secreted frizzled-related protein 1

Overview
Namesecreted frizzled-related protein 1 (ABY85212.1)
Smed IDSMED30022468
Length (bp)1356
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of secreted frizzled-related protein 1 (SMED30022468) t-SNE clustered cells

Violin plots show distribution of expression levels for secreted frizzled-related protein 1 (SMED30022468) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of secreted frizzled-related protein 1 (SMED30022468) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for secreted frizzled-related protein 1 (SMED30022468) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022468

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 65

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
anterior tipSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 ABY85212.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
anterior tipSMED30022468SMESG000075831.1 SMESG000029446.1 ABY85212.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 ABY85212.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v4_13985_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v4_13985_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v4_13985_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 SmedASXL_007755SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
anterior tipSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v4_13985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU130790.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU130790.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 ABY85212.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 ABY85212.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v6_13985_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v6_13985_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v6_13985_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynx tipSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v6_13985_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 Contig45920newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 Contig45920uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 OX_Smed_1.0.15141ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU130790smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30022468SMESG000075831.1 SMESG000029446.1 EU130790smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:22125640
Evans et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:22125640
Evans et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:30485821
Tewari et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30022468SMESG000075831.1 SMESG000029446.1 Contig29018newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022468SMESG000075831.1 SMESG000029446.1 Contig29018uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30022468SMESG000075831.1 SMESG000029446.1 dd_Smed_v4_13985_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
anterior tipSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
anterior tipSMED30022468SMESG000075831.1 SMESG000029446.1 ABY85212.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 ABY85212.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30022468SMESG000075831.1 SMESG000029446.1 EU296635smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of secreted frizzled-related protein 1 vs. Ensembl Human
Match: SFRP5 (secreted frizzled related protein 5 [Source:HGNC Symbol;Acc:HGNC:10779])

HSP 1 Score: 142.895 bits (359), Expect = 2.233e-38
Identity = 89/260 (34.23%), Postives = 137/260 (52.69%), Query Frame = 2
Query:  308 QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI-------PKTVVPGKK-CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNA--LELNLK----CNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            QC  IP +  LC  VGY+ M LPN ++HES+ E  Q +  W+ L+  +CH D + F+CSL+APVC+    ++ + PCR LC  V+  C P M+ YGF WP ++ C KFP   N LCI       P T  P  K C  C    S + +  + C S  V++ +IK I   +G+   I  QKK K LK      ++   L L++K    C C  L     +L G +++M +   D + ++  + +W +K  E K ++K + ++
Sbjct:   52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLD----SLAGSFLVMGR-KVDGQLLLMAVYRWDKKNKEMKFAVKFMFSY 301          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Human
Match: SFRP2 (secreted frizzled related protein 2 [Source:HGNC Symbol;Acc:HGNC:10777])

HSP 1 Score: 141.739 bits (356), Expect = 4.302e-38
Identity = 90/297 (30.30%), Postives = 145/297 (48.82%), Query Frame = 2
Query:  224 PLSLLLFISNVNSFIGDWQAF------QSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP----KTVVPG-----KKCDLCM-KIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALEL-------NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            P SLLL     +  +G  +           Y    C  IP N  LC  + Y+ M LPN + HE+++E  + +  W+ LV  QCH D KKF+CSL+APVC+ +  ++ + PC  LCV VK+ C P M  +GF WP +++C +FPQ  N LCIP      ++P      K C+ C  K      I    C +   ++ K+K I   + +  +IIL+ KSK +      S+  L+        +L+C C  +      +   +++M Q     + V+  + +W++ + EFK   + I+  
Sbjct:    5 PGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDD-LDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQ-KQGGELVITSVKRWQKGQREFKRISRSIRKL 293          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Human
Match: SFRP1 (secreted frizzled related protein 1 [Source:HGNC Symbol;Acc:HGNC:10776])

HSP 1 Score: 141.354 bits (355), Expect = 9.453e-38
Identity = 93/277 (33.57%), Postives = 135/277 (48.74%), Query Frame = 2
Query:  260 SFIGDWQAFQSG--YT-IDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI---PKTVVPGKK------CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGN----AIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            SF  D   +QSG  YT   QC  IP +  LC NVGY+ MVLPN ++HE++ E  Q +  W+ L+N  CH   + F+CSL+APVC+    ++ + PCR LC  V++SC P M+ +GF WP ++KC KFP+    +CI   P       K      C  C      E I    C S   +R KIK +   +G+      +    K     K         L+    C C  L      L   ++IM +    ++ ++  I KW +K  EFK+ MK ++N
Sbjct:   38 SFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCL----DRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPE--GDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLD----NLSHHFLIMGR-KVKSQYLLTAIHKWDKKNKEFKNFMKKMKN 303          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Human
Match: FZD1 (frizzled class receptor 1 [Source:HGNC Symbol;Acc:HGNC:4038])

HSP 1 Score: 95.1301 bits (235), Expect = 2.739e-20
Identity = 44/119 (36.97%), Postives = 64/119 (53.78%), Query Frame = 2
Query:  305 DQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFKNSLCI 658
            D  Y  P +  LC+++ Y   ++PN + H + E+A      +  LV  QC  ++K F+CS+YAPVC      Q +PPCR LC   ++ C   M  +GF WP  +KC KFP      LC+
Sbjct:  112 DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC--TVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCV 228          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Human
Match: FZD8 (frizzled class receptor 8 [Source:HGNC Symbol;Acc:HGNC:4046])

HSP 1 Score: 94.3597 bits (233), Expect = 5.198e-20
Identity = 41/109 (37.61%), Postives = 63/109 (57.80%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKN--SLCI 658
            LC  +GY    +PN   H++ +EA      +  LV  QC  D+K F+CS+Y P+C+ + + + +PPCR +C   K  C P M+ YGF WP  M+C + P+  N  +LC+
Sbjct:   42 LCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYK-KPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCM 149          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Celegans
Match: sfrp-1 (Secreted Frizzled-Related Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3ARM8])

HSP 1 Score: 155.221 bits (391), Expect = 1.863e-43
Identity = 101/322 (31.37%), Postives = 165/322 (51.24%), Query Frame = 2
Query:  218 IFPLSLLLF-ISNVNSFIGD-WQAFQSGYTID-QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGK-------KCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNL------KCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKS---KLPDGISLRERYAAYLKMNN 1126
            +FP+  +LF  S  N ++ D W  F S   +  +C  IP N ++C+ + Y  M LPN ++HE++ EA   SK W  L+   CH D ++F+CSL+APVC+  Q ++ + PC+ LC+ VK+ C   M  YGF WP ++ C KF    + +CI K + P K        C  C ++A+YE + ++FC S +V++AK+ R  PT      I ++      K +     + +E+ L       C C N+  K +  K   ++MA    D K + N +  W+++K  FK   + I  F  + C+S   ++ +  S R  Y    + N 
Sbjct:    3 LFPVLYILFAFSVTNGYLEDSWAMFSSERPVGPKCVDIPSNLSICNGIEYTQMRLPNILEHETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCLM-QMDRLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKFED--DDMCI-KPMQPAKPPAGSSTTCTACSQVATYENLVDQFCRSHLVLKAKVIRDSPT-----HIRVRNGRSLKKGERRRGVSDVEIRLSSESDGSCPC-NIPVKNQNEK--LLVMASRQPDGKYLANLVLPWQKEK-NFK---RAIHQFQRLNCQSLGREIRESASRRPHYYEMRRHNT 308          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Celegans
Match: sfrp-1 (Secreted Frizzled-Related Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3ARM8])

HSP 1 Score: 130.183 bits (326), Expect = 1.188e-34
Identity = 85/269 (31.60%), Postives = 138/269 (51.30%), Query Frame = 2
Query:  365 MVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGK-------KCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNL------KCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKS---KLPDGISLRERYAAYLKMN 1123
            M LPN ++HE++ EA   SK W  L+   CH D ++F+CSL+APVC+  Q ++ + PC+ LC+ VK+ C   M  YGF WP ++ C KF    + +CI K + P K        C  C ++A+YE + ++FC S +V++AK+ R  PT      I ++      K +     + +E+ L       C C N+  K +  K   ++MA    D K + N +  W+++K  FK   + I  F  + C+S   ++ +  S R  Y    + N
Sbjct:    1 MRLPNILEHETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCLM-QMDRLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKFED--DDMCI-KPMQPAKPPAGSSTTCTACSQVATYENLVDQFCRSHLVLKAKVIRDSPT-----HIRVRNGRSLKKGERRRGVSDVEIRLSSESDGSCPC-NIPVKNQNEK--LLVMASRQPDGKYLANLVLPWQKEK-NFK---RAIHQFQRLNCQSLGREIRESASRRPHYYEMRRHN 253          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Celegans
Match: mig-1 (Transmembrane receptor [Source:UniProtKB/TrEMBL;Acc:G5EF44])

HSP 1 Score: 86.2705 bits (212), Expect = 6.191e-18
Identity = 37/103 (35.92%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKN 646
            +C+++ Y L   PN +  ES ++A++    +  L++  C   +K F+CS+Y P+C     N  + PCR LC++V+E CLP ++ +GF WP +++C KFP   N
Sbjct:   33 MCNDLPYNLTSFPNLVDEESWKDASESILTYKPLLSVVCSEQLKFFLCSVYFPMCNEKLAN-PIGPCRPLCLSVQEKCLPVLESFGFKWPDVIRCDKFPLENN 134          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Celegans
Match: mig-1 (Transmembrane receptor [Source:UniProtKB/TrEMBL;Acc:G5EF44])

HSP 1 Score: 86.2705 bits (212), Expect = 6.314e-18
Identity = 37/103 (35.92%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKN 646
            +C+++ Y L   PN +  ES ++A++    +  L++  C   +K F+CS+Y P+C     N  + PCR LC++V+E CLP ++ +GF WP +++C KFP   N
Sbjct:   33 MCNDLPYNLTSFPNLVDEESWKDASESILTYKPLLSVVCSEQLKFFLCSVYFPMCNEKLAN-PIGPCRPLCLSVQEKCLPVLESFGFKWPDVIRCDKFPLENN 134          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9969413:1 gene:WBGene00003397.1 transcript:T23D8.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 83.5741 bits (205), Expect = 6.383e-17
Identity = 48/139 (34.53%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEV--IANRFCLSP 748
            +C N+ Y   V PN + H +  EA      +  L+  +C  DI+ F+C++YAPVC   ++   + PCRELC++ K  C   MK +GF WP  + C+KFP     LC+ K               ++ V  IAN   LSP
Sbjct:   44 MCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVCTVLEK--PIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFP--VTDLCVGKNSSESSNSKKSSNDVTFGVSTIANEVVLSP 178          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0330102)

HSP 1 Score: 86.6557 bits (213), Expect = 7.385e-18
Identity = 44/113 (38.94%), Postives = 62/113 (54.87%), Query Frame = 2
Query:  323 PDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFKNSLCI 658
            P   ++C N+ Y + ++PN I H   EEA      +  LV   C  D++ F+CSLY PVC   +R   +PPCR LC + +  C   MK Y F+WP  ++CSKFP      LC+
Sbjct:   55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER--PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCV 164          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0075743)

HSP 1 Score: 86.6557 bits (213), Expect = 7.936e-18
Identity = 44/113 (38.94%), Postives = 62/113 (54.87%), Query Frame = 2
Query:  323 PDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFKNSLCI 658
            P   ++C N+ Y + ++PN I H   EEA      +  LV   C  D++ F+CSLY PVC   +R   +PPCR LC + +  C   MK Y F+WP  ++CSKFP      LC+
Sbjct:   55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER--PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCV 164          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 85.1149 bits (209), Expect = 2.514e-17
Identity = 40/126 (31.75%), Postives = 64/126 (50.79%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASY 715
            +C  +GY +   PN + HE+ +EA      +  LV  +C  D+K F+CS+Y P+C+ +  ++ +P CR +C   +  C P M+ Y F+WP  M C   P            + G   +LCM+  SY
Sbjct:   71 MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDY-HKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP------------LHGDPDNLCMEQPSY 183          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075029)

HSP 1 Score: 85.1149 bits (209), Expect = 2.514e-17
Identity = 40/126 (31.75%), Postives = 64/126 (50.79%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASY 715
            +C  +GY +   PN + HE+ +EA      +  LV  +C  D+K F+CS+Y P+C+ +  ++ +P CR +C   +  C P M+ Y F+WP  M C   P            + G   +LCM+  SY
Sbjct:   71 MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDY-HKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP------------LHGDPDNLCMEQPSY 183          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0332735)

HSP 1 Score: 85.1149 bits (209), Expect = 2.514e-17
Identity = 40/126 (31.75%), Postives = 64/126 (50.79%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASY 715
            +C  +GY +   PN + HE+ +EA      +  LV  +C  D+K F+CS+Y P+C+ +  ++ +P CR +C   +  C P M+ Y F+WP  M C   P            + G   +LCM+  SY
Sbjct:   71 MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDY-HKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLP------------LHGDPDNLCMEQPSY 183          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Zebrafish
Match: sfrp5 (secreted frizzled-related protein 5 [Source:ZFIN;Acc:ZDB-GENE-011108-2])

HSP 1 Score: 159.844 bits (403), Expect = 6.888e-45
Identity = 101/302 (33.44%), Postives = 151/302 (50.00%), Query Frame = 2
Query:  203 MEMTKIFPLSLLLFISNVNSFIGD---WQA--FQSGYTI---DQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPG--------KKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNL------KCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            + +T+   L+L+L  S  ++   D   WQ+  F SG       QC  IP +  LC NVGY+ M LPN + HE++ E  Q +  W+ L+  +CH D + F+CSL+APVC+    ++ + PCR LC  V++SC P M+ YGF WP +++C KFP   N LCIP     G        K C  C      + I   +C S   ++ KIK      G+   I  QKK K LK      ++  +L L       C C+ L      L   ++IM +   D + ++  I KW +K  E K ++K I++
Sbjct:    8 VSLTQAVTLALVLLTSASSAEEYDYYSWQSDNFHSGRFYAKQPQCVDIPADLRLCYNVGYKKMRLPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCEKFP-IDNDLCIPMQFSAGHVTQTPVSKVCPPCDNELKADTIMEHYCASDFALKMKIKEAKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYIKNGANCPCSQLD----NLGSNFLIMGR-KVDQQLLLMSIHKWDKKSKELKFAIKYIKS 299          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Zebrafish
Match: sfrp2 (secreted frizzled-related protein 2 [Source:ZFIN;Acc:ZDB-GENE-061013-293])

HSP 1 Score: 146.747 bits (369), Expect = 3.740e-40
Identity = 96/300 (32.00%), Postives = 145/300 (48.33%), Query Frame = 2
Query:  227 LSLLLFISNVNSFIGDWQAFQSGYTIDQ---------CYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP----KTVVPGKK-----CDLC-MKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLK------FQANFSQNALEL--NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            L+LL+ +S      G   A    Y  DQ         C  IP N  LC ++ Y  M LPN + HE++ E  Q +  W  LV  QCH D KKF+CSL+APVC+ +  ++ + PCR LC +VK  C P M  +GF WP ++ C +FP   N LCIP      +VP  K     CD C  K  +   I +  C +   ++ K+K I   +G+  +II + K+K +          +F +  L L   L+C C  L      +   +++M Q   D   V+  + +W++ + EFK   + I+  
Sbjct:    5 LALLVALS----IPGYLDALHGLYAFDQPELFQKKSNCKPIPTNLLLCHDIEYTNMRLPNLLGHETMNEVLQQASSWTPLVQKQCHPDTKKFLCSLFAPVCLDD-LDEPIQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRRFP-LDNDLCIPPAGADALVPVTKEVPRVCDACKEKPENDNEIVDSLCKNDFALKIKVKEISYMNGDT-KIIPETKTKMIYKTNGGVTDHDFRKTVLWLKDGLQCVCDEL----NDINAAYLVMGQ-KMDGNLVITSVKRWQKGQREFKRISRSIRKL 292          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Zebrafish
Match: sfrp2 (secreted frizzled-related protein 2 [Source:ZFIN;Acc:ZDB-GENE-061013-293])

HSP 1 Score: 146.747 bits (369), Expect = 3.740e-40
Identity = 96/300 (32.00%), Postives = 145/300 (48.33%), Query Frame = 2
Query:  227 LSLLLFISNVNSFIGDWQAFQSGYTIDQ---------CYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP----KTVVPGKK-----CDLC-MKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLK------FQANFSQNALEL--NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            L+LL+ +S      G   A    Y  DQ         C  IP N  LC ++ Y  M LPN + HE++ E  Q +  W  LV  QCH D KKF+CSL+APVC+ +  ++ + PCR LC +VK  C P M  +GF WP ++ C +FP   N LCIP      +VP  K     CD C  K  +   I +  C +   ++ K+K I   +G+  +II + K+K +          +F +  L L   L+C C  L      +   +++M Q   D   V+  + +W++ + EFK   + I+  
Sbjct:    5 LALLVALS----IPGYLDALHGLYAFDQPELFQKKSNCKPIPTNLLLCHDIEYTNMRLPNLLGHETMNEVLQQASSWTPLVQKQCHPDTKKFLCSLFAPVCLDD-LDEPIQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRRFP-LDNDLCIPPAGADALVPVTKEVPRVCDACKEKPENDNEIVDSLCKNDFALKIKVKEISYMNGDT-KIIPETKTKMIYKTNGGVTDHDFRKTVLWLKDGLQCVCDEL----NDINAAYLVMGQ-KMDGNLVITSVKRWQKGQREFKRISRSIRKL 292          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Zebrafish
Match: sfrp2l (secreted frizzled-related protein 2 like [Source:ZFIN;Acc:ZDB-GENE-061122-2])

HSP 1 Score: 141.739 bits (356), Expect = 5.754e-38
Identity = 84/271 (31.00%), Postives = 132/271 (48.71%), Query Frame = 2
Query:  281 AFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKK-----------CDLCMKIASYE-VIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELN-------LKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKII 1036
            A + G     C  +P+   LC  +GYR M LPN ++H+S  EA Q S  W+ L+  +CH D ++F+CSL+APVC+  +    V PCR LCV V+++C P M  +GF WP +  CS+F      LCIP  + P +            C+ C      E  I   FC +  V+R ++       G+ +++  + +S+ L+ Q    Q ALEL        L C+C  L      L   +II+    S  +  ++ I +W R +   K  ++ +
Sbjct:   67 AVEFGSARSVCKPVPNTMVLCFGIGYREMRLPNLLEHQSAREAQQQSAAWVPLIGKRCHRDTRRFLCSLFAPVCLP-EVPTPVSPCRNLCVAVRDACAPVMSAFGFPWPEMFNCSRFTD-GPELCIPGEIDPLRAPTTLAPTGSEICEACSADGDGEREILQEFCTAQFVVRLRVGS-CSVIGSDLRVFPEGRSRVLRQQD--PQAALELRVLWLPQALHCSCPAL---DGPLTSTYIILGHTHS-GRMQIHRILRWTRDEKTLKKLIRTL 328          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Zebrafish
Match: sfrp2l (secreted frizzled-related protein 2 like [Source:ZFIN;Acc:ZDB-GENE-061122-2])

HSP 1 Score: 137.117 bits (344), Expect = 1.676e-36
Identity = 80/259 (30.89%), Postives = 127/259 (49.03%), Query Frame = 2
Query:  281 AFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELN-------LKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKII 1036
            A + G     C  +P+   LC  +GYR M LPN ++H+S  EA Q S  W+ L+  +CH D ++F+CSL+APVC+  +    V PCR LCV V+++C P M  +GF WP +  CS+F      LCIP  + P               +     L+P V+R ++       G+ +++  + +S+ L+ Q    Q ALEL        L C+C  L      L   +II+    S  +  ++ I +W R +   K  ++ +
Sbjct:   67 AVEFGSARSVCKPVPNTMVLCFGIGYREMRLPNLLEHQSAREAQQQSAAWVPLIGKRCHRDTRRFLCSLFAPVCLP-EVPTPVSPCRNLCVAVRDACAPVMSAFGFPWPEMFNCSRFTD-GPELCIPGEIDP---------------LRAPTTLAPTVVRLRVGS-CSVIGSDLRVFPEGRSRVLRQQD--PQAALELRVLWLPQALHCSCPAL---DGPLTSTYIILGHTHS-GRMQIHRILRWTRDEKTLKKLIRTL 301          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Xenopus
Match: sfrp5 (secreted frizzled-related protein 5 [Source:NCBI gene;Acc:448129])

HSP 1 Score: 146.747 bits (369), Expect = 8.408e-40
Identity = 97/294 (32.99%), Postives = 147/294 (50.00%), Query Frame = 2
Query:  227 LSLLLFISNVNSFIGDWQA--FQSG--YT-IDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKK----------CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGN----AIQIILQKKSKFLKFQANFSQNALELN--LKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            L L+L+ S        WQ+  FQ+G  YT   QC  IP +  LC NVGY+ M LPN + HE++ E  Q +  W+ L+  +CH D + F+CSL+AP+C+     + + PCR LC  V++SC P M+ YGF WP ++ C+KFP   N LCI  TV  G K          C  C      E +  + C S  V+R +IK +   +G+    A Q   +        +  F +  L +     C C  L      L G ++IM +   DNK ++  I KW +K  + K+++  + ++
Sbjct:   16 LGLVLWSSAEEYDYYSWQSDNFQNGRFYTKQSQCIDIPSDLHLCHNVGYKKMRLPNLLDHETMPEVKQQASSWVPLLAKRCHRDTQLFLCSLFAPICL----ERPIYPCRSLCEVVRDSCAPVMESYGFPWPEMLNCNKFP-LDNDLCI--TVQFGSKQVTQPPVTKICTQCEIEQKSETMRVQLCASDFVLRMRIKEVKIENGDRKLIAAQKKKKVLKAGKLKRKEFRKLVLYIKNAASCPCPQLD----NLSGSFLIMGR-KVDNKLLLTAIYKWDKKSKDMKYAVNFMYSY 297          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Xenopus
Match: sfrp2 (secreted frizzled-related protein 2 [Source:NCBI gene;Acc:394659])

HSP 1 Score: 144.436 bits (363), Expect = 4.065e-39
Identity = 87/268 (32.46%), Postives = 136/268 (50.75%), Query Frame = 2
Query:  293 GYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP----KTVVP-----GKKCDLCMKIASYE-VIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALEL-------NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
             Y    C  IP    LC ++ Y  M LPN + HE+++E  Q +  W+ LV  QCH D KKF+CSL+APVCI +  ++ + PCR LC  VK+SC P M  +GF WP +++CS+FPQ  N LCIP    + VVP      K CD C      +  I    C +   ++ K+K I   +G+  +II + K K +      ++  L+         L+C C  +      +   +++M Q     + V+  + +W++ + EFK   + I+  
Sbjct:   34 SYKRSNCKPIPATLVLCHDIEYPNMRLPNLLGHETMKEVLQQASSWIPLVQKQCHQDTKKFLCSLFAPVCIDD-LDETIKPCRSLCEQVKDSCAPVMSAFGFPWPDMLECSRFPQ-DNDLCIPPASTEHVVPVTREAPKVCDACKNSNEDDNDIVENLCKNDFALKIKVKEIAYINGDT-KIIPETKGKTIYKLNGVTERDLKKTVLWLKDGLQCTCDEM----NDINAPYLVMGQ-KLGGELVITSVKRWQKGQREFKRITRSIRKL 293          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Xenopus
Match: sfrpx (secreted frizzled-related protein [Source:NCBI gene;Acc:100037908])

HSP 1 Score: 137.887 bits (346), Expect = 9.468e-37
Identity = 76/260 (29.23%), Postives = 132/260 (50.77%), Query Frame = 2
Query:  311 CYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKK--------CDLCMK--IASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALE-----LNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            C  IP + TLC  VGY  M LPN + H++++E  Q +  W+ L+  QCH D KKF+CSL+APVC+S +  + V PCR LC  V++ C P M  +GF WP +  C++FP   N LC+P      K+        C  C     A  + + N +C S   ++  I+ +    G+ + ++ + +S+ +     +S   L      L+   NC      +    G  +++    +D++ V++++ KW++ + E K   + ++  
Sbjct:   34 CKAIPSSMTLCHGVGYSEMRLPNLLGHDTMKEVLQQAGSWVPLLTKQCHADTKKFLCSLFAPVCLS-ELEEAVYPCRSLCEAVRDGCTPVMAAFGFPWPDMFNCTQFP-LGNELCVPPAGSEDKQQEVKEEAPCSACRNRGDADKDFLQN-YCSSDFALKINIRSVSTLEGD-VMVVPEARSRTVYKSKGWSDEELRKTVLWLSDGDNCLCQDIHE---PGATVLVLGHRADDRLVISWVRKWQKSEKETKRFSRTVRKL 286          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Xenopus
Match: frzb2 (frizzled related protein 2 [Source:NCBI gene;Acc:549442])

HSP 1 Score: 133.265 bits (334), Expect = 6.297e-35
Identity = 77/261 (29.50%), Postives = 132/261 (50.57%), Query Frame = 2
Query:  308 QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP---------KTVVPGKKCDLC--MKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALE-----LNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            +C +IP +  LC ++GY  M +PN ++H+++ E  Q S  W+ L+  +CH D + F+CSL+AP+C+    ++ + PCR LC  V+ SC P M  YG+ WP I++C KFP+  + +CI          +  VP   C  C   + ++ + I + FC +  V + +I +   TS N     L  K + LK  +    + L      L+L   C      +    G ++I  ++  D K VVN    W++K    + +++  +N
Sbjct:   42 RCTRIPRSMALCYDIGYSEMRIPNLLEHDTMAEVIQQSSSWLPLLARECHPDARIFLCSLFAPICL----DRYIYPCRSLCEAVRGSCAPIMACYGYPWPEILRCDKFPE-DHGMCISPITNGTGSTRRTVPRASCRDCELEEASTAKEILDTFCDNDFVAKVRITKKNITSANLYDFDLDSKLEILKHGSLPKTDVLPRLQQWLDLDATCVQ-NIMRGTRTGIYVIGGEVQED-KVVVNNAYAWQKKNKNLQFAVRKWKN 295          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Xenopus
Match: sfrp1 (Xenopus tropicalis secreted frizzled-related protein 1 (sfrp1), mRNA. [Source:RefSeq mRNA;Acc:NM_001123406])

HSP 1 Score: 124.02 bits (310), Expect = 1.298e-31
Identity = 75/264 (28.41%), Postives = 138/264 (52.27%), Query Frame = 2
Query:  284 FQSGYTID---QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP-----KTVVP-GKKCDLCMKIAS---YEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQ 1039
            +QSG       QC +IP + TLC  VGY  MVLPN + HE++ E    +  W+ L++ +CH   + F+CSL+APVC+    ++ V PCR LC +V+++C P M+ +GF WP +++C ++P  +  +CI       T  P  +K ++C +  S    + +    C S   ++  I+ +   +G+   ++ +KK+     +    +  L+    C C  L      LKG+++++ +    ++ ++  I KW +   EF   M+ ++
Sbjct:   42 YQSGRFYSRPAQCVEIPQDMTLCHGVGYNKMVLPNLLDHETMAEVKYQASSWVPLLSKKCHPGTQVFLCSLFAPVCL----DRPVYPCRRLCESVRDACEPVMQYFGFHWPEMLRCEQYPT-EEDVCIAVHLPNATQAPRSRKTEVCPQCDSEIKADSLYEHMCASEFALKVSIREVKKDNGDRKLLLRKKKA---LKKGPIQKKDLKNGANCPCHQLD----QLKGQFLVLGR-KVKSQHLLTAIHKWDKTNREFNRFMRKVK 292          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Mouse
Match: Sfrp1 (secreted frizzled-related protein 1 [Source:MGI Symbol;Acc:MGI:892014])

HSP 1 Score: 147.902 bits (372), Expect = 1.995e-40
Identity = 98/281 (34.88%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  260 SFIGDWQAFQSG--YT-IDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI----PKTVVPGKK-----CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQK--------KSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            SF  D  ++QSG  YT   QC  IP +  LC NVGY+ MVLPN ++HE++ E  Q +  W+ L+N  CH+  + F+CSL+APVC+    ++ + PCR LC  V++SC P M+ +GF WP ++KC KFP+    +CI    P T    K      C  C      E I    C S   +R KIK +   +G+   +  +K        K K LK    F +N  +    C C  L      L   ++IM +    ++ ++  I KW +K  EFK+ MK ++N
Sbjct:   38 SFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCL----DRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPE--GDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKRLVLFLKNGAD----CPCHQLD----NLSHNFLIMGR-KVKSQYLLTAIHKWDKKNKEFKNFMKRMKN 303          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Mouse
Match: Sfrp2 (secreted frizzled-related protein 2 [Source:MGI Symbol;Acc:MGI:108078])

HSP 1 Score: 140.969 bits (354), Expect = 4.508e-38
Identity = 84/267 (31.46%), Postives = 136/267 (50.94%), Query Frame = 2
Query:  296 YTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP----KTVVPG-----KKCDLC-MKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALEL-------NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            Y    C  IP N  LC  + Y+ M LPN + HE+++E  + +  W+ LV  QCH D KKF+CSL+APVC+ +  ++ + PC  LCV VK+ C P M  +GF WP +++C +FPQ  N LCIP      ++P      K C+ C  K      I    C +   ++ K+K I   + +  +IIL+ KSK +      S+  L+        +L+C C  +      +   +++M Q     + V+  + +W++ + EFK   + I+  
Sbjct:   35 YKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDD-LDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQ-KQGGELVITSVKRWQKGQREFKRISRSIRKL 293          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Mouse
Match: Sfrp5 (secreted frizzled-related sequence protein 5 [Source:MGI Symbol;Acc:MGI:1860298])

HSP 1 Score: 138.272 bits (347), Expect = 7.099e-37
Identity = 87/260 (33.46%), Postives = 134/260 (51.54%), Query Frame = 2
Query:  308 QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI-------PKTVVPGKK-CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNL------KCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            QC  IP +  LC  VGY+ M LPN ++HES+ E  Q +  W+ L+  +CH D + F+CSL+APVC+    ++ + PCR LC  V+  C P M+ YGF WP ++ C KFP   N LCI       P T  P  K C  C    S + +  + C S  V++ +IK I   +G+   I  QKK K LK      ++  +L L       C C  L      L G +++M +   + + ++  + +W +K  E K ++K + ++
Sbjct:   49 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLD----NLTGSFLVMGR-KVEGQLLLTAVYRWDKKNKEMKFAVKFMFSY 298          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Mouse
Match: Fzd1 (frizzled class receptor 1 [Source:MGI Symbol;Acc:MGI:1196625])

HSP 1 Score: 95.5153 bits (236), Expect = 1.689e-20
Identity = 44/119 (36.97%), Postives = 65/119 (54.62%), Query Frame = 2
Query:  305 DQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFKNSLCI 658
            D  Y  P +  LC+++ Y   ++PN + H + E+A      +  LV  QC  ++K F+CS+YAPVC   +  Q +PPCR LC   ++ C   M  +GF WP  +KC KFP      LC+
Sbjct:  107 DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLE--QALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCV 223          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Mouse
Match: Fzd8 (frizzled class receptor 8 [Source:MGI Symbol;Acc:MGI:108460])

HSP 1 Score: 95.1301 bits (235), Expect = 2.575e-20
Identity = 41/109 (37.61%), Postives = 63/109 (57.80%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKN--SLCI 658
            LC  +GY    +PN   H++ +EA      +  LV  QC  D+K F+CS+Y P+C+ + + + +PPCR +C   K  C P M+ YGF WP  M+C + P+  N  +LC+
Sbjct:   42 LCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYK-KPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCM 149          
BLAST of secreted frizzled-related protein 1 vs. UniProt/SwissProt
Match: sp|Q9XSC1|SFRP5_BOVIN (Secreted frizzled-related protein 5 OS=Bos taurus OX=9913 GN=SFRP5 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 9.990e-41
Identity = 89/260 (34.23%), Postives = 137/260 (52.69%), Query Frame = 2
Query:  308 QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI-------PKTVVPGKK-CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNA--LELNLK----CNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            QC  IP +  LC  VGY+ M LPN ++HES+ E  Q +  W+ L+  +CH D + F+CSL+APVC+    ++ + PCR LC  V+  C P M+ YGF WP ++ C KFP   N LCI       P T  P  K C  C    S + +  + C S  V++ +IK I   +G+   I  QKK K LK      ++   L L++K    C C  L     +L G +++M +   D + ++  + +W +K  E K ++K + ++
Sbjct:   50 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKSGPLKRKDTKRLVLHMKNSAGCPCPQLD----SLAGSFLVMGR-KVDGQLLLMAVYRWDKKNKEMKFAVKFMFSY 299          
BLAST of secreted frizzled-related protein 1 vs. UniProt/SwissProt
Match: sp|Q8C4U3|SFRP1_MOUSE (Secreted frizzled-related protein 1 OS=Mus musculus OX=10090 GN=Sfrp1 PE=1 SV=3)

HSP 1 Score: 147.902 bits (372), Expect = 1.395e-39
Identity = 98/281 (34.88%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  260 SFIGDWQAFQSG--YT-IDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI----PKTVVPGKK-----CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQK--------KSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            SF  D  ++QSG  YT   QC  IP +  LC NVGY+ MVLPN ++HE++ E  Q +  W+ L+N  CH+  + F+CSL+APVC+    ++ + PCR LC  V++SC P M+ +GF WP ++KC KFP+    +CI    P T    K      C  C      E I    C S   +R KIK +   +G+   +  +K        K K LK    F +N  +    C C  L      L   ++IM +    ++ ++  I KW +K  EFK+ MK ++N
Sbjct:   38 SFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCL----DRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPE--GDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKRLVLFLKNGAD----CPCHQLD----NLSHNFLIMGR-KVKSQYLLTAIHKWDKKNKEFKNFMKRMKN 303          
BLAST of secreted frizzled-related protein 1 vs. UniProt/SwissProt
Match: sp|Q863H1|SFRP2_CANLF (Secreted frizzled-related protein 2 OS=Canis lupus familiaris OX=9615 GN=SFRP2 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.081e-38
Identity = 91/296 (30.74%), Postives = 147/296 (49.66%), Query Frame = 2
Query:  224 PLSLLLFISNVNSFIGDWQAFQSG-----YTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP----KTVVPG-----KKCDLCM-KIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALEL-------NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            P SLLL +   +  +G  +    G     Y    C  IP N  LC  + Y+ M LPN + HE+++E  + +  W+ LV  QCH D KKF+CSL+APVC+ +  ++ + PC  LCV VK+ C P M  +GF WP +++C +FPQ  N LCIP      ++P      K C+ C  K      I    C +   ++ K+K I   + +  +IIL+ KSK +      S+  L+        +L+C C  +      +   +++M Q     + V+  + +W++ + EFK   + I+  
Sbjct:    5 PGSLLLLVLASHCCLGSARGLFFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDD-LDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQ-DNDLCIPLASSDHLLPATEEAPKVCEACKNKNEDDNDIMETLCKNDFALKIKVKEITYINRDT-KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM----NDINAPYLVMGQ-KLGGELVITSVKRWQKGQREFKRISRSIRKL 292          
BLAST of secreted frizzled-related protein 1 vs. UniProt/SwissProt
Match: sp|O19116|SFRP1_BOVIN (Secreted frizzled-related protein 1 OS=Bos taurus OX=9913 GN=SFRP1 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 9.344e-38
Identity = 94/277 (33.94%), Postives = 137/277 (49.46%), Query Frame = 2
Query:  260 SFIGDWQAFQSG--YT-IDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI---PKTVVPGKK------CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGN----AIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            SF  D  A+QSG  YT   QC  IP +  LC NVGY+ MVLPN ++HE++ E  Q +  W+ L+N  CH+  + F+CSL+APVC+    ++ + PCR LC  V++SC P M+ +GF WP ++KC KFP+    +CI   P       K      C  C      E I    C S   +R KIK +   +G+      +    K     K +       L+    C C  L      L   ++IM +    ++ ++  I KW +K  EFK  MK ++N
Sbjct:   32 SFQSDIGAYQSGRFYTKPPQCVDIPADLRLCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCL----DRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPE--GDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKKLVLYLKNGADCPCHQLD----NLSHHFLIMGR-KVKSQYLLTAIHKWDKKNKEFKTFMKKMKN 297          
BLAST of secreted frizzled-related protein 1 vs. UniProt/SwissProt
Match: sp|Q5T4F7|SFRP5_HUMAN (Secreted frizzled-related protein 5 OS=Homo sapiens OX=9606 GN=SFRP5 PE=2 SV=3)

HSP 1 Score: 142.895 bits (359), Expect = 1.072e-37
Identity = 89/260 (34.23%), Postives = 137/260 (52.69%), Query Frame = 2
Query:  308 QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI-------PKTVVPGKK-CDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNA--LELNLK----CNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            QC  IP +  LC  VGY+ M LPN ++HES+ E  Q +  W+ L+  +CH D + F+CSL+APVC+    ++ + PCR LC  V+  C P M+ YGF WP ++ C KFP   N LCI       P T  P  K C  C    S + +  + C S  V++ +IK I   +G+   I  QKK K LK      ++   L L++K    C C  L     +L G +++M +   D + ++  + +W +K  E K ++K + ++
Sbjct:   52 QCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP-LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCPQLD----SLAGSFLVMGR-KVDGQLLLMAVYRWDKKNKEMKFAVKFMFSY 301          
BLAST of secreted frizzled-related protein 1 vs. TrEMBL
Match: B0LMG1 (Secreted frizzled-related protein 1 OS=Schmidtea mediterranea OX=79327 GN=sfrp1 PE=2 SV=1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 342/342 (100.00%), Postives = 342/342 (100.00%), Query Frame = 2
Query:  203 MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 1228
            MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS
Sbjct:    1 MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 342          
BLAST of secreted frizzled-related protein 1 vs. TrEMBL
Match: B1NWW1 (Secreted frizzled protein-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=SFRP-a PE=2 SV=1)

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 318/320 (99.38%), Postives = 318/320 (99.38%), Query Frame = 2
Query:  269 GDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 1228
            GDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQK PPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNAL LNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS
Sbjct:    1 GDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKAPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALGLNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 320          
BLAST of secreted frizzled-related protein 1 vs. TrEMBL
Match: D3J1K3 (Secreted frizzled-related protein (Fragment) OS=Schmidtea polychroa OX=50054 GN=sFRP PE=2 SV=1)

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 308/320 (96.25%), Postives = 310/320 (96.88%), Query Frame = 2
Query:  269 GDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 1228
            GDWQAFQSGYTIDQCYQIPDNFTLCSNVGY  MVLPNYIQHESIEEAAQHSKVWMGLVNTQCH DIKKFICSLYAPVCISNQR QKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPT+GNAIQIILQKKSKFLKFQANFSQNALEL LKCNCTNLKFKQRALKGRWIIMAQID  NKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERK QTRKFRKQKSRKS+K NNRS GIS
Sbjct:    1 GDWQAFQSGYTIDQCYQIPDNFTLCSNVGYMRMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHADIKKFICSLYAPVCISNQRIQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTNGNAIQIILQKKSKFLKFQANFSQNALELELKCNCTNLKFKQRALKGRWIIMAQIDRGNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKQQTRKFRKQKSRKSIK-NNRSPGIS 319          
BLAST of secreted frizzled-related protein 1 vs. TrEMBL
Match: D0VYP5 (Secreted frizzled-related protein A (Fragment) OS=Dugesia japonica OX=6161 GN=DjsFRP-A PE=2 SV=1)

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 263/328 (80.18%), Postives = 291/328 (88.72%), Query Frame = 2
Query:  251 NVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKY-SNERKLQTRKFRKQKSRKSVKP-NNRSAGIS 1228
            NVN FIGDWQ+FQSGYTI+QCY+IP+NF+LC +VGY  MVLPNYIQHESIEEAAQHS+VW+GLVNTQCH+DI+KFIC LYAPVCISNQR QKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQF+NSLCIP+T+VP K CDLC+K  SYEVIANRFCLSPIVIRAKIKRIIP     +QIILQKKSKFLKF ANFSQN L L LKCNCTNLKFKQRALKGRWIIMA+++  N+AVVNFI+KWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNN++KY ++          KQ++R+  KP N RS+ IS
Sbjct:    2 NVNCFIGDWQSFQSGYTINQCYRIPNNFSLCRDVGYNRMVLPNYIQHESIEEAAQHSRVWIGLVNTQCHIDIRKFICCLYAPVCISNQRIQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFQNSLCIPRTIVPEKNCDLCIKNPSYEVIANRFCLSPIVIRAKIKRIIPIGSKEMQIILQKKSKFLKFSANFSQNDLNLRLKCNCTNLKFKQRALKGRWIIMAKLN-KNEAVVNFITKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNKIKYSNSNNNNNNNNKSKQQTRRFKKPINTRSSSIS 328          
BLAST of secreted frizzled-related protein 1 vs. TrEMBL
Match: T1E103 (SFRP-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 1.575e-133
Identity = 182/330 (55.15%), Postives = 252/330 (76.36%), Query Frame = 2
Query:  251 NVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLP---DG-ISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 1228
            N+N F+GDWQ FQ+GY+ +QCY+IP+N TLC+NVGY+ M+LPNYIQHE ++E  QHSKVW+GLVN+QCH DI+KF+CSLYAPVCI+N R QKVPPC ELC+ VKE+CLPSMK++GF+WP IMKCS FP  KNSLCIP T+  GKKC  C+K ASYE++AN+FCLS IVIRAKIK+I    GN  +I L  KSKF+KFQ+N +QN++++ L CNC+ LKF+++A KG+W+IMA +  +N+  VNF++KWK++   F++S+ +++ FG+ +C+  LP   DG  S+ +RY AY KMN   K+ N +    R   +++  + ++  N+  G+S
Sbjct:   15 NINCFLGDWQQFQNGYSTEQCYRIPENLTLCNNVGYKRMILPNYIQHEYLDETVQHSKVWIGLVNSQCHEDIRKFLCSLYAPVCINNMRIQKVPPCNELCIRVKEACLPSMKLFGFEWPNIMKCSLFPSVKNSLCIPSTISKGKKCRTCVKGASYEIMANKFCLSTIVIRAKIKKIKSLEGNGFKIQLSPKSKFIKFQSNLTQNSIKIFLHCNCSKLKFEEKAYKGKWLIMANV-INNQTTVNFLTKWKKRNVNFRNSINVLRKFGNELCRLNLPNNSDGRTSMLKRYLAYAKMNEITKFKNRKNRNNRSDNRKRIVRELQ--NKKDGLS 341          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Cavefish
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:103037681])

HSP 1 Score: 156.762 bits (395), Expect = 7.665e-44
Identity = 90/260 (34.62%), Postives = 136/260 (52.31%), Query Frame = 2
Query:  308 QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP-------KTVVPGK--KCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNL------KCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            QC  IP +  LC  VGY+ M LPN + HE++ E  Q +  W+ L+  +CH D + F+CSL+APVC+    ++ + PCR LC  V++SC P M+ YGF WP +++C KFP + N LCI         T  PG+   C  C      E +   FC S  V++ KIK +    G+   I  QKK K LK      ++  +L L       C C+ L      L   ++IM +   D + ++  I KW +K  E K+++K +++
Sbjct:   50 QCVDIPVDLRLCYTVGYKKMRLPNLLDHETMPEVLQQAGSWVPLLAKRCHADTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCDKFP-YDNDLCITMQFSMNHATQTPGRTFTCPPCDNELKSETVMEHFCASDFVLKMKIKEVKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYLKNGANCPCSQLD----NLGSNFLIMGR-KVDQQLLLMSIHKWDKKSKELKYAIKYMKS 299          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Cavefish
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:103037681])

HSP 1 Score: 155.221 bits (391), Expect = 3.229e-43
Identity = 90/259 (34.75%), Postives = 135/259 (52.12%), Query Frame = 2
Query:  308 QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP-------KTVVP-GKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNL------KCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            QC  IP +  LC  VGY+ M LPN + HE++ E  Q +  W+ L+  +CH D + F+CSL+APVC+    ++ + PCR LC  V++SC P M+ YGF WP +++C KFP + N LCI         T  P  K C  C      E +   FC S  V++ KIK +    G+   I  QKK K LK      ++  +L L       C C+ L      L   ++IM +   D + ++  I KW +K  E K+++K +++
Sbjct:   54 QCVDIPVDLRLCYTVGYKKMRLPNLLDHETMPEVLQQAGSWVPLLAKRCHADTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCDKFP-YDNDLCITMQFSMNHATQTPVSKACPPCDNELKSETVMEHFCASDFVLKMKIKEVKKEKGDRKLIAAQKKKKVLKMGILRKKDLKKLTLYLKNGANCPCSQLD----NLGSNFLIMGR-KVDQQLLLMSIHKWDKKSKELKYAIKYMKS 302          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000011888.2 (secreted frizzled-related protein 2-like [Source:NCBI gene;Acc:103024223])

HSP 1 Score: 147.517 bits (371), Expect = 2.101e-40
Identity = 84/261 (32.18%), Postives = 128/261 (49.04%), Query Frame = 2
Query:  293 GYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKK-----------CDLCMKIASYEV-IANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKF-------QANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFK 1018
            G T   C  +P    LC  +GY  M LPN + H++++EA Q +  W+ L+  +CH D +KF+CSL+AP C+  +    VPPCR LCV V++ CLP M  +GF WP    CS+FP  K  LCIP     G             CD C   +  E  I   FC S    + +I       G+ ++++ Q +S+ L++       QA   Q+AL L    NC+    + + + G  + +  +    + V+  + KW R + E K
Sbjct:   46 GTTRTVCKPLPSTMGLCHGIGYESMRLPNLLGHDTVKEAQQQAGAWVPLLTKRCHSDTRKFLCSLFAPACLV-ELTVAVPPCRSLCVAVRDGCLPVMSAFGFPWPEAFNCSRFPH-KEELCIPGAEDAGHVDTSETDKGTVLCDACSLASEAESEIQKNFCSSQFAFKLQIGS-SSLEGSDLRVVPQGRSRVLRWEGSEQEQQAAMEQSALWLPEAANCSCQALEGKPV-GSMLALGNM-YKGRMVLARLVKWSRSEKELK 301          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Cavefish
Match: sfrp2 (secreted frizzled related protein 2 [Source:NCBI gene;Acc:103033411])

HSP 1 Score: 143.28 bits (360), Expect = 6.562e-39
Identity = 85/268 (31.72%), Postives = 136/268 (50.75%), Query Frame = 2
Query:  299 TIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP-----------KTVVPGKKCDLC-MKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLK-----FQANFSQNALEL--NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            T  QC  IP    LC  + Y  M LPN + HE++ E  Q +  W+ LV  +CH D +KF+CSL+APVC+ +  ++ + PCR LC  V+  C P M  +GF WP +++CS+FP   + LCIP              VP K CD C  KI     + +  C +   ++ K+K I   +G+  +II + KSK +       + +  + AL L   L+C+C  +      +   +++M Q   D   V+  + +W++ + EFK   + I+  
Sbjct:   34 TRSQCKPIPPALHLCHEIEYAEMRLPNLLGHEAMSEVLQQAASWVPLVQKRCHPDTRKFLCSLFAPVCLPDV-DEPIRPCRSLCEAVRHGCAPVMAAFGFPWPEMLRCSRFPP-DDDLCIPAGDNGERATAANETVP-KVCDACKEKIEDDSEMVDSLCKNDFALKIKVKEITYMNGDT-KIIPETKSKTIYKLNGVTERDLRKTALLLKDGLQCSCEEMN----DINSAYLVMGQ-KQDGNLVITSLKRWQKGQREFKRISRSIRKM 292          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Cavefish
Match: sfrp1a (secreted frizzled related protein 1 [Source:NCBI gene;Acc:103030300])

HSP 1 Score: 136.732 bits (343), Expect = 2.276e-36
Identity = 82/272 (30.15%), Postives = 134/272 (49.26%), Query Frame = 2
Query:  278 QAFQSGYTI----DQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP---KTVVPGKKCDLCMKIA-SYEVIANRFCLSPIVIRAKIK---------RIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            + F +G  +     QC +IPD+  LC  VGY  M LPN ++HE++ E  Q +  W+ LV+  CH   + F+CSL+ PVC+    +Q + PCR LC  V+++C P M+ +GF WP ++ C+KFP+    L  P   ++ +P     +C       + I +  C S  VI+ KIK         ++I             K K +K    + +N  +    C C+ L      L   ++IM +   D + ++  I KW +   EF+ +MK ++N
Sbjct:   37 ELFPTGPEVYVKPPQCLEIPDDLRLCHGVGYNQMRLPNLLEHETMAEVKQQAGSWVPLVHKNCHPSTQVFLCSLFTPVCL----DQPIYPCRWLCEDVRDACTPIMQAFGFPWPEMLTCNKFPEGDVCLSAPNASESALPNGVSPICPPCDHEVDAILDHICASEFVIKTKIKEVKRENNDRKVILQKKKKTLKQGTLKKKDMKKLILYLKNGAD----CPCSQLD----NLNNNYLIMGR-KVDKQHIITGIHKWDKSSKEFRQTMKQMRN 295          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011338.1 (pep scaffold:Pmarinus_7.0:GL496444:1147:1527:1 gene:ENSPMAG00000010311.1 transcript:ENSPMAT00000011338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 1.771e-20
Identity = 41/92 (44.57%), Postives = 56/92 (60.87%), Query Frame = 2
Query:  281 AFQS--GYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELC 550
            ++QS   Y    C  IP    LC +VGY  M LPN + HES+ EA Q +  W+ L+  +CH D KKF+CS++APVCI ++    + PCR LC
Sbjct:   37 SYQSDLSYRRPNCKAIPPAMALCHDVGYPEMRLPNLLGHESMREALQQASSWVPLLAKRCHPDTKKFLCSVFAPVCI-DELEDPIWPCRSLC 127          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 4.471e-20
Identity = 39/109 (35.78%), Postives = 62/109 (56.88%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQF--KNSLCI 658
            +C  +GY    +PN   H+S +EA      +  LV  +C  D++ F+CS+Y P+C+ + + Q +PPCR +C   +  C P M+ YGF WP  M+C + P    +N LC+
Sbjct:   16 MCRGIGYNHTYMPNDFNHDSQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYK-QPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPVLGDQNRLCM 123          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Sea Lamprey
Match: frzb (frizzled related protein [Source:ZFIN;Acc:ZDB-GENE-990715-1])

HSP 1 Score: 87.8113 bits (216), Expect = 8.530e-20
Identity = 61/262 (23.28%), Postives = 114/262 (43.51%), Query Frame = 2
Query:  323 PDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI-PKTVVPGKKCDLCMKIASYEVIANR-----FC--LSP---------------------IVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALEL--NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNF----ISKWKRK 1003
            P    +C ++ + +  +PN++ H + E A    + +  L++TQC   ++ F+C++YAP+C    +   + PC+ +C   +++C P M+ Y  DWP  M C + P ++ ++CI P+ +V         + A+ E++         C  +SP                      VIRA++K +  +  + IQ  ++ K        + S+  + L  N  C C  L          +IIM   D     ++ F      KWK +
Sbjct:   28 PVRIPMCQSMLWNMTRMPNHLHHSTQENAILSIEQFQDLLDTQCSAVLRFFLCAMYAPICTIEFQTDPIKPCKAVCEAARDACRPVMRQYNHDWPESMACDELPVYERAVCISPEAIVTVMPEGELTRSATVEMVNKERHLYLICASISPQRCKCRKIKANQKTYTAKNYNYVIRARVKDVHRSGCSEIQTTVEVKDVIKSSGVSISRGDVHLYTNSSCLCPEL-----LTADEYIIMGYEDRMRTRLLLFDGCVAEKWKER 284          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 89.7373 bits (221), Expect = 2.003e-19
Identity = 44/143 (30.77%), Postives = 69/143 (48.25%), Query Frame = 2
Query:  323 PDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSP 748
            P +  LC+++ Y   ++PN + H + E+A      +  LV  QC  D+K F+CS+YAPVC      + +PPCR LC   ++ C   M  +GF WP  ++C  FP Q   ++C+ +     K               + F L P
Sbjct:   59 PISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVC--TVLEEAIPPCRSLCERARQGCETLMNKFGFQWPERLRCENFPVQGSENICVGQNHTDEKGGHPTPPDPHPIPHGDSFTLPP 199          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 88.5817 bits (218), Expect = 3.436e-19
Identity = 40/113 (35.40%), Postives = 64/113 (56.64%), Query Frame = 2
Query:  323 PDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFP-QFKNSLCI 658
            P +  LC+++ Y   ++PN + H + E+A      +  LV  QC  D+K F+CS+YAPVC   ++   +PPCR LC   ++ C   M  +GF WP  ++C  FP Q  + +C+
Sbjct:   15 PISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVLEK--AIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFPVQGSDEICV 125          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 99.3673 bits (246), Expect = 1.668e-22
Identity = 43/111 (38.74%), Postives = 65/111 (58.56%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQF--KNSLCIPK 664
            +C  +GY L  +PN   H++  EAA     +  LV  QC  D++ F+CS+YAP+C     ++ +PPCR +C   +  C P M+ YGF WP  MKC  FP+   +N+LC+ +
Sbjct:   36 MCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLC-EKHYDKDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFPELGDENTLCMGR 145          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 98.9821 bits (245), Expect = 2.487e-22
Identity = 45/124 (36.29%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  323 PDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPK-TVVPGKKCD 691
            P    LC+ + Y + + PN ++H + EEAA     +  LV   C  D+  F+CS+YAPVC        +PPCR LC+TV+  C   MK +GF WP  + C +FP+  + +C+ + T  P    D
Sbjct:   31 PVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVC--TVLETPLPPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDEICVGENTTTPTSDQD 152          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Nematostella
Match: EDO46557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPS6])

HSP 1 Score: 91.2781 bits (225), Expect = 1.077e-20
Identity = 42/117 (35.90%), Postives = 70/117 (59.83%), Query Frame = 2
Query:  290 SGYTIDQCYQIP-DNFTLCSNV--GYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKF 631
            S Y   +C++I  +   +C+N+  GY  ++LPN + H+++ E       W  LV + C   +K F+CS++ PVC+  Q +  VPPC  LC +V++SC P MK++ + WP +  CSK+
Sbjct:   21 SSYRAVKCFEISREKDLMCANLTRGYNKIMLPNALGHDNLAEVRTQLVPWAPLVGSGCSPHLKVFLCSVFMPVCV-QQISYPVPPCHSLCTSVRDSCEPVMKIHNYSWPAMFDCSKY 136          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Nematostella
Match: EDO32500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUU2])

HSP 1 Score: 82.0333 bits (201), Expect = 4.871e-19
Identity = 38/107 (35.51%), Postives = 57/107 (53.27%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI 658
            +C N+GY   + PN + H++  EA      ++ LV   C   + +F+C  YAP C    +   V PCR +C  V+  C   MK +GFDWP  + C KFP+   S+C+
Sbjct:   10 MCKNLGYNQTLFPNSLGHKTQREAGLIVHQFVPLVKVNCSEMLSRFLCFTYAPFCTVLMK--PVLPCRSMCRAVRRGCETLMKRFGFDWPETLNCKKFPRESRSICV 114          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Nematostella
Match: EDO31664 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXA8])

HSP 1 Score: 75.0998 bits (183), Expect = 1.174e-16
Identity = 32/100 (32.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  338 LCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQ 637
            +C   GY   +LPN++ H+S  EA +  + ++  +   C   +K  +C+ Y P C   Q +   PPCRELC   ++ C   M  +GF WP  ++C   P+
Sbjct:   11 ICLGFGYNDTILPNHLNHKSQGEAMRGMQRFLPFIRANCSTSLKALVCAAYFPRCTKPQ-SYAAPPCRELCERSRDECARLMDAFGFAWPRQLRCEDLPR 109          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Medaka
Match: sfrp5 (secreted frizzled related protein 5 [Source:NCBI gene;Acc:101162946])

HSP 1 Score: 146.362 bits (368), Expect = 6.923e-40
Identity = 92/276 (33.33%), Postives = 138/276 (50.00%), Query Frame = 2
Query:  275 WQA--FQSG--YTID-QCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASY---------EVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNL------KCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQN 1042
            WQ+  F +G  YT   QC  IP +  LC NVGY+ M LPN + HE++ E  Q +  W+ L+  +CH D + F+CSL+APVC+    ++ + PCR LC  V+ SC P M+ YGF WP ++ C KFP   N LCIP     G    L                + I   +C S  V++ KIK +     +   I  QKK K LK      ++  +L L       C C+ L     +L   +++M +   D + ++  I KW +K  E K ++K +++
Sbjct:   44 WQSDNFHNGRFYTKQPQCVDIPSDLRLCHNVGYKKMRLPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVCL----DRPIYPCRSLCEAVRNSCAPVMETYGFPWPDMLTCDKFP-IDNDLCIPMQFA-GNHATLPPVPKVCPPCDNELKTDNIMEHYCASDFVLKMKIKEVKKEKADRKLIAAQKKKKVLKQGVLRKKDLKKLTLYIKNGANCPCSQLD----SLGSHFLVMGR-KVDQQLLLMSIHKWDKKSKELKFAIKYMKS 308          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Medaka
Match: sfrp1 (secreted frizzled related protein 1 [Source:NCBI gene;Acc:100049476])

HSP 1 Score: 145.976 bits (367), Expect = 8.352e-40
Identity = 96/298 (32.21%), Postives = 152/298 (51.01%), Query Frame = 2
Query:  227 LSLLLFIS-NVNSFIGDWQAFQ----SGYT-IDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCI------------PKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALE---LNLK----CNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNF 1045
            L LLL ++   + +   W A       GY    QC  IPD+  LC  VGY  M+LPN ++HE++ E  Q +  W+ LV+  CH D + F+C+L+APVC+     + + PCR LC TV++ C P M+ +GF WP ++ C KFPQ  + +CI            P    P   C  C      + +    C S   ++AKIK +   + +  ++ILQ++ + +K Q N  +  L+   L LK    C C  L+     L+ +++IM +   D + ++  I KW +   EFK  MK ++N+
Sbjct:   14 LVLLLAVTCGASEYEYTWAAGSYNGGRGYGKAPQCVDIPDDLRLCHTVGYTQMLLPNLLEHETMAEVKQQASSWVPLVHKNCHKDTQVFLCALFAPVCME----RPIYPCRWLCETVRDGCSPIMEAFGFPWPEMLTCDKFPQ--DGVCIAVTQPNATEATWPSGHSPA--CPPCDNEIKNDAMLENICASEFALKAKIKEVKQENMDR-KVILQRRKRMVK-QGNLKKRDLKKLTLYLKNGANCPCQQLE----NLENQYLIMGR-KVDKQFLLTGIHKWDKSSKEFKKIMKKLKNY 296          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000013981.2 (secreted frizzled-related protein 2 [Source:NCBI gene;Acc:101171428])

HSP 1 Score: 142.124 bits (357), Expect = 3.772e-38
Identity = 79/290 (27.24%), Postives = 126/290 (43.45%), Query Frame = 2
Query:  311 CYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKK----------------CDLC-MKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNL-------------KCNCTNLKFK------------------------QRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFK 1018
            C  IP+  +LC  +GYR M +PN + H+S+ E  Q S  W+ LV+  CH D KKF+CSL+APVC+  + +  V PCR LC  V++ C+P M  +GF WP +  CS+FP     LCIP T     +                CD+C + +     I   FC SP  ++ ++   + T G   Q++   +S+ L++    ++   E                 C C  L                           ++A  G W +      + + V+  + +W R + E +
Sbjct:   37 CKPIPNTLSLCHGIGYRRMWIPNLLGHDSLREVQQQSAAWLPLVSKLCHGDTKKFLCSLFAPVCLP-ELSGPVSPCRGLCEAVRDGCVPVMSAFGFPWPEMFNCSRFPH-GTELCIPATGAREGRTEEEVRHEEALKGSIICDVCSLAVEGESEIQENFCHSPYALKMRLDS-VSTVGRDRQLVPHARSRILRWAGGGAERVQEFGSAMVYGALWLQEGGSCICPGLDAARVKEDAESAEGQVDGKQSKDGGKVEKAASGGWFLSLAQAEEGRLVLTRLLRWTRGERELR 323          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Medaka
Match: sfrp2 (secreted frizzled related protein 2 [Source:NCBI gene;Acc:101159245])

HSP 1 Score: 137.502 bits (345), Expect = 7.749e-37
Identity = 80/287 (27.87%), Postives = 146/287 (50.87%), Query Frame = 2
Query:  209 MTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIP----KTVVP-----GKKCDLCMKIASYE-VIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALEL-------NLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFK 1018
            M  +    LLL  ++ +  + ++   +  +  + C QIP +  LC ++ Y  M LPN + HE++ E  Q +  W+ LV  QCH D +KF+CSL+APVC+ +  ++ + PCR LC +VK  C P M  +GF WP ++ C +FP   + LCIP    + +VP      + CD C +    +  I +  C +   ++ K+K I   + +  +I+ + KSK +      ++  L          ++C C  +      +   +++M Q  +++  V+  + +W++ + EFK
Sbjct:    1 MRALISAVLLLTTTHCSRALFNFDQHELLFKRNSCKQIPASLPLCHDMEYTEMRLPNLLGHETMTEVLQQAASWIPLVQKQCHPDTRKFLCSLFAPVCLDDL-DEPIQPCRSLCESVKRGCAPVMSAFGFPWPKMLDCERFPP-DDDLCIPPVDSENLVPVTEEAPRVCDACKETDEKDNEIVDSLCKNDFAMKIKVKDISYINRDT-KIVPETKSKIIYMVNGVTERDLRKMPLLLRDGMQCICEEMN----DINTAYLVMGQ-KTESHLVITSLKRWQKGQREFK 279          
BLAST of secreted frizzled-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000011365.2 (pep primary_assembly:ASM223467v1:7:14585088:14586426:-1 gene:ENSORLG00000009063.2 transcript:ENSORLT00000011365.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 6.328e-33
Identity = 81/281 (28.83%), Postives = 138/281 (49.11%), Query Frame = 2
Query:  269 GDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTV---------VPGKKCDLC--MKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLK---FQANFSQNALELNLKCNCTNLK--FKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCK 1063
            G W++     T  +C  IP +  LC N+GY  M +PN + HES+ EA Q S  W+ L+  +CH D + F+CSL+AP+C+       + PCR LC +V++SC P M  YG+ WP I++C ++P  ++ +CI              P   C  C   K +S +     FC S  V + ++ R+  +  +  Q  L  K   LK         ++ +EL L+ + T ++   +Q    G +++   +  + + VVN    W+R+    ++ M   + + H  C+
Sbjct:    1 GLWES----RTSSRCVPIPSDMALCQNIGYDTMRMPNLLGHESLAEAVQQSTSWLPLLARECHPDARSFLCSLFAPICLDF-----ISPCRSLCESVRDSCAPIMSCYGYPWPEILRCDQYPA-EHLVCISSITNATVNTDGQRPQASCRDCELEKPSSPKDTLESFCKSDFV-KLRLTRLKYSPASLSQFSLTTKLDVLKQGPLVGGQIRSRIELWLERDATCVRNMTRQHPRGGTFLVTGTVQGE-RLVVNKAYAWQRQN---RNLMAAARKWKHHRCR 266          
BLAST of secreted frizzled-related protein 1 vs. Planmine SMEST
Match: SMESG000075831.1 (SMESG000075831.1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 341/342 (99.71%), Postives = 341/342 (99.71%), Query Frame = 2
Query:  203 MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 1228
            MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTS NAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS
Sbjct:    1 MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 342          
BLAST of secreted frizzled-related protein 1 vs. Planmine SMEST
Match: SMESG000029446.1 (SMESG000029446.1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 341/342 (99.71%), Postives = 341/342 (99.71%), Query Frame = 2
Query:  203 MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 1228
            MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTS NAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS
Sbjct:    1 MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 342          
BLAST of secreted frizzled-related protein 1 vs. Planmine SMEST
Match: SMESG000029446.1 (SMESG000029446.1)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 339/340 (99.71%), Postives = 339/340 (99.71%), Query Frame = 2
Query:  209 MTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 1228
            MTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTS NAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS
Sbjct:    1 MTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 340          
BLAST of secreted frizzled-related protein 1 vs. Planmine SMEST
Match: SMESG000075831.1 (SMESG000075831.1)

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 287/288 (99.65%), Postives = 287/288 (99.65%), Query Frame = 2
Query:  365 MVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 1228
            MVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTS NAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS
Sbjct:    1 MVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSDNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERYAAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS 288          
BLAST of secreted frizzled-related protein 1 vs. Planmine SMEST
Match: SMESG000050379.1 (SMESG000050379.1)

HSP 1 Score: 181.03 bits (458), Expect = 5.865e-53
Identity = 101/279 (36.20%), Postives = 160/279 (57.35%), Query Frame = 2
Query:  266 IGDWQAFQSGYTIDQCYQIPDNFTLCSNVGYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVCISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSLCIPKT----------VVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAIQIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQIDSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKL 1072
            + +W     GY+  +C++IP+ F LC N+GY  M+LPN++QHE+++EA   S  W    + +CH D ++F+CSLYAPVC+ N+  +K+ PC+ELC++VK++C P+M  +G+ WP I+ C KFPQ    LCI  T          VVP K C+ C  + S   I + +C S  VIRAKI R+   + +   + L KKSK +K           + + C C  +       KGRW++M  ++ D K  +  ++KWK+K  +FK  ++ ++ F   +C S+ 
Sbjct:   25 VPEWNNLIYGYSSHRCHEIPNEFGLCKNIGYNKMILPNFLQHETVQEAINSSIDWQKFADIKCHNDTRRFLCSLYAPVCVPNEPVRKIQPCKELCLSVKKACSPNMLTFGYKWPEILHCDKFPQKFAGLCIRGTEGAVPSGSSSVVP-KGCN-CRSLYSAAFINDNYCSSTTVIRAKISRLRIRNNSKYVMRLHKKSKIIKSNPTDLPFITSIEVSCLCDMID-NDNIRKGRWLLMGVVN-DGKFTLTSLTKWKKKNKDFKKVIRKLKKFEEKICGSRF 299          
The following BLAST results are available for this feature:
BLAST of secreted frizzled-related protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SFRP52.233e-3834.23secreted frizzled related protein 5 [Source:HGNC S... [more]
SFRP24.302e-3830.30secreted frizzled related protein 2 [Source:HGNC S... [more]
SFRP19.453e-3833.57secreted frizzled related protein 1 [Source:HGNC S... [more]
FZD12.739e-2036.97frizzled class receptor 1 [Source:HGNC Symbol;Acc:... [more]
FZD85.198e-2037.61frizzled class receptor 8 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp-11.863e-4331.37Secreted Frizzled-Related Protein [Source:UniProt... [more]
sfrp-11.188e-3431.60Secreted Frizzled-Related Protein [Source:UniProt... [more]
mig-16.191e-1835.92Transmembrane receptor [Source:UniProtKB/TrEMBL;A... [more]
mig-16.314e-1835.92Transmembrane receptor [Source:UniProtKB/TrEMBL;A... [more]
mom-56.383e-1734.53pep chromosome:WBcel235:I:9965580:9969413:1 gene:W... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz7.385e-1838.94gene:FBgn0001085 transcript:FBtr0330102[more]
fz7.936e-1838.94gene:FBgn0001085 transcript:FBtr0075743[more]
fz22.514e-1731.75gene:FBgn0016797 transcript:FBtr0112890[more]
fz22.514e-1731.75gene:FBgn0016797 transcript:FBtr0075029[more]
fz22.514e-1731.75gene:FBgn0016797 transcript:FBtr0332735[more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp56.888e-4533.44secreted frizzled-related protein 5 [Source:ZFIN;A... [more]
sfrp23.740e-4032.00secreted frizzled-related protein 2 [Source:ZFIN;A... [more]
sfrp23.740e-4032.00secreted frizzled-related protein 2 [Source:ZFIN;A... [more]
sfrp2l5.754e-3831.00secreted frizzled-related protein 2 like [Source:Z... [more]
sfrp2l1.676e-3630.89secreted frizzled-related protein 2 like [Source:Z... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp58.408e-4032.99secreted frizzled-related protein 5 [Source:NCBI g... [more]
sfrp24.065e-3932.46secreted frizzled-related protein 2 [Source:NCBI g... [more]
sfrpx9.468e-3729.23secreted frizzled-related protein [Source:NCBI gen... [more]
frzb26.297e-3529.50frizzled related protein 2 [Source:NCBI gene;Acc:5... [more]
sfrp11.298e-3128.41Xenopus tropicalis secreted frizzled-related prote... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sfrp11.995e-4034.88secreted frizzled-related protein 1 [Source:MGI Sy... [more]
Sfrp24.508e-3831.46secreted frizzled-related protein 2 [Source:MGI Sy... [more]
Sfrp57.099e-3733.46secreted frizzled-related sequence protein 5 [Sour... [more]
Fzd11.689e-2036.97frizzled class receptor 1 [Source:MGI Symbol;Acc:M... [more]
Fzd82.575e-2037.61frizzled class receptor 8 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9XSC1|SFRP5_BOVIN9.990e-4134.23Secreted frizzled-related protein 5 OS=Bos taurus ... [more]
sp|Q8C4U3|SFRP1_MOUSE1.395e-3934.88Secreted frizzled-related protein 1 OS=Mus musculu... [more]
sp|Q863H1|SFRP2_CANLF3.081e-3830.74Secreted frizzled-related protein 2 OS=Canis lupus... [more]
sp|O19116|SFRP1_BOVIN9.344e-3833.94Secreted frizzled-related protein 1 OS=Bos taurus ... [more]
sp|Q5T4F7|SFRP5_HUMAN1.072e-3734.23Secreted frizzled-related protein 5 OS=Homo sapien... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LMG10.000e+0100.00Secreted frizzled-related protein 1 OS=Schmidtea m... [more]
B1NWW10.000e+099.38Secreted frizzled protein-like protein (Fragment) ... [more]
D3J1K30.000e+096.25Secreted frizzled-related protein (Fragment) OS=Sc... [more]
D0VYP50.000e+080.18Secreted frizzled-related protein A (Fragment) OS=... [more]
T1E1031.575e-13355.15SFRP-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp57.665e-4434.62secreted frizzled related protein 5 [Source:NCBI g... [more]
sfrp53.229e-4334.75secreted frizzled related protein 5 [Source:NCBI g... [more]
ENSAMXT00000011888.22.101e-4032.18secreted frizzled-related protein 2-like [Source:N... [more]
sfrp26.562e-3931.72secreted frizzled related protein 2 [Source:NCBI g... [more]
sfrp1a2.276e-3630.15secreted frizzled related protein 1 [Source:NCBI g... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011338.11.771e-2044.57pep scaffold:Pmarinus_7.0:GL496444:1147:1527:1 gen... [more]
ENSPMAT00000011009.14.471e-2035.78pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
frzb8.530e-2023.28frizzled related protein [Source:ZFIN;Acc:ZDB-GENE... [more]
fzd7a2.003e-1930.77frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd23.436e-1935.40frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429321.668e-2238.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357512.487e-2236.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465571.077e-2035.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325004.871e-1935.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316641.174e-1632.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfrp56.923e-4033.33secreted frizzled related protein 5 [Source:NCBI g... [more]
sfrp18.352e-4032.21secreted frizzled related protein 1 [Source:NCBI g... [more]
ENSORLT00000013981.23.772e-3827.24secreted frizzled-related protein 2 [Source:NCBI g... [more]
sfrp27.749e-3727.87secreted frizzled related protein 2 [Source:NCBI g... [more]
ENSORLT00000011365.26.328e-3328.83pep primary_assembly:ASM223467v1:7:14585088:145864... [more]
back to top
BLAST of secreted frizzled-related protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075831.10.000e+099.71SMESG000075831.1[more]
SMESG000029446.10.000e+099.71SMESG000029446.1[more]
SMESG000029446.10.000e+099.71SMESG000029446.1[more]
SMESG000075831.10.000e+099.65SMESG000075831.1[more]
SMESG000050379.15.865e-5336.20SMESG000050379.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022468
GenBankABY85212.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022468 ID=SMED30022468|Name=secreted frizzled-related protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1356bp
CGATCTTGAAGTTTTCCCATCATTTAAATCAATAACATGCAATAAAGTAG
AGGAAAATGAGGCTGTATTCAGCATGTGAAAATTTAACATTATGACATCT
GACGGTAATTAATATGATTGGCTAGTTTCAACTTATCAGACACAAATCAC
AAGCTATTAACTACTATAATATTTAATCAAATGCCCCATTTGAATTGAAT
TCATGGAAATGACCAAGATTTTTCCCCTAAGTTTACTATTGTTCATTTCT
AATGTTAATAGTTTCATTGGAGATTGGCAAGCATTTCAAAGTGGTTACAC
AATAGATCAATGTTATCAAATTCCTGATAACTTTACCCTGTGTAGTAACG
TCGGTTATAGGCTAATGGTTTTACCCAATTATATTCAACATGAGTCGATA
GAAGAAGCTGCTCAGCACTCTAAAGTCTGGATGGGTTTAGTAAACACTCA
ATGCCATGTCGACATAAAAAAGTTCATTTGTTCACTTTATGCTCCGGTAT
GCATAAGCAATCAGAGAAATCAAAAGGTTCCGCCTTGCAGAGAACTCTGC
GTGACTGTTAAGGAATCGTGTTTGCCGAGTATGAAAATGTACGGATTTGA
CTGGCCAACAATTATGAAATGTTCGAAATTTCCACAATTTAAAAATTCAT
TATGTATACCAAAAACCGTCGTGCCAGGTAAAAAGTGTGACCTATGCATG
AAAATAGCTTCCTATGAAGTCATTGCTAACAGATTCTGTTTATCTCCCAT
AGTAATCAGAGCGAAAATCAAGAGAATTATTCCAACCAGCGGCAATGCCA
TTCAGATTATTCTACAAAAGAAATCAAAATTCCTCAAATTTCAAGCCAAT
TTCAGTCAGAACGCTCTGGAGTTGAATCTGAAATGCAACTGTACGAATCT
CAAATTCAAACAACGCGCCTTGAAAGGCCGGTGGATTATTATGGCACAAA
TCGACAGCGACAACAAAGCCGTGGTGAATTTCATTTCCAAATGGAAAAGA
AAGAAAGCAGAATTCAAGCATTCAATGAAAATCATTCAGAATTTCGGTCA
CATTGTTTGTAAGTCAAAACTGCCGGACGGAATCAGTTTACGTGAGAGAT
ATGCCGCTTATTTAAAGATGAATAATCAACTAAAATATTCAAATGAAAGA
AAACTACAAACGAGAAAATTCAGAAAACAGAAATCGAGAAAATCAGTCAA
ACCCAACAATCGGTCTGCCGGAATTTCCTGATTGCGTTTTGTTTAAATGG
TGATTTCGAATTTGAAATTTGTCAATTTAATGTTATTTAATTCTAATCAC
AACAAAACATTTCATTGATTAATTATTTAACATTATTTTTATTACTTACC
TTTATA
back to top

protein sequence of SMED30022468-orf-1

>SMED30022468-orf-1 ID=SMED30022468-orf-1|Name=SMED30022468-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MEMTKIFPLSLLLFISNVNSFIGDWQAFQSGYTIDQCYQIPDNFTLCSNV
GYRLMVLPNYIQHESIEEAAQHSKVWMGLVNTQCHVDIKKFICSLYAPVC
ISNQRNQKVPPCRELCVTVKESCLPSMKMYGFDWPTIMKCSKFPQFKNSL
CIPKTVVPGKKCDLCMKIASYEVIANRFCLSPIVIRAKIKRIIPTSGNAI
QIILQKKSKFLKFQANFSQNALELNLKCNCTNLKFKQRALKGRWIIMAQI
DSDNKAVVNFISKWKRKKAEFKHSMKIIQNFGHIVCKSKLPDGISLRERY
AAYLKMNNQLKYSNERKLQTRKFRKQKSRKSVKPNNRSAGIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002005anterior tip
PLANA:0002074pharynx tip
PLANA:0002089reproductive organ
PLANA:0007524anterior pole
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR020067Frizzled_dom
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 36..156
e-value: 1.3E-39
score: 147.6
IPR020067Frizzled domainPFAMPF01392Fzcoord: 37..146
e-value: 1.0E-26
score: 93.7
IPR020067Frizzled domainPROSITEPS50038FZcoord: 32..168
score: 22.436
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldGENE3DG3DSA:2.40.50.120coord: 160..282
e-value: 6.8E-6
score: 27.9
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 159..267
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 34..159
e-value: 3.4E-36
score: 126.2
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 36..152
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..332
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..342
NoneNo IPR availablePANTHERPTHR11309:SF128coord: 5..278
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.678
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 5..278
IPR001134Netrin domainPROSITEPS50189NTRcoord: 162..286
score: 10.747