10343.23U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo... [more]
sp|Q2KIA6|PRPF3_BOVIN2.239e-10343.23U4/U6 small nuclear ribonucleoprotein Prp3 OS=Bos ... [more]
sp|Q5R5F1|PRPF3_PONAB4.523e-10342.99U4/U6 small nuclear ribonucleoprotein Prp3 OS=Pong... [more]
back to top
BLAST of SMED30022493 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7GNA41.086e-14454.01U4/U6 small nuclear ribonucleoprotein Prp3 OS=Clon... [more]
A0A4S2M6443.393e-14453.77Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A183NSS41.881e-14153.63Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A430QCL53.338e-14153.49U4/U6 small nuclear ribonucleoprotein PRP3 OS=Schi... [more]
A0A3Q0KGM34.380e-14153.49U4/U6-associated RNA splicing factor-related OS=Sc... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prpf35.790e-10345.48pre-mRNA processing factor 3 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prpf32.362e-11446.71PRP3 pre-mRNA processing factor 3 homolog (yeast) ... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PRP33.596e-1728.99Splicing factor; component of the U4/U6-U5 snRNP c... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO392163.936e-9542.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30022493 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prpf31.745e-10244.60pre-mRNA processing factor 3 [Source:NCBI gene;Acc... [more]
prpf37.319e-8444.15pre-mRNA processing factor 3 [Source:NCBI gene;Acc... [more]
prpf37.319e-8444.15pre-mRNA processing factor 3 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30022493 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023169.10.000e+099.79SMESG000023169.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022493 ID=SMED30022493|Name=SMED30022493|organism=Schmidtea mediterranea sexual|type=transcript|length=1547bp
TTTTTTTTTAAAACGAGGAATTTGAATTAGCAAACAAATCAACCAATCAG
AAACAAAGAACAAAATCACATATTATAATTATACAAATACCATTCAACAG
GAGAGCTCACCCTCTGCCTGCAAGACCTCCTTGCTGTACGAGAGATCCCA
ATACTGCTCGACATCGCATTTCCTGAACTGTTCTCGAGCGTAAATCTCTG
TCGGGCAATTTTTGAACTCCATCTTACCGAATGCGGGGGCCTTCACGGAT
CCCTCCCAGATCAACTCGCAACCGTTCAATCGTGCCGGTTCATCGACAGC
CTCTGCTGGAGCACGCCGATTGTCTTGATTCCAATCAATCCGATTTAGCA
TGAGCCGCTTGAATTTCTTTTGCTTCTTGGCGTTGCCCTCGACAACGACA
ACATTGCAGGTCGAGTGGAGCGCAACGATACCCGTCATCAGCAATTGGTT
GGCATTCTTTTCGATCTTGAACCGATGCGACGGATGAGAGAGATTTTTCA
CCTTGTAAACCGTCACATCGGTTCTGTCGTTGGGATTCTCTTGTAGTTTC
ATCATTTTCTTTGCTCTTGATTCTTCTTTCGTCAGTTTCCTCTGGGCATT
TGCCGTTTCGTGGTTCCGTTTCCTCTGTTCCATTTGCGATCTCACGTAGG
CTTCGATTTTCGTCGGATCTTGGACGGCTTCCGTGCCGAGGACTCGCATA
AGATTCGACAGTCGGACTTTTGGAACCGGCGGTTTCGATAATCCCAATCG
GATTTTCTCTTGTTCTTCTTTTTGCAATTCTGCTCTCGTTTGGCGGCGCA
ATTTTTTCGTTTCGGTTTTAGTGAGCAAAAGGGGAATTTCTGTGACCGAA
TCGATCGGCGGTTTTGCTTTTATCGGGTGTTCGATGAGATTTGTGATCCA
GTCCAAGTTAACGTATTTATCGACATTTTCCAACATTCCATCTTTTTCCG
GGAGATCTTTGTAGAAAATGTCTTTGTCGTTCATTAGATATTCATCCCAC
CATTCGATTTCCGGGATTTGAGATTCGTCTGTTAATCTTTTCGGTTGAAT
ATTGGCCAATTTGACATTTCTAACGATTCCAGTACGTTGAGTAGATTTCG
CCAAAGATTCTTTGAGAGCTTTCAAGCGTTCTTCGGCTCGAGCTTTGTTA
CCTTGCTGTATATGAATTCCTGGTGGATTAAAAACGAGTGCTCGTTTTTT
TCTGAAAGTCGATTTTTGTTTTATTCTGGGATCATAATAACTAGCATTTG
GTTGTGGTTGGATTTTCTTTTGAGTATTTTGTTTATATTCTTCCTTAAAC
AACTGATTTTGTCTAGCTCTTTGATTGGCCTTTAATGTTGGAGAATATCT
GGTGACGGAAGATAATAGAGGAATATTTGAAGCTTTGAATTTTTGTGCTA
ACAAAGCCAATCTTGCTTGTTTTTCTAATTTGCTAGATTTGTTTTGATCG
AGCTCATACATTTTTGTACGATTATTAACTTCTTGTCGGGCTTTAACCAG
CATATCATTAATTTGATCTTGAGTAACTTGTTTTCTGTTGTCCATCA
back to top

protein sequence of SMED30022493-orf-1

>SMED30022493-orf-1 ID=SMED30022493-orf-1|Name=SMED30022493-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MDNRKQVTQDQINDMLVKARQEVNNRTKMYELDQNKSSKLEKQARLALLA
QKFKASNIPLLSSVTRYSPTLKANQRARQNQLFKEEYKQNTQKKIQPQPN
ASYYDPRIKQKSTFRKKRALVFNPPGIHIQQGNKARAEERLKALKESLAK
STQRTGIVRNVKLANIQPKRLTDESQIPEIEWWDEYLMNDKDIFYKDLPE
KDGMLENVDKYVNLDWITNLIEHPIKAKPPIDSVTEIPLLLTKTETKKLR
RQTRAELQKEEQEKIRLGLSKPPVPKVRLSNLMRVLGTEAVQDPTKIEAY
VRSQMEQRKRNHETANAQRKLTKEESRAKKMMKLQENPNDRTDVTVYKVK
NLSHPSHRFKIEKNANQLLMTGIVALHSTCNVVVVEGNAKKQKKFKRLML
NRIDWNQDNRRAPAEAVDEPARLNGCELIWEGSVKAPAFGKMEFKNCPTE
IYAREQFRKCDVEQYWDLSYSKEVLQAEGELSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR027104Prp3
IPR013881Pre-mRNA_splic_Prp3
IPR010541DUF1115
Vocabulary: cellular component
TermDefinition
GO:0046540U4/U6 x U5 tri-snRNP complex
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 240..260
NoneNo IPR availableCOILSCoilCoilcoord: 124..151
NoneNo IPR availableCOILSCoilCoilcoord: 302..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 302..322
IPR010541Domain of unknown function DUF1115PFAMPF06544DUF1115coord: 343..465
e-value: 8.1E-41
score: 139.5
IPR013881Pre-mRNA-splicing factor 3PFAMPF08572PRP3coord: 99..319
e-value: 6.7E-68
score: 228.8
IPR027104U4/U6 small nuclear ribonucleoprotein Prp3PANTHERPTHR14212U4/U6-ASSOCIATED RNA SPLICING FACTOR-RELATEDcoord: 32..468