SMED30022465

Overview
NameSMED30022465
Smed IDSMED30022465
Length (bp)1418
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022465 (SMED30022465) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022465 (SMED30022465) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022465

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30022465SMESG000068142.1 Contig27347newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022465SMESG000068142.1 Contig27347uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30022465SMESG000068142.1 PL06004A1A12_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022465 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000534:62339..70692 -7071
Homology
BLAST of SMED30022465 vs. TrEMBL
Match: A0A183SF89 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS2887 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.524e-14
Identity = 52/155 (33.55%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  776 NQAIITAKYKKDLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPYYNEITNRRVFIPIPRSTVDYTDPMEKLRRRGIVRK---YDPPWLKKVRLERLKRTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAH 1231
            N+A I     +D+ +  FD+       V  K SRACQ  D   F    + + N  V++PIP ST  Y DP+  LRR    R+    +P W+++ RL+R++  F  +++ K     N ++ F +E  G V K+R G++R   V+    YE FV+AH
Sbjct:  217 NRASILTNLGEDICRISFDITEAKFAAVKMKQSRACQSVDRVAFFKNMS-VLNTEVYVPIPMSTYSYDDPIVHLRRENRKRRDAGLEPIWMEEARLKRVQ-MFDGLDEVKSYGVSN-SSLFEIERQGYVLKMRTGVMRGYLVEGEDLYEEFVQAH 368          
BLAST of SMED30022465 vs. TrEMBL
Match: A0A0R3WQV6 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS3131 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.550e-13
Identity = 58/185 (31.35%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  701 LDSIRSRLLDHVVNRY--PINDTNNLLNQAIITAKYKKDLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPYYNE-ITNRRVFIPIPRSTVDYTDPMEKLR---RRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPT--TYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAH 1231
            L SIR  L      +Y  P N   +     +I    + D+ +  FD+ +V    ++ K SR CQ  D   +I Y    ITN  +++P+P ST  Y DPM  +R    + ++R  +P W+ +VR +RL    C  +K K +  +  +  + F VE GG  YK   G+LR   ++ +  Y+ FVR H
Sbjct:  189 LISIRGDLTAASQFKYEAPSNYLGSCRASLLIRIDSEGDVCRVCFDLVDVNYGNILSKTSRGCQTTDP--YIYYKTRGITNSFIYVPVPLSTYLYRDPMPGIRLHSHKQLMRGVEPEWMTEVRRKRL----CHPKKVKADPRYPGSLVSSFIVEYGGYAYKACTGLLRARLIRGTQLYDEFVRTH 367          
BLAST of SMED30022465 vs. TrEMBL
Match: A0A0R3U4A6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1471 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.945e-12
Identity = 53/166 (31.93%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  755 NDTNNLLNQAIITAKYKKDLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPY-YNEITNR---RVFIPIPRSTVDYTDPMEKLRRRG---IVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAH 1231
            N++       ++      D+ + +FD+ ++    V+ + SR CQ  D     PY Y+++       V+IP+P ST  Y DPM  +R+R     V   +PPW+ KVR ERL RT  +  K   N +    + F+VE GG V +   G+L+       S Y+ FVR H
Sbjct:  208 NESGCCRASLLMKVDSDGDICRVRFDLEDMEFVAVLLRTSRGCQTED-----PYIYHKMRGSIKPVVYIPLPLSTYIYHDPMASIRQRNHQHAVNGIEPPWMAKVRRERLCRT--RETKVGGNYSGVLLSTFTVERGGYVMQACTGLLKARITYGHSFYDDFVRTH 366          
BLAST of SMED30022465 vs. TrEMBL
Match: A0A0R3W9S6 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7234 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.083e-12
Identity = 49/148 (33.11%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  809 DLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPYYNE--ITNRRVFIPIPRSTVDYTDPMEKLR---RRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPT--TYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAH 1231
            D+ +  FD+ +V    V+ ++SR+CQ  D +    YY    I +  +++P+P ST  Y DPM  +R    R ++R  +P W+ +VR +RL    C+ +K K +  +  +  + F VE+GG  YK   G+LR   ++  S Y+ FVR H
Sbjct:  216 DICRVSFDLVDVVYANVLSRISRSCQTTDPNV---YYKTRGILSSFMYVPVPLSTYLYKDPMPDIRLQSHRQLMRGAEPEWMTEVRRKRL----CQPKKVKIDPRYPGSLVSSFIVEHGGYAYKACTGLLRAKLIRGFSLYDEFVRTH 356          
BLAST of SMED30022465 vs. TrEMBL
Match: U6JCA3 (Uncharacterized protein OS=Echinococcus granulosus OX=6210 GN=EGR_01813 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.051e-11
Identity = 47/147 (31.97%), Postives = 76/147 (51.70%), Query Frame = 2
Query:  809 DLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPY-YNEITNRRVFIPIPRSTVDYTDPMEKLR---RRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPT--TYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAH 1231
            D+ +  FD+ ++    ++ K S++ Q  D   +I Y    I    V++P+P ST  Y DPM  +R    R ++R  +P W+ +VR +RL    C+ +K K +  +  +  + F VE GG VYK   G+LR   +     Y+ FVR H
Sbjct:  227 DICRVCFDLVDLDCARIILKTSKSSQTTDP--YIYYKMRGIIGSSVYVPVPLSTYFYKDPMTDIRLQSHRQLLRGVEPEWMTEVRRKRL----CRPKKVKADPRYPGSLVSSFIVEQGGYVYKACTGLLRAKLIHGFPLYDEFVRTH 367          
BLAST of SMED30022465 vs. Planmine SMEST
Match: SMESG000068142.1 (SMESG000068142.1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 365/427 (85.48%), Postives = 373/427 (87.35%), Query Frame = 2
Query:   47 RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFXXXXXXXXXXXXXVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITAKYKKDLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPYYNEITNRRVFIPIPRSTVDYTDPMEKLRRRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAHQRKLVAKKWEKIRFYEESSNMVPDWDFELHEQ 1327
            RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFPPPIGKIIIPYKGVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITA              N+    +  +V              Y   + + R+   I +S  +         RRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAHQRKLVAKKWEKIRFYEESSNMVPDWDFELHEQ
Sbjct:    7 RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFPPPIGKIIIPYKGVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITA--------------NLLFSKLAERVK-------------YLMTVVSYRI---IMKSQTE--------ERRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAHQRKLVAKKWEKIRFYEESSNMVPDWDFELHEQ 395          

HSP 2 Score: 59.6918 bits (143), Expect = 2.224e-9
Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 3
Query:  852 SLLFSKLAERVKYLMTVVSYRIIMKSQTEE 941
            +LLFSKLAERVKYLMTVVSYRIIMKSQTEE
Sbjct:  257 NLLFSKLAERVKYLMTVVSYRIIMKSQTEE 286          
BLAST of SMED30022465 vs. Planmine SMEST
Match: SMESG000068142.1 (SMESG000068142.1)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 356/411 (86.62%), Postives = 361/411 (87.83%), Query Frame = 2
Query:   47 RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFXXXXXXXXXXXXXVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITAKYKKDLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPYYNEITNRRVFIPIPRSTVDYTDPMEKLRRRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAHQRKLVAKKWEKIRFYE 1279
            RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFPPPIGKIIIPYKGVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITA              N+    +  +V     V      + Y+                  YTDPMEKLRRRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAHQRKLVAKKWEKIRFYE
Sbjct:    7 RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFPPPIGKIIIPYKGVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITA--------------NLLFSKLAERVKYLMTV------VSYH------------------YTDPMEKLRRRGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAHQRKLVAKKWEKIRFYE 379          
BLAST of SMED30022465 vs. Planmine SMEST
Match: SMESG000068142.1 (SMESG000068142.1)

HSP 1 Score: 483.411 bits (1243), Expect = 3.543e-171
Identity = 250/250 (100.00%), Postives = 250/250 (100.00%), Query Frame = 2
Query:   47 RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFXXXXXXXXXXXXXVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITA 796
            RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFPPPIGKIIIPYKGVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITA
Sbjct:    7 RKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNYFSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFPPPIGKIIIPYKGVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNNLLNQAIITA 256          

HSP 2 Score: 78.1814 bits (191), Expect = 8.058e-16
Identity = 38/39 (97.44%), Postives = 39/39 (100.00%), Query Frame = 3
Query:  852 SLLFSKLAERVKYLMTVVSYRIIMKSQTEEYSFQFLDQL 968
            +LLFSKLAERVKYLMTVVSYRIIMKSQTEEYSFQFLDQL
Sbjct:  257 NLLFSKLAERVKYLMTVVSYRIIMKSQTEEYSFQFLDQL 295          
BLAST of SMED30022465 vs. Planmine SMEST
Match: SMESG000016196.1 (SMESG000016196.1)

HSP 1 Score: 130.954 bits (328), Expect = 7.569e-33
Identity = 98/356 (27.53%), Postives = 171/356 (48.03%), Query Frame = 2
Query:  281 SCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFFYL-IKGRNKTGCVTGINDLSPINIY-RDPKKNGKKKLEQDQSIGALIHFXXXXXXXXXXXXXVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNN--LLNQAIITAKYKKDLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPYYNEITNRRVFIPIPRSTVDYTDPMEKLRR---RGIVRKYDPPWLKKVRLERLKRTFCKIEKFKKNEN----HNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETFVRAHQRKLVAKKWEKIRFYEESSNMVPDWDFE 1315
            S ++C D    V+ I F   + +IFP+    R   DF+NDK+  + N   +   F   S++  I  +F+++  K + K   + GI    P+ +Y +     GK K     ++     +P   G+I + +  +   +  ++  L+S++   +        +N  NN    + A I  +YK D+++FKF +  V IQ +    SR CQV D   +IPY ++I NRRV + +P +   Y DPM  + R      + K +P W+ ++R  R  +T    E F    N     + +T   ++  G VYK++  +L V  + + S YE F +  Q++++ K+  K+       N+VPDWD E
Sbjct:  165 SSIYCTDGKNIVYNISFYATDARIFPLHLEKRKGADFKNDKEIQSENHFFYKTKFFINSSKFIILKKFYFIPSKYKRKFDRLKGIT--PPVKVYFKTDSYKGKSKKVIRNNVSGQNKYPTTSGEIFLLWDNINIKVKAEMFKLESVKQNWM--------LNTKNNGKCKSSAQIITRYKNDILEFKFHLSQVQIQEITPHTSRGCQVRDSQAYIPYISDINNRRVILALPFTQYFYKDPMTDIFRCNWINALNKREPRWVTELRHLRQNKTVN--EDFNAMMNKILEQHHSTEIQIDLVGTVYKLKGNMLVVKKISSDSTYEMFAQERQKQILIKETGKLDSSRLLVNLVPDWDLE 508          
BLAST of SMED30022465 vs. Planmine SMEST
Match: SMESG000068369.1 (SMESG000068369.1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.835e-18
Identity = 78/336 (23.21%), Postives = 157/336 (46.73%), Query Frame = 2
Query:  275 EVSCVHCKDSTQRVFQILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLWITNRFF---YLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGALIHFXXXXXXXXX--XXXXVLFHLNCKLLHLDSIRSRLLDHVVNRYPIN----DTNNLLNQAIITAKYKKDLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPYYNEITNRRVFIPIPRSTVDYTDPMEKLRRRGIVRKY---DPPWLKKVRLERLK--RTFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVN-TVQNSSKYETFVRAHQR 1237
            EVS +  +++  ++F++ F   N  I P+    R+  + + DK+    ++ +++E +     R   T + F   +L +GR           +S +++ +   K  +K++   + +  +      + K ++    + + F  + K++ +D  +  L D   N + I+      +   N+  I A YK D+++F F + ++  Q V    SR+CQ  DD+ +I  Y+ +T+R + +P+PR   DY DPM  ++RR    K+   +P WL   R  RL   +   +++  +K       +    E  G + K R G++    + ++  KYE +V   QR
Sbjct:  102 EVSSIFIRNNQNKMFKLTFRAINGNIIPLYTKERNFVEKDTDKKVQPYSKSRYVEEYTPHLIRFNTTRKDFEVNHLKEGR-----------VSVMSMKQKIGKRMRKEIPLSKPLPGVSASKTNLQKPVLYIRVQNINFKFSPKIMTMDFTKP-LTDLHSNNFLIDLGLETVDQRKNKGSIIASYKGDILKFTFSLVDINYQLVPVSTSRSCQAVDDNIYIRTYSSVTSRIIQVPLPRKIYDYKDPMVDIKRRNEFFKHNKIEPKWLSDTRKSRLAANKQCQQVDPAQKAYEATNGSMILYEGHGTLNKAREGLISCKVSSEDLEKYERWVVNSQR 425          
The following BLAST results are available for this feature:
BLAST of SMED30022465 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SF892.524e-1433.55Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0R3WQV64.550e-1331.35Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3U4A61.945e-1231.93Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3W9S62.083e-1233.11Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
U6JCA35.051e-1131.97Uncharacterized protein OS=Echinococcus granulosus... [more]
back to top
BLAST of SMED30022465 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022465 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068142.12.224e-985.48SMESG000068142.1[more]
SMESG000068142.10.000e+086.62SMESG000068142.1[more]
SMESG000068142.13.543e-171100.00SMESG000068142.1[more]
SMESG000016196.17.569e-3327.53SMESG000016196.1[more]
SMESG000068369.11.835e-1823.21SMESG000068369.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022465 ID=SMED30022465|Name=SMED30022465|organism=Schmidtea mediterranea sexual|type=transcript|length=1418bp
AAAAAAATAAAAATAATTTATGTTTTGTATGAAATCTCATAAAAGCCGAA
AAAGAGTATATTTCCATTCGAGTAGTATTTATTCAAAAGTTCGTCGGATC
CTTGACATTCCGGGAAAATTAAAGAGAAAATTCAGTCAATCAAAGCTTTC
TATAAATTTGAATAATTATTTCAGCACGACCAATCGTTCCAACAGTGATT
TTGGGATAGCTGAAGGCGAAAACTTACACCGACCTCCTGGACCGATTGTT
TGCTCGAAGGAAGAAAAACATATAGAGGTCAGTTGTGTACACTGCAAAGA
TTCTACTCAACGTGTTTTTCAAATTCTTTTCACGATATGCAATGTGAAGA
TCTTTCCGGTAAGTTTCGCTACTCGGGACATCACTGATTTTGAAAATGAC
AAACAGACTTATACCCTTAATCGAATTAAATTTATAGAATTGTTTAATTT
TAAAAGTAATCGTCTTTGGATAACAAACCGATTCTTTTATTTGATCAAGG
GACGTAACAAAACAGGCTGCGTTACCGGGATTAATGATTTAAGTCCAATT
AATATCTATCGAGACCCAAAGAAAAATGGCAAAAAGAAATTAGAGCAAGA
TCAATCGATAGGTGCACTGATTCACTTTCCACCCCCCATTGGTAAGATCA
TTATACCATACAAAGGGGTGCTATTTCACCTGAACTGTAAACTTTTGCAC
TTGGATTCAATTAGAAGTCGTCTACTCGACCATGTAGTCAACCGATATCC
AATTAACGATACGAATAATCTATTAAATCAAGCAATAATTACAGCAAAGT
ACAAAAAAGATTTAATCCAATTTAAATTTGACATGTGTAACGTAACCATT
CAGCCTGTTGTTTTCAAAGTTAGCCGAGCGTGTCAAGTATTTGATGACAG
TCGTTTCATACCGTATTATAATGAAATCACAAACCGAAGAGTATTCATTC
CAATTCCTCGATCAACTGTAGACTATACGGATCCAATGGAAAAACTCAGA
CGTCGTGGTATAGTAAGGAAATACGATCCACCTTGGCTAAAAAAGGTCCG
ACTTGAAAGACTTAAACGGACTTTTTGTAAAATAGAAAAATTCAAGAAAA
ATGAAAACCACAATCCTACAACATATTTTTCTGTGGAAAATGGAGGAATT
GTTTATAAAGTCAGGGCGGGAATATTAAGAGTCAACACTGTACAAAATTC
CAGTAAATATGAAACATTTGTCAGGGCCCATCAGAGAAAGCTTGTGGCTA
AGAAATGGGAAAAAATTCGATTTTATGAAGAAAGTTCTAACATGGTGCCA
GATTGGGACTTCGAACTCCACGAGCAGTAAAATAAAAATTATGTTTTTTA
TAAAAGCTATAAAATCGTGATGAAAATTACATTAAGGTAGTATAAGAATA
TAACAGCACTCTTAGTAT
back to top

protein sequence of SMED30022465-orf-1

>SMED30022465-orf-1 ID=SMED30022465-orf-1|Name=SMED30022465-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=437bp
MFCMKSHKSRKRVYFHSSSIYSKVRRILDIPGKLKRKFSQSKLSINLNNY
FSTTNRSNSDFGIAEGENLHRPPGPIVCSKEEKHIEVSCVHCKDSTQRVF
QILFTICNVKIFPVSFATRDITDFENDKQTYTLNRIKFIELFNFKSNRLW
ITNRFFYLIKGRNKTGCVTGINDLSPINIYRDPKKNGKKKLEQDQSIGAL
IHFPPPIGKIIIPYKGVLFHLNCKLLHLDSIRSRLLDHVVNRYPINDTNN
LLNQAIITAKYKKDLIQFKFDMCNVTIQPVVFKVSRACQVFDDSRFIPYY
NEITNRRVFIPIPRSTVDYTDPMEKLRRRGIVRKYDPPWLKKVRLERLKR
TFCKIEKFKKNENHNPTTYFSVENGGIVYKVRAGILRVNTVQNSSKYETF
VRAHQRKLVAKKWEKIRFYEESSNMVPDWDFELHEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium