Disintegrin and metalloproteinase domain-containing protein 15

Overview
NameDisintegrin and metalloproteinase domain-containing protein 15
Smed IDSMED30022458
Length (bp)3738
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Disintegrin and metalloproteinase domain-containing protein 15 (SMED30022458) t-SNE clustered cells

Violin plots show distribution of expression levels for Disintegrin and metalloproteinase domain-containing protein 15 (SMED30022458) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Disintegrin and metalloproteinase domain-containing protein 15 (SMED30022458) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Disintegrin and metalloproteinase domain-containing protein 15 (SMED30022458) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022458

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022458SMESG000076089.1 Contig2176GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30022458SMESG000076089.1 SMESG000056400.1 dd_Smed_v4_5143_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022458SMESG000076089.1 SMESG000056400.1 dd_Smed_v4_5143_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022458SMESG000076089.1 SMESG000056400.1 dd_Smed_v4_5143_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022458SMESG000076089.1 SMESG000056400.1 dd_Smed_v4_5143_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30022458SMESG000076089.1 SMESG000056400.1 dd_Smed_v4_5143_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30022458SMESG000076089.1 SMESG000056400.1 dd_Smed_v4_5143_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022458SMESG000076089.1 SMESG000056400.1 Contig40005newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022458SMESG000076089.1 SMESG000056400.1 Contig40005uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM9 (ADAM metallopeptidase domain 9 [Source:HGNC Symbol;Acc:HGNC:216])

HSP 1 Score: 226.098 bits (575), Expect = 1.748e-61
Identity = 154/514 (29.96%), Postives = 240/514 (46.69%), Query Frame = 1
Query:  748 MPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIK--LTDENHILMELQLYKRRFI--NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEID-ISHAVLHEIGHNFGLHHDTEQ---CKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQN---RCNCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            +P    VEL+I+VD +   M G  N   +   +  + N ++  +   NI   ++ LEIW    +   +     +L     ++ +F+   +RHD    +L +  G    G + + ++C  +   G   + + Q  ++  +  V HE+GHN G++HD  +   C    CIM +G    S S N+S+CS  + + L  +   +CLL+                   P+  E+     CGN +VD GE+CDCG  K+CE +   CC   TC     A CA G CC  + C     GT+CR    E CD+PEYCNG S++C  DV+ Q+G  C N      ++CY G C     +CQ ++G  A+ +   C+ ++N +GD   NCG                  K C+   ++CG+L C +  E  +      +      G  C  V F L   + D GMV  G  CG+G+IC   +CV  + +  +   +  CH HG CN+  NCHC  G++ PNC T
Sbjct:  208 LPQTRYVELFIVVDKERYDMMG-RNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFG-GTAGMAFVGTVCSRSHAGGI--NVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGNCLLN------------------IPKPDEAYSAPSCGNKLVDAGEECDCGTPKECELDP--CCEGSTCKLKSFAECAYGDCC--KDCRFLPGGTLCRGKTSE-CDVPEYCNGSSQFCQPDVFIQNGYPCQNN----KAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGF------------SGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCET 675          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM9 (ADAM metallopeptidase domain 9 [Source:HGNC Symbol;Acc:HGNC:216])

HSP 1 Score: 228.024 bits (580), Expect = 1.843e-61
Identity = 154/514 (29.96%), Postives = 240/514 (46.69%), Query Frame = 1
Query:  748 MPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIK--LTDENHILMELQLYKRRFI--NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEID-ISHAVLHEIGHNFGLHHDTEQ---CKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQN---RCNCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            +P    VEL+I+VD +   M G  N   +   +  + N ++  +   NI   ++ LEIW    +   +     +L     ++ +F+   +RHD    +L +  G    G + + ++C  +   G   + + Q  ++  +  V HE+GHN G++HD  +   C    CIM +G    S S N+S+CS  + + L  +   +CLL+                   P+  E+     CGN +VD GE+CDCG  K+CE +   CC   TC     A CA G CC  + C     GT+CR    E CD+PEYCNG S++C  DV+ Q+G  C N      ++CY G C     +CQ ++G  A+ +   C+ ++N +GD   NCG                  K C+   ++CG+L C +  E  +      +      G  C  V F L   + D GMV  G  CG+G+IC   +CV  + +  +   +  CH HG CN+  NCHC  G++ PNC T
Sbjct:  208 LPQTRYVELFIVVDKERYDMMG-RNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFG-GTAGMAFVGTVCSRSHAGGI--NVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGNCLLN------------------IPKPDEAYSAPSCGNKLVDAGEECDCGTPKECELDP--CCEGSTCKLKSFAECAYGDCC--KDCRFLPGGTLCRGKTSE-CDVPEYCNGSSQFCQPDVFIQNGYPCQNN----KAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGF------------SGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCET 675          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM19 (ADAM metallopeptidase domain 19 [Source:HGNC Symbol;Acc:HGNC:197])

HSP 1 Score: 226.868 bits (577), Expect = 1.731e-60
Identity = 184/703 (26.17%), Postives = 311/703 (44.24%), Query Frame = 1
Query:  220 WLRLNSINNPKYSLWLHLELKKQNQFPILVR---KNENKV----DWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDEN--HILMELQLYKRRFI-NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY-----GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV-NG--YHCSAVRF----DLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN--CHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            W R +   +PK    L +   K ++ P+  +   K E +V      +  D + ++ L++ +     Y++  +  TTT ++E    +   + + +    +  ++S C GI G+  + ++  Y+     +    +  Q L        PP              DW     Q++K+    M  +++     VELY++ D  +       + +    ++  I N ++  +   NI   ++ LE+W    +    EN    L     ++R+ +  K HD    I G +      G + + +MC   +  G   D+ S+N I ++  + HE+GHNFG+ HD+  C        GCIMA       F   ++ C++ E+   L+SG   CL + P + M                       +CGNG ++ GE+CD     + E  +N CCN   C    GA CA GSCC   +C L   GT+CR  +   CDLPE+C G+S  CP++ Y+ DG  C     G  ++CY G C + + +CQ+LWG  A  + D+C++ +N  GD   NCG ++           N   + C+   + CG++ C+    R L  +   ++  I+ NG    C         + +  + D G+V  G  CG   IC++ +C   +  E   C   C+ HG CNN  NCHC PG++ P C T
Sbjct:   30 WTRGSEEGSPKLQHELIIPQWKTSESPVREKHPLKAELRVMAEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRETE---LSSVTLSTCRGIRGLITVSSNLSYVI----EPLPDSKGQHLIYRSEHLKPPPGNCGFEHSKPTTRDWALQFTQQTKKRPRRMKREDLNSMKYVELYLVAD-YLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLWSFLSWRRKLLAQKYHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDH-SENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAATGH-PFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGG------------------RRCGNGYLEDGEECD---CGEEEECNNPCCNASNCTLRPGAECAHGSCC--HQCKLLAPGTLCRE-QARQCDLPEFCTGKSPHCPTNFYQMDGTPCE----GGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDM-----------NGEHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLVMTGTKCGYNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNT 683          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM19 (ADAM metallopeptidase domain 19 [Source:HGNC Symbol;Acc:HGNC:197])

HSP 1 Score: 226.868 bits (577), Expect = 2.327e-60
Identity = 184/703 (26.17%), Postives = 311/703 (44.24%), Query Frame = 1
Query:  220 WLRLNSINNPKYSLWLHLELKKQNQFPILVR---KNENKV----DWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDEN--HILMELQLYKRRFI-NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY-----GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV-NG--YHCSAVRF----DLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN--CHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            W R +   +PK    L +   K ++ P+  +   K E +V      +  D + ++ L++ +     Y++  +  TTT ++E    +   + + +    +  ++S C GI G+  + ++  Y+     +    +  Q L        PP              DW     Q++K+    M  +++     VELY++ D  +       + +    ++  I N ++  +   NI   ++ LE+W    +    EN    L     ++R+ +  K HD    I G +      G + + +MC   +  G   D+ S+N I ++  + HE+GHNFG+ HD+  C        GCIMA       F   ++ C++ E+   L+SG   CL + P + M                       +CGNG ++ GE+CD     + E  +N CCN   C    GA CA GSCC   +C L   GT+CR  +   CDLPE+C G+S  CP++ Y+ DG  C     G  ++CY G C + + +CQ+LWG  A  + D+C++ +N  GD   NCG ++           N   + C+   + CG++ C+    R L  +   ++  I+ NG    C         + +  + D G+V  G  CG   IC++ +C   +  E   C   C+ HG CNN  NCHC PG++ P C T
Sbjct:   30 WTRGSEEGSPKLQHELIIPQWKTSESPVREKHPLKAELRVMAEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRETE---LSSVTLSTCRGIRGLITVSSNLSYVI----EPLPDSKGQHLIYRSEHLKPPPGNCGFEHSKPTTRDWALQFTQQTKKRPRRMKREDLNSMKYVELYLVADY-LEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLWSFLSWRRKLLAQKYHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDH-SENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAAT-GHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGG------------------RRCGNGYLEDGEECD---CGEEEECNNPCCNASNCTLRPGAECAHGSCC--HQCKLLAPGTLCRE-QARQCDLPEFCTGKSPHCPTNFYQMDGTPCE----GGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDM-----------NGEHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLVMTGTKCGYNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNT 683          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Match: ADAM33 (ADAM metallopeptidase domain 33 [Source:HGNC Symbol;Acc:HGNC:15478])

HSP 1 Score: 222.631 bits (566), Expect = 1.166e-59
Identity = 152/511 (29.75%), Postives = 230/511 (45.01%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLT-DENHILMELQLYKRRFINKR-HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDM-NKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEI-VNGYH--CSAVRFDLDWYLD--DFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +ELYI+ D  +  +    N N+   R+  + N ++      +I   +  LE+W ERD+ ++T D N  L     ++R    +R HD    + G     A  G + +  MC      G + D+ S+  I  +  + HEIGH+ GL HD + C      +  GC+MA       F   +S CS+ ++++  + G   CL + P   +                   + P+ CGNG V+ GE+CDCG  ++C    + CC    C    GA CA G CC   RC LK +G +CR   +  CDLPE+C G S  CP DVY  DG  C+        +C+ G C +   +CQ+LWG  +  + + C+ + N  GD   NCG           Q    +  PC+   ++CG+L C+     +L      ++  + ++G    C          LD    G+V  G  CG   +C    C      E  RC   CH HG CN+  NCHC PG++ P C
Sbjct:  212 LELYIVADHTLF-LTRHRNLNHTKQRLLEVANYVDQLLRTLDIQVALTGLEVWTERDRSRVTQDANATLWAFLQWRRGLWAQRPHDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDH-SELPIGAAATMAHEIGHSLGLSHDPDGCCVEAAAESGGCVMAAATGH-PFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGL------------------PVPPALCGNGFVEAGEECDCGPGQECR---DLCCFAHNCSLRPGAQCAHGDCC--VRCLLKPAGALCRQA-MGDCDLPEFCTGTSSHCPPDVYLLDGSPCARG----SGYCWDGACPTLEQQCQQLWGPGSHPAPEACFQVVNSAGDAHGNCG-----------QDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQELQRCLTACHSHGVCNSNHNCHCAPGWAPPFC 680          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: adm-2 (ADAM (Disintegrin plus metalloprotease) family [Source:UniProtKB/TrEMBL;Acc:G5EDW5])

HSP 1 Score: 213.001 bits (541), Expect = 2.561e-56
Identity = 159/517 (30.75%), Postives = 224/517 (43.33%), Query Frame = 1
Query:  763 LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWER-DQIK-LTDENHILMELQLYKRRFINKRH-DCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQ-----CKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVL---RLSEQFLNDEIVNGYHCSAVRFDLDWY-------LDDFGMVPNGVSCGSGRICWKSECVLVNSIEQ--NRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
             VEL ++ D  +   +  D    +   +   MN +N  +   NI  T++  EIW++ DQI  + D    L     YK+  +     D  + +          G++   +MC Y+   G   D+ + + ++      HE+GH FG+ HD        C    CIM    +SG     WS CS   + S    G+  CL +EP            +P+ A          KCGNG+V+ GE+CDCG  K C+   N CCN  TC     A CA G CCDL+ C  K   T+CR   +  CDL EYCNGE+  CP+D + Q+   C  K   E   CY G C SR  +C KLWG T +  ++ CY  N  G    NCG                  K C  E + CG L C  + ER +     S  F +  + +       +F   +          D G+VP+G  CG  ++C   +C     I +   +C  NC+  G CNN GNCHC  GF    C
Sbjct:  178 FVELALVADYSVYTKYDSDE-KKVNDYMQQTMNILNSLYFPLNIRITLVHSEIWKKGDQISVIPDSKETLNNFMEYKKIMLKDHFFDTGYLMTTLKFDEGVVGKAYKGTMCSYDYSGGIYVDH-NNDTVETVATFAHELGHTFGMDHDPNDKDVCYCPMPRCIMNP--QSGHMEV-WSECSVKNLASGFNRGIDLCLFNEP----------GKKPSDA----------KCGNGIVEPGEECDCGPLK-CD---NHCCNGSTCKLIGEAECASGDCCDLKTCKPKPRATVCR-AAIGICDLDEYCNGETNDCPADFFVQNAALCPGK---ENEFCYEGGCGSRNDQCAKLWGPTGKNGDENCYRKNTEGTFHGNCGTNA----------HTKEIKKCETENAKCGLLQCETQAERPVFGDPGSVTFSHSTVYSSLKRDDKKFCYVFKSAYGGLNAPDPGLVPDGAICGEEQMCIGQKCHKKEKISKVTAQCLDNCNFRGVCNNVGNCHCERGFGGIAC 651          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: adm-2 (ADAM (Disintegrin plus metalloprotease) family [Source:UniProtKB/TrEMBL;Acc:G5EDW5])

HSP 1 Score: 212.616 bits (540), Expect = 2.911e-56
Identity = 159/517 (30.75%), Postives = 224/517 (43.33%), Query Frame = 1
Query:  763 LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWER-DQIK-LTDENHILMELQLYKRRFINKRH-DCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQ-----CKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVL---RLSEQFLNDEIVNGYHCSAVRFDLDWY-------LDDFGMVPNGVSCGSGRICWKSECVLVNSIEQ--NRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
             VEL ++ D  +   +  D    +   +   MN +N  +   NI  T++  EIW++ DQI  + D    L     YK+  +     D  + +          G++   +MC Y+   G   D+ + + ++      HE+GH FG+ HD        C    CIM    +SG     WS CS   + S    G+  CL +EP            +P+ A          KCGNG+V+ GE+CDCG  K C+   N CCN  TC     A CA G CCDL+ C  K   T+CR   +  CDL EYCNGE+  CP+D + Q+   C  K   E   CY G C SR  +C KLWG T +  ++ CY  N  G    NCG                  K C  E + CG L C  + ER +     S  F +  + +       +F   +          D G+VP+G  CG  ++C   +C     I +   +C  NC+  G CNN GNCHC  GF    C
Sbjct:  178 FVELALVADYSVYTKYDSDE-KKVNDYMQQTMNILNSLYFPLNIRITLVHSEIWKKGDQISVIPDSKETLNNFMEYKKIMLKDHFFDTGYLMTTLKFDEGVVGKAYKGTMCSYDYSGGIYVDH-NNDTVETVATFAHELGHTFGMDHDPNDKDVCYCPMPRCIMNP--QSGHMEV-WSECSVKNLASGFNRGIDLCLFNEP----------GKKPSDA----------KCGNGIVEPGEECDCGPLK-CD---NHCCNGSTCKLIGEAECASGDCCDLKTCKPKPRATVCR-AAIGICDLDEYCNGETNDCPADFFVQNAALCPGK---ENEFCYEGGCGSRNDQCAKLWGPTGKNGDENCYRKNTEGTFHGNCGTNA----------HTKEIKKCETENAKCGLLQCETQAERPVFGDPGSVTFSHSTVYSSLKRDDKKFCYVFKSAYGGLNAPDPGLVPDGAICGEEQMCIGQKCHKKEKISKVTAQCLDNCNFRGVCNNVGNCHCERGFGGIAC 651          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: unc-71 (Disintegrin and metalloproteinase domain-containing protein unc-71 [Source:UniProtKB/Swiss-Prot;Acc:G5EFD5])

HSP 1 Score: 166.007 bits (419), Expect = 2.752e-41
Identity = 146/525 (27.81%), Postives = 214/525 (40.76%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQF----NIYFTVIQLEIWERDQ-IKL-TDENHILMELQLYKRRFI-NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCV---GYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYG---CIM------ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGG-SCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYH---CSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--------NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            VE+ +I D +     G  + +     IS+++  +N+A S      NI  + + +E+W   Q I L  D    L  +  Y    I + + D        +        + + S+C     V   G  +     N       +   IGH  GL HDT  C C     C+M        G     FS+ +S CS   +  + + G   CLL++P                     +     +CGNGVVD  E+CDCG R+ C+   + CC+P TC     A CA    CC   RC L+K+G  CR+ +   CD+ E C+G+S  CP D +  DG  C     G    C+RG C+    +CQKLWG  A V+  VC++ N +G   ANCG    R+AD           PC  E + CG L C   +   +  S +          H   C ++           G+  +G +C SGR+C    CV ++S+              C  HG C     C C  G+S   C
Sbjct:  229 VEVALIADYEFMKARGLHDLDA----ISYMLESLNIADSMLSRDLNIRLSAVYVELWTDVQRIDLWEDIERTLSGVVDYASGHIYHIQKDASILFTAGSFANQEVSNAAIRSICTARSAVIVKGVEQFATHWN----GELLAQSIGHLLGLEHDTTACSCEPSPECVMRQQPGRVGGGGGSPFSWQFSKCSVARMHGIWQDGNIQCLLNKP--------------------FQVSELRECGNGVVDGSEECDCGSRENCQ---DPCCDPLTCTLRPHAQCAAHHKCC--HRCELRKAGDTCRSSK-SPCDVAEQCDGKSGDCPPDGHLIDGTVC-----GTDGQCWRGNCSDSHQQCQKLWGREARVAEPVCFEQNTKGAEYANCG---QRQAD-------GTYHPCQIEDTRCGTLHCHSGSITPIDSSLKAFTFHFTENSHQIQCKSIASAA------VGLTSDGTNCASGRVCVAGSCVEMSSVSSATACPTNNLALLCSGHGHCTTTARCVCFNGWSGVAC 698          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: sup-17 (Disintegrin and metalloproteinase domain-containing protein 10 homolog [Source:UniProtKB/Swiss-Prot;Acc:G5EFD9])

HSP 1 Score: 71.2478 bits (173), Expect = 4.596e-12
Identity = 71/226 (31.42%), Postives = 95/226 (42.04%), Query Frame = 1
Query: 1153 AVLHEIGHNFGLHHD-TEQCKCY----GCIMATGIESGSFSFN--WSNCSKHEIKSLL----KSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCG-GRKQCEAESNKCC---------NPETCLFTVGASCAG--GSCCDLQRCSL--KKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKC 1755
             + HEIGHNFG  HD   +C+        IM     SG    N  +S CS   I ++L    KS   D   +  P  +GK N             +    + CGN + + GE+CDCG  +  C+   +KCC          P  C    GA C+   G CC+   CSL  K    ICR  E E  +L + C+G +  CP    K DGI C +        C  G+C
Sbjct:  423 TLAHEIGHNFGSPHDFPAECQPGLPDGNFIMFASATSGDKPNNGKFSPCSVKNISAVLAVVLKSMPVDPTRNASPVGIGKRNC-----------FQERTSAFCGNQIYEPGEECDCGFSQADCDQMGDKCCVPHEARGNGGPGPCKRKPGAQCSPSQGYCCNPDTCSLHGKNEEKICRQ-ESECSNL-QTCDGRNAQCPVSPPKHDGIPCQDST----KVCSSGQC 631          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Match: adt-1 (A disintegrin and metalloproteinase with thrombospondin motifs adt-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECS8])

HSP 1 Score: 52.373 bits (124), Expect = 2.702e-6
Identity = 53/244 (21.72%), Postives = 96/244 (39.34%), Query Frame = 1
Query:  721 SAFHMPVKEMPGPYLVELYIIVDSKMAAMFG----GDNYNNLFSRISFIMNQINLAFSQ----FNIYFTVIQLEIWERDQIKLTDENHI-----------------------LMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKC-YGCIMATGIESGSFSFNWSNCSKHEIKSLL----KSGMADCLLDEPP 1344
            S+F  P  +   P  +E+ + +DSK+   F      D   +L      ++N +++ + Q     N+   +++ E+W      L+   H                        L ++  Y    +   +D  H        T+  G + +A MC         +  +    +  S  + HE+GHN G+ HD  Q +C  GC + + + +G+    WS+CS  E  + L    +SG  +CL D  P
Sbjct:  223 SSFIFPNMD---PITLEIGLFLDSKLFEHFEREYIQDAEQHLLEFSLALINNVHVLYQQDTLTPNLDIVIVRYEMWRTQPSALSTGVHKNGQAQSLLDAFCRYQAHMNPGTDLTDMNHYDHGVLLTGYDIYHTT------TSVAGVAPVARMCDPLFACSLVEGLH----LGRSFVLAHEMGHNMGMVHDGVQNQCNKGCCLMSAV-NGAGKTTWSDCSVREFNAFLLQLDESGRGNCLRDASP 452          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: Meltrin (gene:FBgn0265140 transcript:FBtr0301499)

HSP 1 Score: 256.144 bits (653), Expect = 2.633e-70
Identity = 182/556 (32.73%), Postives = 267/556 (48.02%), Query Frame = 1
Query:  691 KFSRHQRSKRSAFHMPVKEMPGPY-------LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDENHILMELQLYKRRFINKR---------HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYG--CIMATGIESGSF-SFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLF-TVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERV-------LRLSEQFLNDE--IVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC------NCHEHGDCNNRGNCHCHPGFSAPNCT 2250
            +FSR    KR       + + GPY        VEL I+VD+K+   F  +N   +      I N IN  +   NI+  ++ + IW E ++I+ + +  + +      R F+N R         +D    +  EN      G++    +C Y    G +  + S N   ++  + HE+GHNFG+ HDT  C C    C+MA    S SF   NWS+CS  ++      GM  CL ++P                  R  ES     CGNG V+ GEQCDCG  + CE   N CCN +TC+  +  A+CA G CCDL  C  K +G+ CR  E E CDLPEYC GESE+CP+DV+++D   C     G  ++C+ G C S  ++C+ LWG T + S + CY+ N  G  + NCG         +R  K +    C ++   CG L C H NER+         LS  +++ +  IV    C     DL     D G+ PNG  CG  ++C    C+ V+++ Q         +C+ +G CN+RG+CHC  GF   +C+
Sbjct:  238 EFSRTLLRKRRQADDSSQLIRGPYNANKYSSYVELVIVVDNKVYKNFQ-ENTKKVHQYCKGIANIINALYVPLNIFVALVGVVIWNESNEIEFSSDGDLTL------RNFLNYRSTKLVLDHPNDNAQLLTKENFAGGVVGKALKGPICTYEYSGGVSMQH-SPNPAMVATTMAHEMGHNFGMEHDTSDCHCRDEKCVMAA--SSTSFIPVNWSSCSIDQLTIAFSRGMNYCLRNKPE-----------------RLFES---PTCGNGFVEPGEQCDCGLPEHCE---NACCNAQTCMLHSKNATCATGECCDLTTCRPKLAGSACREAENE-CDLPEYCTGESEYCPADVFRRDTEPCD----GGQAYCFHGTCRSHSNQCRTLWGPTGDNS-EHCYNKNTEGTRLGNCGY--------NRLNKTF--LRCEEQHVNCGMLHCIHLNERLEFGMESAAVLSHSYISHDRKIVA---CRTALVDLGLQTTDPGLTPNGAKCGVDKMCVDQRCLPVDAVRQKGMGKPCPEDCNGNGICNSRGHCHCDVGFGGESCS 741          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: Meltrin (gene:FBgn0265140 transcript:FBtr0301498)

HSP 1 Score: 258.84 bits (660), Expect = 5.247e-70
Identity = 182/556 (32.73%), Postives = 267/556 (48.02%), Query Frame = 1
Query:  691 KFSRHQRSKRSAFHMPVKEMPGPY-------LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDENHILMELQLYKRRFINKR---------HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYG--CIMATGIESGSF-SFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLF-TVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERV-------LRLSEQFLNDE--IVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC------NCHEHGDCNNRGNCHCHPGFSAPNCT 2250
            +FSR    KR       + + GPY        VEL I+VD+K+   F  +N   +      I N IN  +   NI+  ++ + IW E ++I+ + +  + +      R F+N R         +D    +  EN      G++    +C Y    G +  + S N   ++  + HE+GHNFG+ HDT  C C    C+MA    S SF   NWS+CS  ++      GM  CL ++P                  R  ES     CGNG V+ GEQCDCG  + CE   N CCN +TC+  +  A+CA G CCDL  C  K +G+ CR  E E CDLPEYC GESE+CP+DV+++D   C     G  ++C+ G C S  ++C+ LWG T + S + CY+ N  G  + NCG         +R  K +    C ++   CG L C H NER+         LS  +++ +  IV    C     DL     D G+ PNG  CG  ++C    C+ V+++ Q         +C+ +G CN+RG+CHC  GF   +C+
Sbjct:  238 EFSRTLLRKRRQADDSSQLIRGPYNANKYSSYVELVIVVDNKVYKNFQ-ENTKKVHQYCKGIANIINALYVPLNIFVALVGVVIWNESNEIEFSSDGDLTL------RNFLNYRSTKLVLDHPNDNAQLLTKENFAGGVVGKALKGPICTYEYSGGVSMQH-SPNPAMVATTMAHEMGHNFGMEHDTSDCHCRDEKCVMAA--SSTSFIPVNWSSCSIDQLTIAFSRGMNYCLRNKPE-----------------RLFES---PTCGNGFVEPGEQCDCGLPEHCE---NACCNAQTCMLHSKNATCATGECCDLTTCRPKLAGSACREAENE-CDLPEYCTGESEYCPADVFRRDTEPCD----GGQAYCFHGTCRSHSNQCRTLWGPTGDNS-EHCYNKNTEGTRLGNCGY--------NRLNKTFLR--CEEQHVNCGMLHCIHLNERLEFGMESAAVLSHSYISHDRKIV---ACRTALVDLGLQTTDPGLTPNGAKCGVDKMCVDQRCLPVDAVRQKGMGKPCPEDCNGNGICNSRGHCHCDVGFGGESCS 741          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: mmd (gene:FBgn0259110 transcript:FBtr0299534)

HSP 1 Score: 202.601 bits (514), Expect = 2.567e-53
Identity = 157/565 (27.79%), Postives = 244/565 (43.19%), Query Frame = 1
Query:  676 NAADWKFSRHQRSKRSAFHMPVKEM-------------PGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLY----KRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDT--EQCKC---YGCIMATGI--ESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRH-ENERVLRLSEQFLNDEIVN----GYHCSAVRFDLDW-YLDDFGMVPNGVSCGSGRICWKSECV-LVNSIEQNRC-------NCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            N   W+ SR  +   +     V+E+                  +E  IIVD  M     G     +      + N  +L F   N   +V+ +E W ++Q  +     I   +  +     R       D    + GE       G +   ++C   R VG + D        ++  + H IGHN G+ HD   E+C C   +GCIMA  I  +     + +S CSK +    L++G   CLL++P       N + +  N             CGN VV++ E+CDCG  ++C  +  +CC+  TC     A CA G+CCD  +C L+    ICR+   E CDLPEYC+GE   CPSDV+K++G  C    TG   +C++G C +   +C+ +WG     ++  CY+  N +G +  +CG    R+A       N +   C  E   CG L C+  E + V    +Q  +  I++     + C A    +      + G+V +G  CG   IC    CV L   ++Q +C        C EHG C N   C C  G+   +C++
Sbjct:  229 NLDSWRLSRRTKHLSAGVAGVVEEILQAGVGRNKRDVREATKYIETAIIVDKAMFDKRNGSTRAEVIHDAIQVANIADLYFRTLNTRVSVVYIETWGKNQAVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGMAVPETVC-TPRAVGISVDVNVYEPHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLCLLNKP-------NEIELRRN-------------CGNKVVEEDEECDCGTFEECALD--QCCDGITCKLKSEAQCASGACCD--QCRLRPKDYICRDSNNE-CDLPEYCDGEIGQCPSDVFKKNGSPCGLSKTGISGYCFQGYCPTLSLQCEAIWGYGGSAADRQCYEQFNSKGSINGHCG----RDA-------NEHYIKCEPENVQCGTLQCKDGERQPVNDGIDQLYSRTIISIKGQEFECKATSGQVGSNSYPEHGLVKDGTPCGDNLICLNQTCVSLFPHVDQTKCPANSQGLECSEHGVCTNTNRCFCDMGWGGNDCSS 756          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: mmd (gene:FBgn0259110 transcript:FBtr0340310)

HSP 1 Score: 204.912 bits (520), Expect = 5.241e-53
Identity = 151/522 (28.93%), Postives = 233/522 (44.64%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLY----KRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDT--EQCKC---YGCIMATGI--ESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRH-ENERVLRLSEQFLNDEIVN----GYHCSAVRFDLDW-YLDDFGMVPNGVSCGSGRICWKSECV-LVNSIEQNRC-------NCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            +E  IIVD  M     G     +      + N  +L F   N   +V+ +E W ++Q  +     I   +  +     R       D    + GE       G +   ++C   R VG + D        ++  + H IGHN G+ HD   E+C C   +GCIMA  I  +     + +S CSK +    L++G   CLL++P       N + +  N             CGN VV++ E+CDCG  ++C  +  +CC+  TC     A CA G+CCD  +C L+    ICR+   E CDLPEYC+GE   CPSDV+K++G  C    TG   +C++G C +   +C+ +WG     ++  CY+  N +G +  +CG    R+A       N +   C  E   CG L C+  E + V    +Q  +  I++     + C A    +      + G+V +G  CG   IC    CV L   ++Q +C        C EHG C N   C C  G+   +C++
Sbjct:  272 IETAIIVDKAMFDKRNGSTRAEVIHDAIQVANIADLYFRTLNTRVSVVYIETWGKNQAVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGMAVPETVC-TPRAVGISVDVNVYEPHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLCLLNKP-------NEIELRRN-------------CGNKVVEEDEECDCGTFEECALD--QCCDGITCKLKSEAQCASGACCD--QCRLRPKDYICRDSNNE-CDLPEYCDGEIGQCPSDVFKKNGSPCGLSKTGISGYCFQGYCPTLSLQCEAIWGYGGSAADRQCYEQFNSKGSINGHCG----RDA-------NEHYIKCEPENVQCGTLQCKDGERQPVNDGIDQLYSRTIISIKGQEFECKATSGQVGSNSYPEHGLVKDGTPCGDNLICLNQTCVSLFPHVDQTKCPANSQGLECSEHGVCTNTNRCFCDMGWGGNDCSS 756          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Match: mmd (gene:FBgn0259110 transcript:FBtr0310306)

HSP 1 Score: 204.912 bits (520), Expect = 5.501e-53
Identity = 151/522 (28.93%), Postives = 233/522 (44.64%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLY----KRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDT--EQCKC---YGCIMATGI--ESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRH-ENERVLRLSEQFLNDEIVN----GYHCSAVRFDLDW-YLDDFGMVPNGVSCGSGRICWKSECV-LVNSIEQNRC-------NCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            +E  IIVD  M     G     +      + N  +L F   N   +V+ +E W ++Q  +     I   +  +     R       D    + GE       G +   ++C   R VG + D        ++  + H IGHN G+ HD   E+C C   +GCIMA  I  +     + +S CSK +    L++G   CLL++P       N + +  N             CGN VV++ E+CDCG  ++C  +  +CC+  TC     A CA G+CCD  +C L+    ICR+   E CDLPEYC+GE   CPSDV+K++G  C    TG   +C++G C +   +C+ +WG     ++  CY+  N +G +  +CG    R+A       N +   C  E   CG L C+  E + V    +Q  +  I++     + C A    +      + G+V +G  CG   IC    CV L   ++Q +C        C EHG C N   C C  G+   +C++
Sbjct:  272 IETAIIVDKAMFDKRNGSTRAEVIHDAIQVANIADLYFRTLNTRVSVVYIETWGKNQAVIDGSKDISKAISNFNDYTSRNLFQIERDTTQLLTGETFAGGEAGMAVPETVC-TPRAVGISVDVNVYEPHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLCLLNKP-------NEIELRRN-------------CGNKVVEEDEECDCGTFEECALD--QCCDGITCKLKSEAQCASGACCD--QCRLRPKDYICRDSNNE-CDLPEYCDGEIGQCPSDVFKKNGSPCGLSKTGISGYCFQGYCPTLSLQCEAIWGYGGSAADRQCYEQFNSKGSINGHCG----RDA-------NEHYIKCEPENVQCGTLQCKDGERQPVNDGIDQLYSRTIISIKGQEFECKATSGQVGSNSYPEHGLVKDGTPCGDNLICLNQTCVSLFPHVDQTKCPANSQGLECSEHGVCTNTNRCFCDMGWGGNDCSS 756          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam8a (ADAM metallopeptidase domain 8a [Source:ZFIN;Acc:ZDB-GENE-030616-622])

HSP 1 Score: 247.669 bits (631), Expect = 4.827e-68
Identity = 163/508 (32.09%), Postives = 248/508 (48.82%), Query Frame = 1
Query:  754 GPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDENHILMELQLYKRR---FINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY---GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWY-LDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN--CHEHGDCNNRGNCHCHPGFSAPNC 2247
            G  +VE+ ++VD+     FG  ++  +  R+  + N ++  +   NI   ++ LE+W +RD I ++   ++ +E  L  RR      K+HD  H I G +   +  G + + +MC  +      +D+ S N I ++  V HE+GHN G+ HD   C C    GCIM   I S  +  ++S CS+  +K+ L++   +CL+D P  N G++        G P          CGN  V+KGE+CDCG  ++C   +N CCN  TC  T GA CA G CC    C LK +G++CR      CDL EYC GES +CP D YK +G+ C+        +CY G+C + +  C+ LWG  A+V +D C+  N                   DR  K       S E   CGR++C   N       +  +N +    Y        LD    +D GMVP G  CG+ ++C+KS C+ ++      C+  C+  G CN+   CHC PG++ P C
Sbjct:  195 GQQIVEMVLVVDNTEYKKFG--SFKKIEERMMLVANHVDKLYRPLNIRVMLVGLEVWSQRDLIDVSSRPNLTLERFLKWRRDSLLQRKKHDNAHFITGIDFEGSTVGLATLYAMCSSSSSGAVNEDHNS-NPIAVASTVAHEMGHNLGMSHDDSSCGCSSNKGCIMGDTIGS-IYPDSFSTCSQSSLKAFLENYDTNCLIDVP--NEGQIY-------GGP---------VCGNAFVEKGEECDCGTVEEC---NNPCCNATTCRLTEGARCAHGECC--HNCQLKHTGSLCRK-SAHDCDLDEYCTGESAFCPEDDYKMNGLPCNY----NQGYCYNGQCPTHKEHCKMLWGSGADVDDDACFQYNV-----------------IDRTSK-------SAEHRKCGRIYCYGGNPFPKTNKKANVNVQSRTCY------MALDSSPTEDLGMVPTGTKCGTNKVCYKSLCLDISMYGTENCSNKCNNRGVCNHELKCHCDPGWAPPYC 640          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:ZFIN;Acc:ZDB-GENE-070809-4])

HSP 1 Score: 238.039 bits (606), Expect = 4.907e-65
Identity = 164/517 (31.72%), Postives = 255/517 (49.32%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDENHILME--LQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY--------GCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-PSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAG-GSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLS-EQFLNDEIV---NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSEC--VLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL ++ D K    +  +N   ++ R+  + NQ++  +   N+   ++ LEIW ++D+IK+       +   L    R  + + RHD    I+GE+      G +  +SMC  +R  G   D+   + + ++  V HE+GHN G+ HDT   +C+        GCIM  +TG   G     +S+CS+ ++   L  G   CL + P P ++           G PR         CGN  V+KGE+CDCG   +C   ++ CCN  TC    GA C+  G CC  + C L+ +G++CR   L  CDLPE+C G S +CP +V+ Q+G  C     G  S+CY G CAS   +CQ LWG  +  +  +C+  +NK+G+   NCG           Q  N +  PC K    CGR+ C+   ER L  S  + L   ++   + + C    F+L   + D  MV  G +CG  + C   +C  V +  +++ R  CH HG CN+  NCHC  G++ P+C
Sbjct:  204 IELVLVADHKEYLNYQKNNKTIIY-RMLDVANQVDWFYRPLNVRVALLGLEIWSDQDKIKVDKSPTETLNRFLDWRTRELLPRLRHDNAQLIMGESFDGTTVGMASQSSMCSKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTADRRCHCQNEPRLGGCIMEPSTGFMPGQL---FSSCSERDLSLSLLHGGGMCLFNVPQPESL----------LGGPR---------CGNLYVEKGEECDCGLLDEC---NDPCCNASTCKLVPGAQCSSDGICC--ENCKLRVAGSVCRE-PLGECDLPEHCTGSSPYCPPNVFLQNGEPCK----GGSSYCYSGVCASLDDQCQMLWGQNSTRAPPICFSSVNKQGNKYGNCG-----------QMPNGSYIPCLKWDVHCGRIQCQGGGERPLLGSNAEILTTTVILNQSDFTCRGTYFNLGDDVSDPAMVLQGTACGPNKACVDQKCRDVSMFGVDECRSKCHGHGVCNSNKNCHCDEGWAPPDC 675          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:ZFIN;Acc:ZDB-GENE-070809-4])

HSP 1 Score: 240.736 bits (613), Expect = 5.380e-65
Identity = 164/517 (31.72%), Postives = 255/517 (49.32%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDENHILME--LQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY--------GCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-PSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAG-GSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLS-EQFLNDEIV---NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSEC--VLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL ++ D K    +  +N   ++ R+  + NQ++  +   N+   ++ LEIW ++D+IK+       +   L    R  + + RHD    I+GE+      G +  +SMC  +R  G   D+   + + ++  V HE+GHN G+ HDT   +C+        GCIM  +TG   G     +S+CS+ ++   L  G   CL + P P ++           G PR         CGN  V+KGE+CDCG   +C   ++ CCN  TC    GA C+  G CC  + C L+ +G++CR   L  CDLPE+C G S +CP +V+ Q+G  C     G  S+CY G CAS   +CQ LWG  +  +  +C+  +NK+G+   NCG           Q  N +  PC K    CGR+ C+   ER L  S  + L   ++   + + C    F+L   + D  MV  G +CG  + C   +C  V +  +++ R  CH HG CN+  NCHC  G++ P+C
Sbjct:  251 IELVLVADHKEYLNYQKNNKTIIY-RMLDVANQVDWFYRPLNVRVALLGLEIWSDQDKIKVDKSPTETLNRFLDWRTRELLPRLRHDNAQLIMGESFDGTTVGMASQSSMCSKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTADRRCHCQNEPRLGGCIMEPSTGFMPGQL---FSSCSERDLSLSLLHGGGMCLFNVPQPESL----------LGGPR---------CGNLYVEKGEECDCGLLDEC---NDPCCNASTCKLVPGAQCSSDGICC--ENCKLRVAGSVCRE-PLGECDLPEHCTGSSPYCPPNVFLQNGEPCK----GGSSYCYSGVCASLDDQCQMLWGQNSTRAPPICFSSVNKQGNKYGNCG-----------QMPNGSYIPCLKWDVHCGRIQCQGGGERPLLGSNAEILTTTVILNQSDFTCRGTYFNLGDDVSDPAMVLQGTACGPNKACVDQKCRDVSMFGVDECRSKCHGHGVCNSNKNCHCDEGWAPPDC 722          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: adam8b (ADAM metallopeptidase domain 8b [Source:ZFIN;Acc:ZDB-GENE-070808-1])

HSP 1 Score: 235.343 bits (599), Expect = 5.288e-64
Identity = 151/516 (29.26%), Postives = 252/516 (48.84%), Query Frame = 1
Query:  739 VKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLT-DENHILMELQLYKRRFINKR--HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYG------CIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVN---SIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +K    P  VEL+++VD+     FG  + +++ +R+  ++N ++  +   NI   ++ LE+W ++DQI ++   +  L     +++  + KR  HD    + G +      G +   +MC  +   G  +D+ +QN + ++  + HE+GHN G+ HD + C C        CIM   + +  F   +S+CS  ++   L +    CLLD P S       V                  CGN  +D GE+CDCG  ++C+   N CC+P TC  T G+ CA G CC  + C +K + ++CR   +  CD+PEYC G SE CP + ++ +GI CS+       +CY G+C +    CQ+LWG  A+V+ D C+  N  G   ++CG    +  D          +PC++E   CG+++C   NE  +   +  +   +     C+      +   D   MVP G  CG  ++C+  +C  +N   SIE     C+  G CN++  CHC PG++ P C
Sbjct:  196 MKSFQTPRFVELFLVVDNTEYRNFG-SSMDSIRARMLEVVNHVDKLYRSLNIRVMLVGLEVWMKQDQIVVSVSSDDTLSRFIEWRKSNLLKRVKHDNAQFVTGIDFLGDTVGLANKFAMCAESS-AGVNQDH-NQNPLGLASTIAHEMGHNMGMSHDEDHCTCGSSVISSFCIMTERVGT-LFPEQFSDCSLEQLTVFLDNANPSCLLDTPSSYKLYSGPV------------------CGNAFLDPGEECDCGSVEECK---NPCCDPMTCKLTEGSRCAQGDCC--ENCQIKDAESLCR-ASINECDVPEYCTGLSEKCPENDFRMNGIPCSSG----QGYCYNGQCPTHLQHCQRLWGTGAKVAPDTCFYQNTLGKNDSHCG----KTKD--------GIRPCARENMFCGKIFCNEGNEFPVTGQKAVI---VTLRGQCNVAGDQTEE--DALSMVPTGTKCGHNKVCYDYKCQELNIYGSIEGCSLQCNGRGICNHKKQCHCDPGWAPPYC 662          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Match: zgc:174164 (zgc:174164 [Source:ZFIN;Acc:ZDB-GENE-030131-4971])

HSP 1 Score: 225.328 bits (573), Expect = 7.552e-61
Identity = 162/534 (30.34%), Postives = 257/534 (48.13%), Query Frame = 1
Query:  703 HQR-SKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDEN--HILMELQLYKRRFINK--RHDCLHAILGEN------LGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDI-SHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNG-YHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNR-C----NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            H R +  S F    + +P    VEL ++VD K   +    + N +   +  + N ++  F Q NI   +I L+I++       + N   +L     +++  ++   R+D    ++G+       LG A  G    AS  G           +S N +   S    HE+GHN G+ HD+  C C  CIMA    S S S  +S+CS +  + L++ G   CL + P                A  +I S+   +CGNG+++ GE+CDCG  ++C   +  CCN  TC FT G++CA GSCC  Q+C +  +GT CR   +  CDLPEYC GES +CPSD Y  DG+ C+N      ++C+ G+C +  ++C++++G  A  ++D C+ ++N  G+   NCG                  KPCS + ++CG+L C   N     L       +I  G   C    F++   + D   V  G  C  G++C    C   + ++Q+R C    +C  +G CN+R +CHC+ G+  PNC
Sbjct:  183 HSRYADMSMFLRKKRTLPQTKYVELALVVDQKRF-IIKNRSVNAVRDEMVQLANLLDTYFKQLNIRIALIGLKIFDTGNPFSVEGNAGDVLGRFVDWRKTTLSPQIRNDAAQLVVGQGAYPGGVLGMAFVGSVCSASTSG-------AISVFSDNNLQYYSTVAAHELGHNLGMSHDSNGCSCQ-CIMA---PSASGSTKFSDCSDNAFERLIQGGGGACLRNIP----------------AQDSIISV--PRCGNGILESGEECDCGTPQEC---NTTCCNAATCTFTKGSTCAAGSCC--QKCQIIVAGTPCRP-SINPCDLPEYCGGESPYCPSDFYMMDGLPCNNNA----AYCFEGRCQTFDYQCKQIFGSGATKADDKCFTNVNTYGNAFGNCGYS------------GTFPKPCSVQNAMCGKLQCLF-NSNNPPLGATVSVQKIEGGTITCMNADFNMGPDVPDPAYVKTGSVCAPGKLCANFTCFNSSVMDQSRKCDAQRDCSSNGVCNDRYHCHCNNGWGPPNC 663          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:NCBI gene;Acc:677728])

HSP 1 Score: 260.381 bits (664), Expect = 8.902e-72
Identity = 175/510 (34.31%), Postives = 255/510 (50.00%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDE-NHILMELQLYKRRFIN-KRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSE-QFLNDEIVNGY--HCSAVR-FDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL+I+ D  M  M    N  +   R+  I N ++  +   NI   +I LE+W ERDQ  + D+ N  L     +K++  + K+HD    I G        G + +  MC      G + D+ S+N I  +  + HEIGHNFG+ HD + C      +  GCIMA       F   +S CS+ ++ S  + G   CL + P +N                  + +M  KCGNG +++GEQCDCG  ++C   +N CCN   C    GA CA G CC  Q C LK +GT CR +   SCDLPE+C G++ +CPS+VY  DG SC+    GE ++CY G C + + +C  LWG  A V+ D C+ D+NK GD   NCG     +  R +  K      C+   + CG++ C+  +E+    S  +  N  I+NGY   C  V  + +     D G+V  G  CG G +C    C   +  E ++C   C+ HG CN+  NCHCH G++ P C
Sbjct:  208 MELFIVADYSMF-MKQNRNLGSTKQRVLEIANYVDKFYMSMNIKVALIGLEVWTERDQCDVNDDANDSLRSFLQWKQKLRSRKKHDNAQLITGVTFKGTTIGMAPLEGMCTAENSGGVSMDH-SENAIGAAATMAHEIGHNFGMSHDNDGCCVEATPEQGGCIMAASTGH-PFPRKFSRCSQQQLMSYFRKGGGMCLFNMPNTN------------------DLVMGKKCGNGFLEEGEQCDCGEPEEC---TNPCCNANNCTLKAGAKCAHGECC--QDCRLKSAGTQCREMA-GSCDLPEFCTGDAPFCPSNVYMLDGSSCA---FGE-AYCYNGMCLTHQQQCIHLWGSGAVVAPDFCFQDVNKAGDQYGNCG-----KNGRGQFVK------CTSRDAKCGKIQCQTSSEKPRDPSMVKVDNTIIINGYKMKCQGVHAYSMQEEEGDPGLVMTGTKCGDGMVCKDRRCQNASFFELDQCVSKCNGHGVCNSNRNCHCHSGWAPPYC 675          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:NCBI gene;Acc:677728])

HSP 1 Score: 260.381 bits (664), Expect = 9.381e-72
Identity = 175/510 (34.31%), Postives = 255/510 (50.00%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDE-NHILMELQLYKRRFIN-KRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSE-QFLNDEIVNGY--HCSAVR-FDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL+I+ D  M  M    N  +   R+  I N ++  +   NI   +I LE+W ERDQ  + D+ N  L     +K++  + K+HD    I G        G + +  MC      G + D+ S+N I  +  + HEIGHNFG+ HD + C      +  GCIMA       F   +S CS+ ++ S  + G   CL + P +N                  + +M  KCGNG +++GEQCDCG  ++C   +N CCN   C    GA CA G CC  Q C LK +GT CR +   SCDLPE+C G++ +CPS+VY  DG SC+    GE ++CY G C + + +C  LWG  A V+ D C+ D+NK GD   NCG     +  R +  K      C+   + CG++ C+  +E+    S  +  N  I+NGY   C  V  + +     D G+V  G  CG G +C    C   +  E ++C   C+ HG CN+  NCHCH G++ P C
Sbjct:  206 MELFIVADYSMF-MKQNRNLGSTKQRVLEIANYVDKFYMSMNIKVALIGLEVWTERDQCDVNDDANDSLRSFLQWKQKLRSRKKHDNAQLITGVTFKGTTIGMAPLEGMCTAENSGGVSMDH-SENAIGAAATMAHEIGHNFGMSHDNDGCCVEATPEQGGCIMAASTGH-PFPRKFSRCSQQQLMSYFRKGGGMCLFNMPNTN------------------DLVMGKKCGNGFLEEGEQCDCGEPEEC---TNPCCNANNCTLKAGAKCAHGECC--QDCRLKSAGTQCREMA-GSCDLPEFCTGDAPFCPSNVYMLDGSSCA---FGE-AYCYNGMCLTHQQQCIHLWGSGAVVAPDFCFQDVNKAGDQYGNCG-----KNGRGQFVK------CTSRDAKCGKIQCQTSSEKPRDPSMVKVDNTIIINGYKMKCQGVHAYSMQEEEGDPGLVMTGTKCGDGMVCKDRRCQNASFFELDQCVSKCNGHGVCNSNRNCHCHSGWAPPYC 673          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:NCBI gene;Acc:677728])

HSP 1 Score: 251.906 bits (642), Expect = 1.474e-70
Identity = 174/515 (33.79%), Postives = 255/515 (49.51%), Query Frame = 1
Query:  751 PGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDE-NHILMELQLYKRRFIN-KRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSE-QFLNDEIVNGY--HCSAVR-FDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            PG + V L  +  ++   M    N  +   R+  I N ++  +   NI   +I LE+W ERDQ  + D+ N  L     +K++  + K+HD    I G        G + +  MC      G + D+ S+N I  +  + HEIGHNFG+ HD + C      +  GCIMA       F   +S CS+ ++ S  + G   CL + P +N                  + +M  KCGNG +++GEQCDCG  ++C   +N CCN   C    GA CA G CC  Q C LK +GT CR +   SCDLPE+C G++ +CPS+VY  DG SC+    GE ++CY G C + + +C  LWG  A V+ D C+ D+NK GD   NCG     +  R +  K      C+   + CG++ C+  +E+    S  +  N  I+NGY   C  V  + +     D G+V  G  CG G +C    C   +  E ++C   C+ HG CN+  NCHCH G++ P C
Sbjct:  163 PGHHRVSLEWLTATQF--MKQNRNLGSTKQRVLEIANYVDKFYMSMNIKVALIGLEVWTERDQCDVNDDANDSLRSFLQWKQKLRSRKKHDNAQLITGVTFKGTTIGMAPLEGMCTAENSGGVSMDH-SENAIGAAATMAHEIGHNFGMSHDNDGCCVEATPEQGGCIMAASTGH-PFPRKFSRCSQQQLMSYFRKGGGMCLFNMPNTN------------------DLVMGKKCGNGFLEEGEQCDCGEPEEC---TNPCCNANNCTLKAGAKCAHGECC--QDCRLKSAGTQCREMA-GSCDLPEFCTGDAPFCPSNVYMLDGSSCA---FGE-AYCYNGMCLTHQQQCIHLWGSGAVVAPDFCFQDVNKAGDQYGNCG-----KNGRGQFVK------CTSRDAKCGKIQCQTSSEKPRDPSMVKVDNTIIINGYKMKCQGVHAYSMQEEEGDPGLVMTGTKCGDGMVCKDRRCQNASFFELDQCVSKCNGHGVCNSNRNCHCHSGWAPPYC 634          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:NCBI gene;Acc:677728])

HSP 1 Score: 250.366 bits (638), Expect = 3.684e-70
Identity = 169/492 (34.35%), Postives = 246/492 (50.00%), Query Frame = 1
Query:  820 NYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDE-NHILMELQLYKRRFIN-KRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSE-QFLNDEIVNGY--HCSAVR-FDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            N  +   R+  I N ++  +   NI   +I LE+W ERDQ  + D+ N  L     +K++  + K+HD    I G        G + +  MC      G + D+ S+N I  +  + HEIGHNFG+ HD + C      +  GCIMA       F   +S CS+ ++ S  + G   CL + P +N                  + +M  KCGNG +++GEQCDCG  ++C   +N CCN   C    GA CA G CC  Q C LK +GT CR +   SCDLPE+C G++ +CPS+VY  DG SC+    GE ++CY G C + + +C  LWG  A V+ D C+ D+NK GD   NCG     +  R +  K      C+   + CG++ C+  +E+    S  +  N  I+NGY   C  V  + +     D G+V  G  CG G +C    C   +  E ++C   C+ HG CN+  NCHCH G++ P C
Sbjct:  173 NLGSTKQRVLEIANYVDKFYMSMNIKVALIGLEVWTERDQCDVNDDANDSLRSFLQWKQKLRSRKKHDNAQLITGVTFKGTTIGMAPLEGMCTAENSGGVSMDH-SENAIGAAATMAHEIGHNFGMSHDNDGCCVEATPEQGGCIMAASTGH-PFPRKFSRCSQQQLMSYFRKGGGMCLFNMPNTN------------------DLVMGKKCGNGFLEEGEQCDCGEPEEC---TNPCCNANNCTLKAGAKCAHGECC--QDCRLKSAGTQCREMA-GSCDLPEFCTGDAPFCPSNVYMLDGSSCA---FGE-AYCYNGMCLTHQQQCIHLWGSGAVVAPDFCFQDVNKAGDQYGNCG-----KNGRGQFVK------CTSRDAKCGKIQCQTSSEKPRDPSMVKVDNTIIINGYKMKCQGVHAYSMQEEEGDPGLVMTGTKCGDGMVCKDRRCQNASFFELDQCVSKCNGHGVCNSNRNCHCHSGWAPPYC 623          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:NCBI gene;Acc:677728])

HSP 1 Score: 248.054 bits (632), Expect = 6.852e-70
Identity = 168/485 (34.64%), Postives = 244/485 (50.31%), Query Frame = 1
Query:  841 RISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDE-NHILMELQLYKRRFIN-KRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSE-QFLNDEIVNGY--HCSAVR-FDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            R+  I N ++  +   NI   +I LE+W ERDQ  + D+ N  L     +K++  + K+HD    I G        G + +  MC      G + D+ S+N I  +  + HEIGHNFG+ HD + C      +  GCIMA       F   +S CS+ ++ S  + G   CL + P +N                  + +M  KCGNG +++GEQCDCG  ++C   +N CCN   C    GA CA G CC  Q C LK +GT CR +   SCDLPE+C G++ +CPS+VY  DG SC+    GE ++CY G C + + +C  LWG  A V+ D C+ D+NK GD   NCG     +  R +  K      C+   + CG++ C+  +E+    S  +  N  I+NGY   C  V  + +     D G+V  G  CG G +C    C   +  E ++C   C+ HG CN+  NCHCH G++ P C
Sbjct:  119 RVLEIANYVDKFYMSMNIKVALIGLEVWTERDQCDVNDDANDSLRSFLQWKQKLRSRKKHDNAQLITGVTFKGTTIGMAPLEGMCTAENSGGVSMDH-SENAIGAAATMAHEIGHNFGMSHDNDGCCVEATPEQGGCIMAASTGH-PFPRKFSRCSQQQLMSYFRKGGGMCLFNMPNTN------------------DLVMGKKCGNGFLEEGEQCDCGEPEEC---TNPCCNANNCTLKAGAKCAHGECC--QDCRLKSAGTQCREMA-GSCDLPEFCTGDAPFCPSNVYMLDGSSCA---FGE-AYCYNGMCLTHQQQCIHLWGSGAVVAPDFCFQDVNKAGDQYGNCG-----KNGRGQFVK------CTSRDAKCGKIQCQTSSEKPRDPSMVKVDNTIIINGYKMKCQGVHAYSMQEEEGDPGLVMTGTKCGDGMVCKDRRCQNASFFELDQCVSKCNGHGVCNSNRNCHCHSGWAPPYC 562          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam33 (a disintegrin and metallopeptidase domain 33 [Source:MGI Symbol;Acc:MGI:1341813])

HSP 1 Score: 230.72 bits (587), Expect = 1.526e-62
Identity = 188/697 (26.97%), Postives = 295/697 (42.32%), Query Frame = 1
Query:  259 LWLHLELKKQNQFP--ILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMP-------------GPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLT-DENHILMELQLYKRRFINKR-HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV---NGYHCSAVRFDLDWYLD--DFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            LWL + L++    P  +LV       D +    + HK L    +    Y  +   +  +       ++   +    E   +   +S C+G+SG+  L +   Y Y   +   +T +             P       +QL+    W+    QR K S +   +  +P              P  +ELYI+ D  +  +    N N+   R+  + N ++      +I   +  LE+W E+D  ++T D N  L     ++R    +R HD    + G        G + +  +C      G + D+ S+  I  +  + HEIGH+ GLHHD E C      +  GC+M  ATG     F   +S CS+ ++++  + G   CL     SN      +             ++PS+CGNG ++ GE+CDCG  ++C    + CC    C    GA CA G CC   RC LK +GT CR    + CDLPE+C G S +CP+DVY  DG  C+        +C  G C +   +CQ+LWG  ++ + + C+  MN  G+   NCG           Q    +  PC++  ++CG+L C+      L      ++  I+       C       D +LD  D G+V  G  CG   +C    C    S E  RC   CH  G CN+  NCHC  G++ P C
Sbjct:   51 LWLKVTLEEPILKPDSVLVALEAEGQDLLLELEKKHKLLAPGYTE-THYRPDGHPVVLSPNHTDHCQYHGRVRGFRE---SWVVLSTCSGMSGLIVLSSKVSY-YLQPRTPGDTKDF------------PTHEIFRMEQLFT---WRGV--QRDKNSQYKAGMASLPHVPQSRVRREARRSPRYLELYIVADHTLF-LLQHQNLNHTRQRLLEVANCVDQILRTLDIQLVLTGLEVWTEQDLSRITQDANETLWAFLQWRRGVWARRPHDSTQLLTGRTFQGTTVGLAPVEGICRAESSGGVSTDH-SELPIGTAATMAHEIGHSLGLHHDPEGCCVQADAEQGGCVMEAATG---HPFPRVFSACSRRQLRTFFRKGGGPCL-----SNTSAPGLL-------------VLPSRCGNGFLEAGEECDCGSGQKC---PDPCCFAHNCSLRAGAQCAHGDCC--ARCLLKSAGTPCRPAATD-CDLPEFCTGTSPYCPADVYLLDGSPCAEG----RGYCLDGWCPTLEQQCQQLWGPGSKPAPEPCFQQMNSMGNSQGNCG-----------QDHKGSFLPCAQRDALCGKLLCQGGEPNPLVPHIVTMDSTILLEGREVVCRGAFVLPDSHLDQLDLGLVEPGTGCGPRMVCQDRHCQNATSQELERCLTACHNGGVCNSNRNCHCAAGWAPPFC 681          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam33 (a disintegrin and metallopeptidase domain 33 [Source:MGI Symbol;Acc:MGI:1341813])

HSP 1 Score: 230.72 bits (587), Expect = 1.526e-62
Identity = 188/697 (26.97%), Postives = 295/697 (42.32%), Query Frame = 1
Query:  259 LWLHLELKKQNQFP--ILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMP-------------GPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLT-DENHILMELQLYKRRFINKR-HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV---NGYHCSAVRFDLDWYLD--DFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            LWL + L++    P  +LV       D +    + HK L    +    Y  +   +  +       ++   +    E   +   +S C+G+SG+  L +   Y Y   +   +T +             P       +QL+    W+    QR K S +   +  +P              P  +ELYI+ D  +  +    N N+   R+  + N ++      +I   +  LE+W E+D  ++T D N  L     ++R    +R HD    + G        G + +  +C      G + D+ S+  I  +  + HEIGH+ GLHHD E C      +  GC+M  ATG     F   +S CS+ ++++  + G   CL     SN      +             ++PS+CGNG ++ GE+CDCG  ++C    + CC    C    GA CA G CC   RC LK +GT CR    + CDLPE+C G S +CP+DVY  DG  C+        +C  G C +   +CQ+LWG  ++ + + C+  MN  G+   NCG           Q    +  PC++  ++CG+L C+      L      ++  I+       C       D +LD  D G+V  G  CG   +C    C    S E  RC   CH  G CN+  NCHC  G++ P C
Sbjct:   51 LWLKVTLEEPILKPDSVLVALEAEGQDLLLELEKKHKLLAPGYTE-THYRPDGHPVVLSPNHTDHCQYHGRVRGFRE---SWVVLSTCSGMSGLIVLSSKVSY-YLQPRTPGDTKDF------------PTHEIFRMEQLFT---WRGV--QRDKNSQYKAGMASLPHVPQSRVRREARRSPRYLELYIVADHTLF-LLQHQNLNHTRQRLLEVANCVDQILRTLDIQLVLTGLEVWTEQDLSRITQDANETLWAFLQWRRGVWARRPHDSTQLLTGRTFQGTTVGLAPVEGICRAESSGGVSTDH-SELPIGTAATMAHEIGHSLGLHHDPEGCCVQADAEQGGCVMEAATG---HPFPRVFSACSRRQLRTFFRKGGGPCL-----SNTSAPGLL-------------VLPSRCGNGFLEAGEECDCGSGQKC---PDPCCFAHNCSLRAGAQCAHGDCC--ARCLLKSAGTPCRPAATD-CDLPEFCTGTSPYCPADVYLLDGSPCAEG----RGYCLDGWCPTLEQQCQQLWGPGSKPAPEPCFQQMNSMGNSQGNCG-----------QDHKGSFLPCAQRDALCGKLLCQGGEPNPLVPHIVTMDSTILLEGREVVCRGAFVLPDSHLDQLDLGLVEPGTGCGPRMVCQDRHCQNATSQELERCLTACHNGGVCNSNRNCHCAAGWAPPFC 681          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam19 (a disintegrin and metallopeptidase domain 19 (meltrin beta) [Source:MGI Symbol;Acc:MGI:105377])

HSP 1 Score: 230.72 bits (587), Expect = 6.568e-62
Identity = 198/702 (28.21%), Postives = 311/702 (44.30%), Query Frame = 1
Query:  220 WLRLNSINNPKYSLWLHLELKKQNQFPIL-VRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISF--IMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDEN--HILMELQLYKRRFI-NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY-----GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEI-VNG--YHCSAVRF-------DLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN--CHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            W    S    K+ L   L +  + +  IL + KNE+      T+T      Y+A+ N           T+T + E    +   + D+DE   +  ++S C GI G+  + ++  YI    +   N+ +   +  SE  ++PP            + DW      ++K+    M  +++     VELY++ D    A F  + ++   ++     I N ++  +   NI   ++ LE+W         EN    L     ++R+ +  K HD    I G +      G + + +MC   +  G + D+ S+N I ++  V HEIGHNFG+ HD+  C        GCIMA       F   +S C++ E+   L++G   CL     SNM             P         +CGNG ++ GE+CD     + E   N CCN   C    GA CA GSCC   +C L   GT CR  ++  CDLPE+C G+S  CP++ Y+ DG  C     G  ++CY G C + + +CQ+LWG  A  + D+C++ +N  GD   NCG  +           N   + CS   + CG++ C+    R L  +   ++  I +NG   HC            + +  + D G+V  G  CG   IC++ +C   +  E   C   C+ HG CNN  NCHC PG+S P C T
Sbjct:   51 WRTSESPGRGKHPLRAELRVMAEGRELILDLEKNEHLFAPAYTET-----CYTASGN---------PQTSTLKSEDHCFYHGTVRDVDE---SSVTLSTCRGIRGLIIVRSNLSYII---EPVPNSDSQHRIYRSEHLTLPPGNC-GFEHSGPTSKDWALQFTHQTKKQPRRMKREDLHSMKYVELYLVAD---YAEFQKNRHDQDATKRKLMEIANYVDKFYRSLNIRIALVGLEVWTHGDKCEVSENPYSTLWSFLSWRRKLLAQKSHDNAQLITGRSFQGTTIGLAPLMAMCSVYQSGGVSMDH-SENAIGVASTVAHEIGHNFGMSHDSAHCCSASAADGGCIMAAATGH-PFPKVFSWCNRKELDRYLQTGGGMCL-----SNM-------------PDTRTLYGGRRCGNGYLEDGEECD---CGEEEECKNPCCNASNCTLKEGAECAHGSCC--HQCKLVAPGTQCRE-QVRQCDLPEFCTGKSPHCPTNYYQMDGTPCE----GGQAYCYNGMCLTYQEQCQQLWGPGARPALDLCFERVNAAGDTYGNCGKGL-----------NGQYRKCSPRDAKCGKIQCQSTQARPLESNAVSIDTTITLNGRRIHCRGTHVYRGPEEEEGEGDMLDPGLVMTGTKCGHNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNKNCHCFPGWSPPFCNT 687          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam9 (a disintegrin and metallopeptidase domain 9 (meltrin gamma) [Source:MGI Symbol;Acc:MGI:105376])

HSP 1 Score: 225.713 bits (574), Expect = 1.552e-60
Identity = 183/674 (27.15%), Postives = 293/674 (43.47%), Query Frame = 1
Query:  337 IQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEH----------HKNHFSVSLCNGISG----------IEKLYNSSKY---IYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTD-ENHILMELQLYKRRFINKR--HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEID-ISHAVLHEIGHNFGLHHDTEQ---CKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQN---RCNCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            IQ   + H       ++L+P  N+F   T     +KE   +S+  ++  H            +  +VS C G+ G          IE L+NSS +    Y     H+      V +         R  +    Q         ++  R +R+        +P    VEL+I+VD +   M G  N   +   +  + N ++  +   NI   ++ LEIW +R+ I +      +L     ++ +F+  R  HD    +L +  G    G + + ++C  +   G   + + Q  ++  +  V HE+GHN G++HD  +   C    CIM +G    S S N+S+CS  + + L  +    CLL+                   P+  E+     CGN +VD GE+CDCG  K+CE +   CC   TC     A CA G CC  + C     G++CR    E CD+PEYCNG S++CP DV+ Q+G  C N      ++CY G C     +CQ ++G  A+ +   C+ ++N +GD   NCG                  K C+   ++CG+L C +  +  +      +      G  C  V F L   + D GMV  G  C +G+IC   +CV  + +  +   +  CH HG CN+  NCHC  G++ P+C T
Sbjct:   70 IQAQGKQHIIHLERNTDLLP--NDFVVYT----YDKEGSLLSDHPNVQSHCHYRGYVEGVQNSAVAVSACFGLRGLLHLENASFGIEPLHNSSHFEHIFYPMDGIHQEPLRCGVSN---------RDTEKEGTQGDEEEHPSVTQLLRRRRAV-------LPQTRYVELFIVVDKERYDMMG-RNQTAVREEMIRLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDSAQLVLKKGFG-GTAGMAFVGTVCSRSHAGGI--NVFGQITVETFASIVAHELGHNLGMNHDDGRECFCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGSCLLN------------------IPKPDEAYSAPSCGNKLVDPGEECDCGTAKECEVD--PCCEGSTCKLKSFAECAYGDCC--KDCQFLPGGSMCRGKTSE-CDVPEYCNGSSQFCPPDVFIQNGYPCQN----SKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCGFS------------GSEYKKCATGNALCGKLQCENVQDMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNKNCHCEDGWAPPHCDT 675          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Match: Adam9 (a disintegrin and metallopeptidase domain 9 (meltrin gamma) [Source:MGI Symbol;Acc:MGI:105376])

HSP 1 Score: 225.328 bits (573), Expect = 1.751e-60
Identity = 183/674 (27.15%), Postives = 293/674 (43.47%), Query Frame = 1
Query:  337 IQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEH----------HKNHFSVSLCNGISG----------IEKLYNSSKY---IYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTD-ENHILMELQLYKRRFINKR--HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEID-ISHAVLHEIGHNFGLHHDTEQ---CKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQN---RCNCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            IQ   + H       ++L+P  N+F   T     +KE   +S+  ++  H            +  +VS C G+ G          IE L+NSS +    Y     H+      V +         R  +    Q         ++  R +R+        +P    VEL+I+VD +   M G  N   +   +  + N ++  +   NI   ++ LEIW +R+ I +      +L     ++ +F+  R  HD    +L +  G    G + + ++C  +   G   + + Q  ++  +  V HE+GHN G++HD  +   C    CIM +G    S S N+S+CS  + + L  +    CLL+                   P+  E+     CGN +VD GE+CDCG  K+CE +   CC   TC     A CA G CC  + C     G++CR    E CD+PEYCNG S++CP DV+ Q+G  C N      ++CY G C     +CQ ++G  A+ +   C+ ++N +GD   NCG                  K C+   ++CG+L C +  +  +      +      G  C  V F L   + D GMV  G  C +G+IC   +CV  + +  +   +  CH HG CN+  NCHC  G++ P+C T
Sbjct:   70 IQAQGKQHIIHLERNTDLLP--NDFVVYT----YDKEGSLLSDHPNVQSHCHYRGYVEGVQNSAVAVSACFGLRGLLHLENASFGIEPLHNSSHFEHIFYPMDGIHQEPLRCGVSN---------RDTEKEGTQGDEEEHPSVTQLLRRRRAV-------LPQTRYVELFIVVDKERYDMMG-RNQTAVREEMIRLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDSAQLVLKKGFG-GTAGMAFVGTVCSRSHAGGI--NVFGQITVETFASIVAHELGHNLGMNHDDGRECFCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGSCLLN------------------IPKPDEAYSAPSCGNKLVDPGEECDCGTAKECEVD--PCCEGSTCKLKSFAECAYGDCC--KDCQFLPGGSMCRGKTSE-CDVPEYCNGSSQFCPPDVFIQNGYPCQN----SKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCGFS------------GSEYKKCATGNALCGKLQCENVQDMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNKNCHCEDGWAPPHCDT 675          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|Q923W9|ADA33_MOUSE (Disintegrin and metalloproteinase domain-containing protein 33 OS=Mus musculus OX=10090 GN=Adam33 PE=1 SV=3)

HSP 1 Score: 230.72 bits (587), Expect = 1.067e-61
Identity = 188/697 (26.97%), Postives = 295/697 (42.32%), Query Frame = 1
Query:  259 LWLHLELKKQNQFP--ILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMP-------------GPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLT-DENHILMELQLYKRRFINKR-HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQC------KCYGCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV---NGYHCSAVRFDLDWYLD--DFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            LWL + L++    P  +LV       D +    + HK L    +    Y  +   +  +       ++   +    E   +   +S C+G+SG+  L +   Y Y   +   +T +             P       +QL+    W+    QR K S +   +  +P              P  +ELYI+ D  +  +    N N+   R+  + N ++      +I   +  LE+W E+D  ++T D N  L     ++R    +R HD    + G        G + +  +C      G + D+ S+  I  +  + HEIGH+ GLHHD E C      +  GC+M  ATG     F   +S CS+ ++++  + G   CL     SN      +             ++PS+CGNG ++ GE+CDCG  ++C    + CC    C    GA CA G CC   RC LK +GT CR    + CDLPE+C G S +CP+DVY  DG  C+        +C  G C +   +CQ+LWG  ++ + + C+  MN  G+   NCG           Q    +  PC++  ++CG+L C+      L      ++  I+       C       D +LD  D G+V  G  CG   +C    C    S E  RC   CH  G CN+  NCHC  G++ P C
Sbjct:   51 LWLKVTLEEPILKPDSVLVALEAEGQDLLLELEKKHKLLAPGYTE-THYRPDGHPVVLSPNHTDHCQYHGRVRGFRE---SWVVLSTCSGMSGLIVLSSKVSY-YLQPRTPGDTKDF------------PTHEIFRMEQLFT---WRGV--QRDKNSQYKAGMASLPHVPQSRVRREARRSPRYLELYIVADHTLF-LLQHQNLNHTRQRLLEVANCVDQILRTLDIQLVLTGLEVWTEQDLSRITQDANETLWAFLQWRRGVWARRPHDSTQLLTGRTFQGTTVGLAPVEGICRAESSGGVSTDH-SELPIGTAATMAHEIGHSLGLHHDPEGCCVQADAEQGGCVMEAATG---HPFPRVFSACSRRQLRTFFRKGGGPCL-----SNTSAPGLL-------------VLPSRCGNGFLEAGEECDCGSGQKC---PDPCCFAHNCSLRAGAQCAHGDCC--ARCLLKSAGTPCRPAATD-CDLPEFCTGTSPYCPADVYLLDGSPCAEG----RGYCLDGWCPTLEQQCQQLWGPGSKPAPEPCFQQMNSMGNSQGNCG-----------QDHKGSFLPCAQRDALCGKLLCQGGEPNPLVPHIVTMDSTILLEGREVVCRGAFVLPDSHLDQLDLGLVEPGTGCGPRMVCQDRHCQNATSQELERCLTACHNGGVCNSNRNCHCAAGWAPPFC 681          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|O35674|ADA19_MOUSE (Disintegrin and metalloproteinase domain-containing protein 19 OS=Mus musculus OX=10090 GN=Adam19 PE=2 SV=2)

HSP 1 Score: 230.72 bits (587), Expect = 4.594e-61
Identity = 198/702 (28.21%), Postives = 311/702 (44.30%), Query Frame = 1
Query:  220 WLRLNSINNPKYSLWLHLELKKQNQFPIL-VRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISF--IMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDEN--HILMELQLYKRRFI-NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY-----GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEI-VNG--YHCSAVRF-------DLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN--CHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            W    S    K+ L   L +  + +  IL + KNE+      T+T      Y+A+ N           T+T + E    +   + D+DE   +  ++S C GI G+  + ++  YI    +   N+ +   +  SE  ++PP            + DW      ++K+    M  +++     VELY++ D    A F  + ++   ++     I N ++  +   NI   ++ LE+W         EN    L     ++R+ +  K HD    I G +      G + + +MC   +  G + D+ S+N I ++  V HEIGHNFG+ HD+  C        GCIMA       F   +S C++ E+   L++G   CL     SNM             P         +CGNG ++ GE+CD     + E   N CCN   C    GA CA GSCC   +C L   GT CR  ++  CDLPE+C G+S  CP++ Y+ DG  C     G  ++CY G C + + +CQ+LWG  A  + D+C++ +N  GD   NCG  +           N   + CS   + CG++ C+    R L  +   ++  I +NG   HC            + +  + D G+V  G  CG   IC++ +C   +  E   C   C+ HG CNN  NCHC PG+S P C T
Sbjct:   51 WRTSESPGRGKHPLRAELRVMAEGRELILDLEKNEHLFAPAYTET-----CYTASGN---------PQTSTLKSEDHCFYHGTVRDVDE---SSVTLSTCRGIRGLIIVRSNLSYII---EPVPNSDSQHRIYRSEHLTLPPGNC-GFEHSGPTSKDWALQFTHQTKKQPRRMKREDLHSMKYVELYLVAD---YAEFQKNRHDQDATKRKLMEIANYVDKFYRSLNIRIALVGLEVWTHGDKCEVSENPYSTLWSFLSWRRKLLAQKSHDNAQLITGRSFQGTTIGLAPLMAMCSVYQSGGVSMDH-SENAIGVASTVAHEIGHNFGMSHDSAHCCSASAADGGCIMAAATGH-PFPKVFSWCNRKELDRYLQTGGGMCL-----SNM-------------PDTRTLYGGRRCGNGYLEDGEECD---CGEEEECKNPCCNASNCTLKEGAECAHGSCC--HQCKLVAPGTQCRE-QVRQCDLPEFCTGKSPHCPTNYYQMDGTPCE----GGQAYCYNGMCLTYQEQCQQLWGPGARPALDLCFERVNAAGDTYGNCGKGL-----------NGQYRKCSPRDAKCGKIQCQSTQARPLESNAVSIDTTITLNGRRIHCRGTHVYRGPEEEEGEGDMLDPGLVMTGTKCGHNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNKNCHCFPGWSPPFCNT 687          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|Q13443|ADAM9_HUMAN (Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 8.851e-61
Identity = 154/514 (29.96%), Postives = 240/514 (46.69%), Query Frame = 1
Query:  748 MPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIK--LTDENHILMELQLYKRRFI--NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEID-ISHAVLHEIGHNFGLHHDTEQ---CKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQN---RCNCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            +P    VEL+I+VD +   M G  N   +   +  + N ++  +   NI   ++ LEIW    +   +     +L     ++ +F+   +RHD    +L +  G    G + + ++C  +   G   + + Q  ++  +  V HE+GHN G++HD  +   C    CIM +G    S S N+S+CS  + + L  +   +CLL+                   P+  E+     CGN +VD GE+CDCG  K+CE +   CC   TC     A CA G CC  + C     GT+CR    E CD+PEYCNG S++C  DV+ Q+G  C N      ++CY G C     +CQ ++G  A+ +   C+ ++N +GD   NCG                  K C+   ++CG+L C +  E  +      +      G  C  V F L   + D GMV  G  CG+G+IC   +CV  + +  +   +  CH HG CN+  NCHC  G++ PNC T
Sbjct:  208 LPQTRYVELFIVVDKERYDMMG-RNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFG-GTAGMAFVGTVCSRSHAGGI--NVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGNCLLN------------------IPKPDEAYSAPSCGNKLVDAGEECDCGTPKECELDP--CCEGSTCKLKSFAECAYGDCC--KDCRFLPGGTLCRGKTSE-CDVPEYCNGSSQFCQPDVFIQNGYPCQNN----KAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGF------------SGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCET 675          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|Q9H013|ADA19_HUMAN (Disintegrin and metalloproteinase domain-containing protein 19 OS=Homo sapiens OX=9606 GN=ADAM19 PE=1 SV=3)

HSP 1 Score: 226.868 bits (577), Expect = 1.117e-59
Identity = 184/703 (26.17%), Postives = 311/703 (44.24%), Query Frame = 1
Query:  220 WLRLNSINNPKYSLWLHLELKKQNQFPILVR---KNENKV----DWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDEN--HILMELQLYKRRFI-NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY-----GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV-NG--YHCSAVRF----DLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN--CHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            W R +   +PK    L +   K ++ P+  +   K E +V      +  D + ++ L++ +     Y++  +  TTT ++E    +   + + +    +  ++S C GI G+  + ++  Y+     +    +  Q L        PP              DW     Q++K+    M  +++     VELY++ D  +       + +    ++  I N ++  +   NI   ++ LE+W    +    EN    L     ++R+ +  K HD    I G +      G + + +MC   +  G   D+ S+N I ++  + HE+GHNFG+ HD+  C        GCIMA       F   ++ C++ E+   L+SG   CL + P + M                       +CGNG ++ GE+CD     + E  +N CCN   C    GA CA GSCC   +C L   GT+CR  +   CDLPE+C G+S  CP++ Y+ DG  C     G  ++CY G C + + +CQ+LWG  A  + D+C++ +N  GD   NCG ++           N   + C+   + CG++ C+    R L  +   ++  I+ NG    C         + +  + D G+V  G  CG   IC++ +C   +  E   C   C+ HG CNN  NCHC PG++ P C T
Sbjct:   30 WTRGSEEGSPKLQHELIIPQWKTSESPVREKHPLKAELRVMAEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRETE---LSSVTLSTCRGIRGLITVSSNLSYVI----EPLPDSKGQHLIYRSEHLKPPPGNCGFEHSKPTTRDWALQFTQQTKKRPRRMKREDLNSMKYVELYLVADY-LEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLWSFLSWRRKLLAQKYHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDH-SENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAAT-GHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGG------------------RRCGNGYLEDGEECD---CGEEEECNNPCCNASNCTLRPGAECAHGSCC--HQCKLLAPGTLCRE-QARQCDLPEFCTGKSPHCPTNFYQMDGTPCE----GGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDM-----------NGEHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLVMTGTKCGYNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNT 683          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Match: sp|Q61072|ADAM9_MOUSE (Disintegrin and metalloproteinase domain-containing protein 9 OS=Mus musculus OX=10090 GN=Adam9 PE=1 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 1.225e-59
Identity = 183/674 (27.15%), Postives = 293/674 (43.47%), Query Frame = 1
Query:  337 IQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEH----------HKNHFSVSLCNGISG----------IEKLYNSSKY---IYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTD-ENHILMELQLYKRRFINKR--HDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEID-ISHAVLHEIGHNFGLHHDTEQ---CKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQN---RCNCHEHGDCNNRGNCHCHPGFSAPNCTT 2253
            IQ   + H       ++L+P  N+F   T     +KE   +S+  ++  H            +  +VS C G+ G          IE L+NSS +    Y     H+      V +         R  +    Q         ++  R +R+        +P    VEL+I+VD +   M G  N   +   +  + N ++  +   NI   ++ LEIW +R+ I +      +L     ++ +F+  R  HD    +L +  G    G + + ++C  +   G   + + Q  ++  +  V HE+GHN G++HD  +   C    CIM +G    S S N+S+CS  + + L  +    CLL+                   P+  E+     CGN +VD GE+CDCG  K+CE +   CC   TC     A CA G CC  + C     G++CR    E CD+PEYCNG S++CP DV+ Q+G  C N      ++CY G C     +CQ ++G  A+ +   C+ ++N +GD   NCG                  K C+   ++CG+L C +  +  +      +      G  C  V F L   + D GMV  G  C +G+IC   +CV  + +  +   +  CH HG CN+  NCHC  G++ P+C T
Sbjct:   70 IQAQGKQHIIHLERNTDLLP--NDFVVYT----YDKEGSLLSDHPNVQSHCHYRGYVEGVQNSAVAVSACFGLRGLLHLENASFGIEPLHNSSHFEHIFYPMDGIHQEPLRCGVSN---------RDTEKEGTQGDEEEHPSVTQLLRRRRAV-------LPQTRYVELFIVVDKERYDMMG-RNQTAVREEMIRLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDSAQLVLKKGFG-GTAGMAFVGTVCSRSHAGGI--NVFGQITVETFASIVAHELGHNLGMNHDDGRECFCGAKSCIMNSG---ASGSRNFSSCSAEDFEKLTLNKGGSCLLN------------------IPKPDEAYSAPSCGNKLVDPGEECDCGTAKECEVD--PCCEGSTCKLKSFAECAYGDCC--KDCQFLPGGSMCRGKTSE-CDVPEYCNGSSQFCPPDVFIQNGYPCQN----SKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCGFS------------GSEYKKCATGNALCGKLQCENVQDMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNKNCHCEDGWAPPHCDT 675          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A0X3NN21 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR151252 PE=4 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 1.767e-112
Identity = 212/570 (37.19%), Postives = 312/570 (54.74%), Query Frame = 1
Query:  727 FHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKL-TDENHILMELQLYKRRFINKRHDCLHAILGENLG--TARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP----------------PSNMGKM-NAVAMEPNGAPRNIESLMP----SKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQ------RCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN------KRGDLVANCGLEIPREADRDRQPKNWNTKPCSK-ETSICGRLWCRHENERVLRL----SEQFLNDEIVNGYHCSAVRFD----------------LDWYL-----DDFGMVPNGVSCGSGRICWKSECVLVNSIEQN-RCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            FH P    P PY++ELY++VD K    + GD    L+ R++ +   +N  F+ FN+   +++LEIW+ D++++  +++H+L  L  +KR   + RHDCLHAI+ +  G  +  RG++    MC ++ CVG+T+D  S    + +  + HE+GH+ GL HDTE+C+C GCIMATG+E G+ + +WS CS  ++  LL+ GM  CL D P                P+++ ++ N   + P   P    +  P    S CGNG +D GE+CDCG  + C   +  CC+   C    GA CA G CC++       +C L+ +G+ CR  E  SCDLPE+C+G SEWCP+DVYK DG  C  +  G  S+C RG C S +  CQ LWGDTA  +   C + N       + D VANCG   P   +R    ++W +K C   E + CGRLWC H NE+ + L    S+Q ++ +  +G  C A+ +D                  W        D GMVP+G  C  G +C+   CV ++SI     C+C+ HG CNN GNCHC+PGF+ P+C
Sbjct:   98 FHQP--NHPAPYIIELYVVVDEKFVKSYRGDVVGILY-RVNTLFKHVNALFAPFNVRVVLVRLEIWKTDRVRMDVEDHHLLKTLANFKRTLTDVRHDCLHAIVADEGGQMSTMRGKASKEKMCTFSSCVGFTRDAPSMYPKETARTIAHELGHSLGLRHDTEECECQGCIMATGVEVGTTTMDWSLCSLRDLPVLLEHGMGSCLHDTPLDGHTSLLHASTTGAQPASVVRVFNGDQLRPGKVPEPRSTTPPQITESLCGNGKLDPGEECDCGTSETCPNATRACCDVYRCRLINGAECATGPCCEVTSTARGYQCRLRSAGSTCRP-ETGSCDLPEFCDGNSEWCPADVYKIDGEPCYTE-HGYKSYCVRGGCRSSQDWCQTLWGDTATHAGYGCTEYNIQLSKDGKADDVANCGKSRPIAEERWNDAQSWPSKVCKTWEDAQCGRLWCLHNNEKAMLLGWIQSQQRIDPQ--SGRSCLALVYDPVDVVPYSSVSRSLSDAAWGYTAAKSQDAGMVPDGTPCRRG-MCYNGSCVAISSIPMPITCSCNSHGVCNNLGNCHCNPGFAPPHC 659          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A0V0J9H2 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR151252 PE=4 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 4.621e-112
Identity = 212/570 (37.19%), Postives = 312/570 (54.74%), Query Frame = 1
Query:  727 FHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKL-TDENHILMELQLYKRRFINKRHDCLHAILGENLG--TARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP----------------PSNMGKM-NAVAMEPNGAPRNIESLMP----SKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQ------RCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN------KRGDLVANCGLEIPREADRDRQPKNWNTKPCSK-ETSICGRLWCRHENERVLRL----SEQFLNDEIVNGYHCSAVRFD----------------LDWYL-----DDFGMVPNGVSCGSGRICWKSECVLVNSIEQN-RCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            FH P    P PY++ELY++VD K    + GD    L+ R++ +   +N  F+ FN+   +++LEIW+ D++++  +++H+L  L  +KR   + RHDCLHAI+ +  G  +  RG++    MC ++ CVG+T+D  S    + +  + HE+GH+ GL HDTE+C+C GCIMATG+E G+ + +WS CS  ++  LL+ GM  CL D P                P+++ ++ N   + P   P    +  P    S CGNG +D GE+CDCG  + C   +  CC+   C    GA CA G CC++       +C L+ +G+ CR  E  SCDLPE+C+G SEWCP+DVYK DG  C  +  G  S+C RG C S +  CQ LWGDTA  +   C + N       + D VANCG   P   +R    ++W +K C   E + CGRLWC H NE+ + L    S+Q ++ +  +G  C A+ +D                  W        D GMVP+G  C  G +C+   CV ++SI     C+C+ HG CNN GNCHC+PGF+ P+C
Sbjct:  132 FHQP--NHPAPYIIELYVVVDEKFVKSYRGDVVGILY-RVNTLFKHVNALFAPFNVRVVLVRLEIWKTDRVRMDVEDHHLLKTLANFKRTLTDVRHDCLHAIVADEGGQMSTMRGKASKEKMCTFSSCVGFTRDAPSMYPKETARTIAHELGHSLGLRHDTEECECQGCIMATGVEVGTTTMDWSLCSLRDLPVLLEHGMGSCLHDTPLDGHTSLLHASTTGAQPASVVRVFNGDQLRPGKVPEPRSTTPPQITESLCGNGKLDPGEECDCGTSETCPNATRACCDVYRCRLINGAECATGPCCEVTSTARGYQCRLRSAGSTCRP-ETGSCDLPEFCDGNSEWCPADVYKIDGEPCYTE-HGYKSYCVRGGCRSSQDWCQTLWGDTATHAGYGCTEYNIQLSKDGKADDVANCGKSRPIAEERWNDAQSWPSKVCKTWEDAQCGRLWCLHNNEKAMLLGWIQSQQRIDPQ--SGRSCLALVYDPVDVVPYSSVSRSLSDAAWGYTAAKSQDAGMVPDGTPCRRG-MCYNGSCVAISSIPMPITCSCNSHGVCNNLGNCHCNPGFAPPHC 693          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A564YET5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5673 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 3.750e-110
Identity = 217/576 (37.67%), Postives = 304/576 (52.78%), Query Frame = 1
Query:  724 AFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTAR-RGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-------------------PSNMGKMNAVAMEPNGAPRNIES----LMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQR---------CSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN-------KRGDLVANCGLEIPREADRDRQPKNWNTKPCSK-ETSICGRLWCRHENERVLRLSEQFLNDEIVNGYH--CSAVRFD-LD-----------------W-----YLDDFGMVPNGVSCGSGRICWKSECVLVNSIE-QNRCNCHEHGDCNNRGNCHCHPGFSAPNCT 2250
             FH P +    PY+VELY++ D K  + F  D    + +R++ I   +N  FS+FN+ F ++ LEIWE++++ L  E+H L  L  +KR  +N RHDCL AILG++  T+  RG++    MC Y+ CV + +D       D +    HE+GH FGL HDTE C+C GCIMATG+E G+ +  WS CS  ++ +LL+ GM  CL D P                   PS++     +  +  G P  ++S    L  S CGNG +D GE+CDCG R+ C  E   CC+  TC F  GA CA G CCD+Q          C LK SGT+CR++   SCDLPEYC+G+SEWCP+DV+K DG +C  K  G  S+C RG C +    C+ LWG T   +   C   N       +  D VANCG   PR  +R ++   W +KPC     + CGRLWC H NE+ + L  Q     +       C A+ +D LD                 W        D GM P+G  C  G +C+   C+  + +  +  CNC+ +G CNN G+CHC+ G++ P+C 
Sbjct:   96 VFHRPGEN--APYIVELYVVTDEKFISSFSHD-IAQVVTRVNNIFKVVNSLFSRFNVQFVIVGLEIWEKNRVNLEAEDHFLRTLASFKRTEVNTRHDCLFAILGDDDQTSTTRGRANSQVMCKYSSCVSFVRDSLYMEVNDTARTAAHELGHTFGLRHDTEDCECQGCIMATGVEFGTATMEWSPCSIRDMPNLLRFGMGACLHDIPVQSHTSLLPRQLRLIDVNGPSSIHTYTVINTQ-RGTPELLQSTPLSLKMSLCGNGKLDPGEECDCGTRETCPKEVRACCDVTTCKFREGAECASGPCCDIQTVSGDPSKTICKLKASGTVCRDVG-NSCDLPEYCDGQSEWCPADVFKTDGETCYTK-EGYRSNCIRGGCNAPDEWCRVLWGPTGTAAGPGCIGYNLIRDPNSQSIDEVANCGRLRPRSDERWKEIDQWPSKPCYDWPDAECGRLWCMHRNEKAMLLGWQESQRRVDPHTQRTCVALVYDPLDPLQHAEITSQTGFPGPGWDHTASVTQDAGMTPDGTPCQRG-LCYNGSCISRDELLFRKTCNCNSNGVCNNLGHCHCNIGYAPPDCV 664          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A564YGG3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5673 PE=4 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 3.957e-110
Identity = 217/576 (37.67%), Postives = 304/576 (52.78%), Query Frame = 1
Query:  724 AFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTAR-RGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-------------------PSNMGKMNAVAMEPNGAPRNIES----LMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQR---------CSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN-------KRGDLVANCGLEIPREADRDRQPKNWNTKPCSK-ETSICGRLWCRHENERVLRLSEQFLNDEIVNGYH--CSAVRFD-LD-----------------W-----YLDDFGMVPNGVSCGSGRICWKSECVLVNSIE-QNRCNCHEHGDCNNRGNCHCHPGFSAPNCT 2250
             FH P +    PY+VELY++ D K  + F  D    + +R++ I   +N  FS+FN+ F ++ LEIWE++++ L  E+H L  L  +KR  +N RHDCL AILG++  T+  RG++    MC Y+ CV + +D       D +    HE+GH FGL HDTE C+C GCIMATG+E G+ +  WS CS  ++ +LL+ GM  CL D P                   PS++     +  +  G P  ++S    L  S CGNG +D GE+CDCG R+ C  E   CC+  TC F  GA CA G CCD+Q          C LK SGT+CR++   SCDLPEYC+G+SEWCP+DV+K DG +C  K  G  S+C RG C +    C+ LWG T   +   C   N       +  D VANCG   PR  +R ++   W +KPC     + CGRLWC H NE+ + L  Q     +       C A+ +D LD                 W        D GM P+G  C  G +C+   C+  + +  +  CNC+ +G CNN G+CHC+ G++ P+C 
Sbjct:   96 VFHRPGEN--APYIVELYVVTDEKFISSFSHD-IAQVVTRVNNIFKVVNSLFSRFNVQFVIVGLEIWEKNRVNLEAEDHFLRTLASFKRTEVNTRHDCLFAILGDDDQTSTTRGRANSQVMCKYSSCVSFVRDSLYMEVNDTARTAAHELGHTFGLRHDTEDCECQGCIMATGVEFGTATMEWSPCSIRDMPNLLRFGMGACLHDIPVQSHTSLLPRQLRLIDVNGPSSIHTYTVINTQ-RGTPELLQSTPLSLKMSLCGNGKLDPGEECDCGTRETCPKEVRACCDVTTCKFREGAECASGPCCDIQTVSGDPSKTICKLKASGTVCRDVG-NSCDLPEYCDGQSEWCPADVFKTDGETCYTK-EGYRSNCIRGGCNAPDEWCRVLWGPTGTAAGPGCIGYNLIRDPNSQSIDEVANCGRLRPRSDERWKEIDQWPSKPCYDWPDAECGRLWCMHRNEKAMLLGWQESQRRVDPHTQRTCVALVYDPLDPLQHAEITSQTGFPGPGWDHTASVTQDAGMTPDGTPCQRG-LCYNGSCISRDELLFRKTCNCNSNGVCNNLGHCHCNIGYAPPDCV 664          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Match: A0A419Q565 (Disintegrin and metalloproteinase domain-containing protein 9 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Adam9 PE=4 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 8.788e-110
Identity = 221/589 (37.52%), Postives = 309/589 (52.46%), Query Frame = 1
Query:  733 MPV---KEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKL-TDENHILMELQLYKRRFINKRHDCLHAILGENL-GTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP------------PSNMGKMNAVAME------------PNGAPRNIESLMPSK-----CGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQR------------CSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN---KRG---DLVANCGLEIPREADRDRQPKNWNTKPC-SKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYH--CSAVRFDLDW----------------------------YLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQN-RCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            MP+    + P P ++ELY++VD  +  +F  D Y+ L  R++ +++ +N  ++ FNI   V++LE+W +D+ +L  +E+HIL  L  +KR     RHDCLHA+LGE   G++ +G++   +MC ++RCVGYT+D  S + ++ +  + HE+GHNFGL HDTE+CKC  CIMATG+E G+    WS CS  ++  LL  GM  CL D P            P N    +AV +             P  +PR   S   S      CGNGV+D GE+CDCG R+ C  +   CC+ + C    G+ CAGG CC +QR            C L  +GT+CRN E  +CDLPEYC+G S WCPSDV+K DGI C  +  G  S+C RG C      C+ LWG     ++  C+D N    +G   D VANCG   P   +R   PK+W    C S + + CGRLWC H+NE+ + L         ++     CSA+ +D  W                               D GMVP+G  C  G +C+   CV  + I    +C+C  HG CNN G+CHC PGF  P C
Sbjct:   18 MPILHRPDQPSPRILELYMVVDEALVNLFNRD-YDMLIFRVNSLISHVNALYAPFNIAIVVVRLELWMQDRDRLNIEEHHILPTLAQFKRMHTTVRHDCLHALLGERKEGSSNKGKANSHTMCVFSRCVGYTRDSPSSDILETARTMAHELGHNFGLRHDTEECKCQNCIMATGVEFGTNLMAWSPCSMRDLSVLLDYGMGACLHDTPVRTVVAIGAYNQPKNSTVSSAVRVYDWTTQSSSELHLPALSPRYRHSSRRSTATDRLCGNGVLDPGEECDCGTRESCPIQLQDCCDAQRCRLKPGSECAGGPCCRIQRVPATQFSLERFQCRLAPAGTVCRN-ESGNCDLPEYCDGLSGWCPSDVFKADGIPCWTE-EGTESYCARGGCREADSWCRVLWGKRGRRAHPHCFDENHGIPKGVPVDPVANCGKRKPLSEERWEDPKSWPGIRCPSVQDAECGRLWCHHQNEKAMILGWIESQTRYLSSVEQSCSALVYDPVWPASDPSTWDASKKRQTNLNVAGVGILSAVTQDAGMVPDGTPCSRG-MCYNGSCVPHSEIRARFQCDCRGHGICNNLGHCHCDPGFHPPFC 602          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:103046159])

HSP 1 Score: 241.506 bits (615), Expect = 3.175e-65
Identity = 166/517 (32.11%), Postives = 250/517 (48.36%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENH---ILMELQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDT--EQCKCY------GCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-PSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAG-GSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV----NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSEC--VLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL ++ D K    +  +N   ++ R+  + NQ++  +   N+   ++ LEIW      L D+N    +   L+   R  + + RHD    ++GE+      G +  +SMC  +R  G   D+   + + ++  V HE+GHN G+ HDT    C+C       GCIM  +TG   G     +S+CS+ ++   L  G   CL + P P  +           G PR         CGN  V+KGE+CDCG   +C   ++ CCN  TC    GA C+  G CC  + C L+ +G +CR   L  CDLPE+C G S +CP +V+ Q+G  C + +    S+CY G CAS   +CQ+LWG  A  +  VC+  +NK G+   NCG           Q  N +  PCS     CGR+ C+   +R L  S   +    V      + C  + FDL   + D  MV  G +C  G++C    C  V V  +E+ R  C+ HG CN+  NCHC  G++ P+C
Sbjct:  276 IELVLVADHKEYLNYQRNNKTIIY-RMLDVANQVDWFYRTLNVRVALLGLEIWSDQDKILVDKNPTDTLNRFLEWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCTKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTSDRHCECQNEPRLGGCIMEPSTGSMPGQL---FSSCSERDLSLSLLHGGGMCLFNVPQPEKL----------LGGPR---------CGNLYVEKGEECDCGLLDEC---NDPCCNASTCKLVPGAQCSSDGICC--ENCRLRVAGWMCRE-PLGECDLPEFCTGTSPFCPPNVFLQNGEPCQDGV----SYCYSGVCASLDDQCQQLWGANATRAPPVCFSSVNKEGNKYGNCG-----------QTANGSYIPCSNADVHCGRIQCQGGGDRPLLGSNAQIRTARVRLNLKNFTCRGLYFDLGDGVSDPAMVAQGTACAPGKVCLDQRCQDVSVFGVEECRDKCNGHGVCNSNKNCHCDVGWAPPHC 747          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:103046159])

HSP 1 Score: 240.736 bits (613), Expect = 3.252e-65
Identity = 166/517 (32.11%), Postives = 250/517 (48.36%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENH---ILMELQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTE--QCKCY------GCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-PSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAG-GSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV----NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSEC--VLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL ++ D K    +  +N   ++ R+  + NQ++  +   N+   ++ LEIW      L D+N    +   L+   R  + + RHD    ++GE+      G +  +SMC  +R  G   D+   + + ++  V HE+GHN G+ HDT    C+C       GCIM  +TG   G     +S+CS+ ++   L  G   CL + P P  +           G PR         CGN  V+KGE+CDCG   +C   ++ CCN  TC    GA C+  G CC  + C L+ +G +CR   L  CDLPE+C G S +CP +V+ Q+G  C + +    S+CY G CAS   +CQ+LWG  A  +  VC+  +NK G+   NCG           Q  N +  PCS     CGR+ C+   +R L  S   +    V      + C  + FDL   + D  MV  G +C  G++C    C  V V  +E+ R  C+ HG CN+  NCHC  G++ P+C
Sbjct:  276 IELVLVADHKEYLNYQRNNKTIIY-RMLDVANQVDWFYRTLNVRVALLGLEIWSDQDKILVDKNPTDTLNRFLEWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCTKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTSDRHCECQNEPRLGGCIMEPSTGSMPGQL---FSSCSERDLSLSLLHGGGMCLFNVPQPEKL----------LGGPR---------CGNLYVEKGEECDCGLLDEC---NDPCCNASTCKLVPGAQCSSDGICC--ENCRLRVAGWMCRE-PLGECDLPEFCTGTSPFCPPNVFLQNGEPCQDGV----SYCYSGVCASLDDQCQQLWGANATRAPPVCFSSVNKEGNKYGNCG-----------QTANGSYIPCSNADVHCGRIQCQGGGDRPLLGSNAQIRTARVRLNLKNFTCRGLYFDLGDGVSDPAMVAQGTACAPGKVCLDQRCQDVSVFGVEECRDKCNGHGVCNSNKNCHCDVGWAPPHC 747          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:103046159])

HSP 1 Score: 241.506 bits (615), Expect = 3.537e-65
Identity = 166/517 (32.11%), Postives = 250/517 (48.36%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENH---ILMELQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDT--EQCKCY------GCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-PSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAG-GSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV----NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSEC--VLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL ++ D K    +  +N   ++ R+  + NQ++  +   N+   ++ LEIW      L D+N    +   L+   R  + + RHD    ++GE+      G +  +SMC  +R  G   D+   + + ++  V HE+GHN G+ HDT    C+C       GCIM  +TG   G     +S+CS+ ++   L  G   CL + P P  +           G PR         CGN  V+KGE+CDCG   +C   ++ CCN  TC    GA C+  G CC  + C L+ +G +CR   L  CDLPE+C G S +CP +V+ Q+G  C + +    S+CY G CAS   +CQ+LWG  A  +  VC+  +NK G+   NCG           Q  N +  PCS     CGR+ C+   +R L  S   +    V      + C  + FDL   + D  MV  G +C  G++C    C  V V  +E+ R  C+ HG CN+  NCHC  G++ P+C
Sbjct:  276 IELVLVADHKEYLNYQRNNKTIIY-RMLDVANQVDWFYRTLNVRVALLGLEIWSDQDKILVDKNPTDTLNRFLEWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCTKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTSDRHCECQNEPRLGGCIMEPSTGSMPGQL---FSSCSERDLSLSLLHGGGMCLFNVPQPEKL----------LGGPR---------CGNLYVEKGEECDCGLLDEC---NDPCCNASTCKLVPGAQCSSDGICC--ENCRLRVAGWMCRE-PLGECDLPEFCTGTSPFCPPNVFLQNGEPCQDGV----SYCYSGVCASLDDQCQQLWGANATRAPPVCFSSVNKEGNKYGNCG-----------QTANGSYIPCSNADVHCGRIQCQGGGDRPLLGSNAQIRTARVRLNLKNFTCRGLYFDLGDGVSDPAMVAQGTACAPGKVCLDQRCQDVSVFGVEECRDKCNGHGVCNSNKNCHCDVGWAPPHC 747          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:103046159])

HSP 1 Score: 240.35 bits (612), Expect = 4.758e-65
Identity = 166/517 (32.11%), Postives = 250/517 (48.36%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDEN---HILMELQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDT--EQCKCY------GCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-PSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAG-GSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV----NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSEC--VLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL ++ D K    +  +N   ++ R+  + NQ++  +   N+   ++ LEIW      L D+N    +   L+   R  + + RHD    ++GE+      G +  +SMC  +R  G   D+   + + ++  V HE+GHN G+ HDT    C+C       GCIM  +TG   G     +S+CS+ ++   L  G   CL + P P  +           G PR         CGN  V+KGE+CDCG   +C   ++ CCN  TC    GA C+  G CC  + C L+ +G +CR   L  CDLPE+C G S +CP +V+ Q+G  C + +    S+CY G CAS   +CQ+LWG  A  +  VC+  +NK G+   NCG           Q  N +  PCS     CGR+ C+   +R L  S   +    V      + C  + FDL   + D  MV  G +C  G++C    C  V V  +E+ R  C+ HG CN+  NCHC  G++ P+C
Sbjct:  276 IELVLVADHKEYLNYQRNNKTIIY-RMLDVANQVDWFYRTLNVRVALLGLEIWSDQDKILVDKNPTDTLNRFLEWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCTKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTSDRHCECQNEPRLGGCIMEPSTGSMPGQL---FSSCSERDLSLSLLHGGGMCLFNVPQPEKL----------LGGPR---------CGNLYVEKGEECDCGLLDEC---NDPCCNASTCKLVPGAQCSSDGICC--ENCRLRVAGWMCRE-PLGECDLPEFCTGTSPFCPPNVFLQNGEPCQDGV----SYCYSGVCASLDDQCQQLWGANATRAPPVCFSSVNKEGNKYGNCG-----------QTANGSYIPCSNADVHCGRIQCQGGGDRPLLGSNAQIRTARVRLNLKNFTCRGLYFDLGDGVSDPAMVAQGTACAPGKVCLDQRCQDVSVFGVEECRDKCNGHGVCNSNKNCHCDVGWAPPHC 747          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Match: adam15 (ADAM metallopeptidase domain 15 [Source:NCBI gene;Acc:103046159])

HSP 1 Score: 240.736 bits (613), Expect = 5.150e-65
Identity = 166/517 (32.11%), Postives = 250/517 (48.36%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENH---ILMELQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDT--EQCKCY------GCIM--ATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP-PSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAG-GSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIV----NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSEC--VLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +EL ++ D K    +  +N   ++ R+  + NQ++  +   N+   ++ LEIW      L D+N    +   L+   R  + + RHD    ++GE+      G +  +SMC  +R  G   D+   + + ++  V HE+GHN G+ HDT    C+C       GCIM  +TG   G     +S+CS+ ++   L  G   CL + P P  +           G PR         CGN  V+KGE+CDCG   +C   ++ CCN  TC    GA C+  G CC  + C L+ +G +CR   L  CDLPE+C G S +CP +V+ Q+G  C + +    S+CY G CAS   +CQ+LWG  A  +  VC+  +NK G+   NCG           Q  N +  PCS     CGR+ C+   +R L  S   +    V      + C  + FDL   + D  MV  G +C  G++C    C  V V  +E+ R  C+ HG CN+  NCHC  G++ P+C
Sbjct:  276 IELVLVADHKEYLNYQRNNKTIIY-RMLDVANQVDWFYRTLNVRVALLGLEIWSDQDKILVDKNPTDTLNRFLEWRTRDLLPRLRHDNAQLVMGESFDGTTVGMASQSSMCTKDRSGGVNVDHLV-SVLGVASTVAHELGHNLGMSHDTSDRHCECQNEPRLGGCIMEPSTGSMPGQL---FSSCSERDLSLSLLHGGGMCLFNVPQPEKL----------LGGPR---------CGNLYVEKGEECDCGLLDEC---NDPCCNASTCKLVPGAQCSSDGICC--ENCRLRVAGWMCRE-PLGECDLPEFCTGTSPFCPPNVFLQNGEPCQDGV----SYCYSGVCASLDDQCQQLWGANATRAPPVCFSSVNKEGNKYGNCG-----------QTANGSYIPCSNADVHCGRIQCQGGGDRPLLGSNAQIRTARVRLNLKNFTCRGLYFDLGDGVSDPAMVAQGTACAPGKVCLDQRCQDVSVFGVEECRDKCNGHGVCNSNKNCHCDVGWAPPHC 747          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004527.1 (pep scaffold:Pmarinus_7.0:GL476950:296064:347055:1 gene:ENSPMAG00000004117.1 transcript:ENSPMAT00000004527.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 3.050e-58
Identity = 158/517 (30.56%), Postives = 239/517 (46.23%), Query Frame = 1
Query:  703 HQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLT-DENHILMELQLYKRR--FINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY--------GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSK-CGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENER-VLRLSEQFLNDEIV----NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN--CHEHG 2190
            H R KRSA     K M     VEL I+ D+        D       R+  + N ++  +   NI   ++ +E+W E D+  +T D +  L E   ++++     K+HD    + G +      G + + SMC   +  G   D+ + N + ++  + HE+GHNFG++HDT + +C+        GCIMA       F   +S+CS  ++ S L  G   CL + P                   ++  L   K CGNG V+ GEQCDCG  ++C+   N CCN   C    GA CA G CC  Q C LK SGT CR+    +CDLPEYCNG S  CP +VY  DG  C     G+ ++CY G C +   +C  LWG  ++ + ++C+ ++N  GD   NCG          +  K    K C      CG++ C+  + R V+  +   ++  I         C      L   + D G+V  G  CG G+IC+   C  V+ ++   C+  C+ HG
Sbjct:   64 HARLKRSAL----KNMK---YVELIIVADNAKYNRESKD-LTRTKQRMIDVANHVDKYYRSLNIRIALVGVEVWTESDRSAVTVDASSTLYEFLDWRKKQLLTRKKHDNAQLVTGISFQGTTIGMAPLMSMCSAEQSGGVNMDH-AVNPVGLAATMAHEMGHNFGMNHDTPERRCHCQANSEQGGCIMAPSTGH-PFPSKFSSCSIRDLDSSLSKGGGMCLYNMP-------------------DVRDLYGGKRCGNGYVEDGEQCDCGEIEECD---NPCCNANNCTLRAGAECAHGMCC--QDCQLKPSGTRCRD-PTNTCDLPEYCNGGSPHCPPNVYLLDGYPCH----GKEAYCYNGMCLTHEQQCVTLWGSGSKPAPEICFANVNSAGDQYGNCG----------KDSKAVYMK-CKASDVKCGKIQCQGGSTRPVIGTNAVSIDTNIAVPGGGTVLCRGTHVYLGDDMLDPGLVLTGTKCGEGKICYNRHCQNVSILKTGNCDTKCNGHG 530          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004524.1 (pep scaffold:Pmarinus_7.0:GL476950:296055:347085:1 gene:ENSPMAG00000004117.1 transcript:ENSPMAT00000004524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 4.120e-56
Identity = 158/517 (30.56%), Postives = 241/517 (46.62%), Query Frame = 1
Query:  703 HQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLT-DENHILMELQLYKRR--FINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY--------GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSK-CGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENER-VLRLSEQFLNDEIV----NGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN--CHEHG 2190
            H R KRSA     K M     VEL I+ D+        D       R+  + N ++  +   NI   ++ +E+W E D+  +T D +  L E   ++++     K+HD    +  + + T   G + + SMC   +  G   D+ + N + ++  + HE+GHNFG++HDT + +C+        GCIMA    S   +  +S+CS  ++ S L  G   CL + P                   ++  L   K CGNG V+ GEQCDCG  ++C+   N CCN   C    GA CA G CC  Q C LK SGT CR+    +CDLPEYCNG S  CP +VY  DG  C     G+ ++CY G C +   +C  LWG  ++ + ++C+ ++N  GD   NCG          +  K    K C      CG++ C+  + R V+  +   ++  I         C      L   + D G+V  G  CG G+IC+   C  V+ ++   C+  C+ HG
Sbjct:   67 HARLKRSAL----KNMK---YVELIIVADNAKYNRESKD-LTRTKQRMIDVANHVDKYYRSLNIRIALVGVEVWTESDRSAVTVDASSTLYEFLDWRKKQLLTRKKHDNAQLVTKKRVSTTI-GMAPLMSMCSAEQSGGVNMDH-AVNPVGLAATMAHEMGHNFGMNHDTPERRCHCQANSEQGGCIMA---PSTGGNDKFSSCSIRDLDSSLSKGGGMCLYNMP-------------------DVRDLYGGKRCGNGYVEDGEQCDCGEIEECD---NPCCNANNCTLRAGAECAHGMCC--QDCQLKPSGTRCRD-PTNTCDLPEYCNGGSPHCPPNVYLLDGYPCH----GKEAYCYNGMCLTHEQQCVTLWGSGSKPAPEICFANVNSAGDQYGNCG----------KDSKAVYMK-CKASDVKCGKIQCQGGSTRPVIGTNAVSIDTNIAVPGGGTVLCRGTHVYLGDDMLDPGLVLTGTKCGEGKICYNRHCQNVSILKTGNCDTKCNGHG 530          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007858.1 (pep scaffold:Pmarinus_7.0:GL476347:375920:389428:1 gene:ENSPMAG00000007065.1 transcript:ENSPMAT00000007858.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 1.184e-49
Identity = 149/525 (28.38%), Postives = 244/525 (46.48%), Query Frame = 1
Query:  748 MPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW---ERDQIKLTDENHILMELQLYKRRFIN----KRHDCLHAILGEN----LGTARRGQSEM-ASMCGYNRCVGYTKDYYSQNEIDISHAVL-HEIGHNFGLHHDTEQ-CKC---YGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSEC----VLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTN 2256
            +P    VEL  I+D+ +       N       ++ + N ++  +   +I    + + +    E   +    ++   +  +  K R  N    KRHD    I        LG A  G   + A+  G N  VG        + + ++ +VL HE+GHN G+ HD  + C C   +GCIM   + S   +  +S CS+ +++ L+    A CLL+ P ++                  E+L P  CG+ ++D GE+CDCG  ++C+   NKCC+  TC    GA CA GSCC  + C     G +CR  +   CDLPE+C+G +  CP D + Q+G  C N      ++CY G C +   +C+ +WG  +  ++D C+  +N +G+   NCG  +P          +   K CS+    CG+L C  +N + L +     N        C AV ++L   + D  +V +G  C  G +C+  +C    VL  SI+     C+ HG+ NN  +CHC  G++ P+C++ 
Sbjct:  145 LPSTRYVELLFILDNTLYTGQYQSNKTLAVHDMAELANLVDSYYRVLDIRVVPVGVHVLSAQEEAAVMAEGDSAGTVLGKFLKWRESNLDSMKRHDNAQLITARQFQSILGMAYVGTVCLRATSGGINTLVG--------SSVLMTASVLSHELGHNLGMSHDDNRTCSCAAEHGCIMGAVMGSPPATV-FSGCSEDDLEGLVNG--ATCLLNVPKAD------------------EALRPPVCGDKMLDAGEECDCGSPEECD---NKCCDARTCRLRSGARCAYGSCC--KDCQFVGQGEVCRAAQ-GVCDLPEFCSGSAASCPDDSFLQNGHPCQNAA----AYCYNGVCQTYTSQCEAIWGPESNPASDECFLTVNTKGNEFGNCG-TVP----------SGKYKSCSRRDVKCGKLICESKNNQPL-IGHTVPNFAFYG--QCRAVDYNLGSDVPDPALVQSGTKCADGMVCFNQQCQDARVLNYSIDYTSI-CNGHGEHNNHKHCHCAEGWAPPDCSST 615          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007654.1 (pep scaffold:Pmarinus_7.0:GL476707:60529:77379:-1 gene:ENSPMAG00000006905.1 transcript:ENSPMAT00000007654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 1.091e-48
Identity = 145/508 (28.54%), Postives = 237/508 (46.65%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDEN-----HILMELQLYKRRFIN--KRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYG-CIMATGIESGSFSFNWSNCSKHEIKSL-LKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCN----CHEHGDCNNRGNCHCHPGFSAPNC 2247
            VE  ++V + +       N +++ + ++ I+N ++L +   NI   ++ L +   ++  L  ++      ++ +   +++   N   RHDC H +  E+ G A  G + + ++C  +   G      ++    ++  V HE+GHN G+ HD   C+C   CIM  G+ +   +  +S CS  + ++L L      CLL+ P  N                  E      CG+ +VDKGE CDCG  ++C   +N CC   TC   V A CA G CC  + C +   G  CR   + +CDLPEYCNG S++C +D + Q+G  C N      ++CY G C +  ++C+ +WG  A   +D CY  +N +G+   NCG           Q  N     C+     CG+L C +   + L +          +   C+AV F+    + D G+V  G  CGS  +C  ++C     +    CN    C  HG CNN  NCHC+ G++ P+C
Sbjct:   77 VEFVLVVGATLYKNRYNSNRSSMVTDVAAIVNLVDLDYKTINIRVVLVGLHLMTTEEQALVVQDGDAAGSVVGKFAKWRQTNYNILGRHDCGHLLTWESYG-AIVGMAYVGTICSRSSSAG-IASMPTRQIPSVAAVVAHEMGHNLGMSHDRSPCQCSTPCIMNAGLVNPPPT-AFSQCSTDDFENLILVQHGGSCLLNVPTPN------------------EEFRQPVCGDSIVDKGEDCDCGSPQEC---NNPCCEASTCRLKVNAECAYGLCC--KECKIMGQGESCRP-SVGACDLPEYCNGSSQFCYTDTFIQNGYPCQN----SSAYCYNGVCLTLDYQCRSIWGGNAVSGSDNCYLIVNTKGNEFGNCG-----------QGTNGYIT-CTTANIKCGKLVCENTPSKPLIVDAP----NFASYQGCNAVSFNYGTDIPDPGLVQPGTKCGSNSVCMDNQCQNATVVMGTLCNTTQKCSGHGVCNNNLNCHCNDGYAPPDC 537          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Match: adam22 (ADAM metallopeptidase domain 22 [Source:ZFIN;Acc:ZDB-GENE-070810-1])

HSP 1 Score: 169.859 bits (429), Expect = 1.808e-43
Identity = 145/494 (29.35%), Postives = 215/494 (43.52%), Query Frame = 1
Query:  853 IMNQINLAF-SQFNIYFTVIQLEIW-ERDQIKL-TDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFG-LHHDTEQ------CKC----YGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYD-MNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYH------CSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC-------NCHEHGDCNNRGNCHCHPGFSAPNCT 2250
            I+N ++  +  Q N    ++ +E W + ++I + TD    L     Y+R+      D  H + G    ++  G +    +C   R  G   +Y +   + ++ A    IG N G L H+++       C+C    YGCIM   +        +S CS  E +  L++G   CL ++P                     +     +CGNG V+ GE+CDCG   +C    +KCC  + C FT GA C+ G CC    C     G  CR+   E CDLPE C G+S  CP +V+KQDG SC NK  G    CY G+C +R  +C+ +WGD    S   CYD +N  G    NCG          R+  +W    CSK   +CG L C + + R  +L E   +   V+  H      CS     L     D G V +G  CG   IC   +C  + ++  + C        C  HG C+N   C C   +   +C+
Sbjct:  166 IVNMVDAIYKEQLNTRVVLVSMETWTDENRITVSTDPLQTLRAFMKYRRQSPRTDGDTAHLLSGLMFESSHSGVAYFGGVCSLQR-GGGVNEYGNVGAMVVTLA--QGIGQNLGMLWHNSKAAARGGGCQCTDIWYGCIME--VTGQMLPMRFSQCSIDEYQEFLQAGGGACLFNKP--------------------TQLFEQPECGNGFVELGEECDCGSPTECSEGWDKCC--KKCTFTHGAICSSGLCCAPNSCQFITRGEECRHAVGE-CDLPETCPGDSVQCPPNVHKQDGYSC-NKDQGR---CYIGQCKTREKQCKYIWGDKGMSSERQCYDKLNIEGTEKGNCG----------RKEDSWLQ--CSKHDVLCGFLLCTNVS-REPQLGELQGDSVKVSIRHNGHLLECSGGHIMLA-DGSDLGYVEDGTPCGPDVICLDHKCQPLQALNLSGCPSVIQGTACSGHGVCSNEARCVCERHWVGNDCS 613          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO37129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGQ0])

HSP 1 Score: 126.716 bits (317), Expect = 7.891e-33
Identity = 79/239 (33.05%), Postives = 119/239 (49.79%), Query Frame = 1
Query: 1168 IGHNFGLHHDTEQCKCY--------GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANC 1860
            +GHN G+ HD     C         GCIM +G+     +  WS CS+   K  ++ G+  CL ++P    G  +A+                  CGNG  ++GE+CDCG  ++C+  S+ CCN  TC  T G+ C  G CC   +C L  +G  CR  ++  CDLPE C+G+SE CP++ Y  +G SC +        C+ G C +  ++C+ LWG       +VCY +N +G    +C
Sbjct:    1 MGHNLGMSHDESVVGCTCEDKDVNKGCIM-SGVARSIPATKWSKCSEDSFKEFMERGLDPCLFNQPLMLFG--DAI------------------CGNGFKEEGEECDCGTAEECKRYSDDCCNSTTCKLTAGSECMDGPCC--FKCKLSPAGKECRE-KVSECDLPEVCDGKSELCPANRYVYNGKSCGDG----KGFCFNGVCPTLDNQCETLWGLGVTSGPEVCYTINMKGTYSGSC 211          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO37131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGQ4])

HSP 1 Score: 95.5153 bits (236), Expect = 1.008e-22
Identity = 56/145 (38.62%), Postives = 80/145 (55.17%), Query Frame = 1
Query: 1426 CGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANC 1860
            CGNG  ++GE+CDCG     E  S+ CCN  TC  T G+ C  G CC   +C L  +G  CR  ++  CDLPE C+G+SE CP++ Y  +G SC +        C+ G C +  ++C+ LWG       +VCY +N +G    +C
Sbjct:    2 CGNGFKEEGEECDCGTA---ERYSDDCCNSTTCKLTAGSECMDGPCC--FKCKLSPAGKECRE-KVSECDLPEVCDGKSELCPANRYVYNGKSCGDG----KGFCFNGVCPTLDNQCETLWGLGVTSGPEVCYTINMKGTYSGSC 136          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO30803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZR7])

HSP 1 Score: 66.2402 bits (160), Expect = 6.490e-11
Identity = 87/329 (26.44%), Postives = 124/329 (37.69%), Query Frame = 1
Query:  823 YNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQI--KLTDEN-HILMELQLYK--------RRFINKRHDCLHAILG------ENL--GTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVL-HEIGHNFGLHHDTEQCKCY------GCIMATGIESGSFSFN--WSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCN----PETCLFTVGASCAG--GSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISC 1707
            Y N F+  ++ +      +S + I F V ++ I++   +  K  D+N  I + L L            F+    D  + ILG       N   G   R          YN  V   K Y       +S     HE+GH FG  HD E   C         +M +   SG    N  +S+CS   I+  +     D                   P  +   I +  P  CGN +++  EQCDCG    C+AE   CCN    P+ C  T+ A+C+   G CC  + C    +   CRN     C     C+G S  CP  VY+ D   C
Sbjct:  231 YKNAFNTTNYDL------YSPYGITFRVKKMVIYDEQDVPDKYKDDNLAIDVMLNLLSSDDHSDVCEAFMFTDRDFDNGILGLAWIGKPNFLGGICSRYSKVGGQYISYNTGVVTLKLYRLFTPPKVSEVTFAHELGHGFGSEHDPEDGDCSPGGKDGNYVMYSKATSGDRPNNDVFSSCSLKAIRDNINDKRGD-------------------PKYSGCFISADTPI-CGNRIIEGNEQCDCGDENSCKAEGG-CCNPPGHPQACRLTLPATCSPSQGPCCG-RDCRYVGNDISCRN--KTDCLDKAMCSGSSVECPKSVYQPDNTVC 529          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO47184 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMZ8])

HSP 1 Score: 61.6178 bits (148), Expect = 1.942e-9
Identity = 61/221 (27.60%), Postives = 88/221 (39.82%), Query Frame = 1
Query:  766 VELYIIVDSKMAAMFGGDNYNNL-----------FSRISFIMNQINLAFSQFNIYFT--------------VIQLEIW-ERDQIKL-TDENHILMELQLYKRRFI--NKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEP 1341
            +E  ++VD KMA   G D                FS  S   N INL  S+  I  T              +     W ER+   L  DENH      L+ R  I  +K   C      + LG AR        MC +       +D    N + +   + HE GH+ G++HD   C     +M+T       +F+WS+CS++ +K  L S  + CL D+P
Sbjct:  205 IESLVVVDPKMANFHGEDAAKQYALAACNIVSAKFSDSSLGENPINLVVSRMQILTTQQPGLIINHHASNTLESFGKWAERNNNPLDNDENHYDYAT-LFTRYNICKDKNQPC------DTLGLAR-----TRGMCSFPSSASVNQD----NGLMLGMTLAHETGHSMGINHDGGDCADGENVMSTFAPGKPAAFSWSSCSRNYLKQFLASDDSKCLDDQP 409          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Match: EDO33983 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQN0])

HSP 1 Score: 55.8398 bits (133), Expect = 1.018e-7
Identity = 53/203 (26.11%), Postives = 82/203 (40.39%), Query Frame = 1
Query: 1078 SMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDC---GGRKQCEAESNKCCNPETCLFTVGASCA--GGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGE-SEW 1668
            + CGY+    Y+        +  + ++ HE+ HN G+ HDT  C   G IM +G  SG  +F WS CS+ E+K        +C  + PP  +                    +PS+     +D  EQC      G K+C    ++C   +      G SC   G    D   C  +K     R +E+    LP   +G+ S+W
Sbjct:  354 AFCGYSCESRYSASVNDDQGLQTAFSIAHEMAHNLGVDHDTGDCS--GHIMTSGQPSGPDAFTWSKCSRKELKQSFAG--HECYDNLPPKLIK-------------------IPSRPPGFNIDADEQCTMMYGRGYKRCPITQHQC---DQMFCYRGNSCVARGSPPVDGTACGWRKWCMKGRCVEV-GASLPPPVDGQWSDW 529          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: ENSORLT00000015906.2 (zinc metalloproteinase-disintegrin-like atrase-A [Source:NCBI gene;Acc:101166011])

HSP 1 Score: 249.595 bits (636), Expect = 9.121e-69
Identity = 184/613 (30.02%), Postives = 293/613 (47.80%), Query Frame = 1
Query:  475 IDEHHKNHFSVSLCNGISGI----EKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXV--PPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPY-LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWE-RDQIKLTDENHILMELQLYKRR---FINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKC------YGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHC-SAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHE----HGDCNNRGNCHCHPGFSAPNC 2247
            I     +  SV +C+GISG     ++L+          + H    + Q+  SS   S     R+A++  QQ    A    SR +RSK          +P P   VEL ++ D+   +  G +       RI   +N ++  + + NI   ++ LEIW  RD I +  +    ++  L  R+    +  +HD    + G +  T   G +   +MC  N   G     + +N I ++  + HE+GHNFGL HD + C C        C+M   I++G F   +S+CS  ++   +      CL  E P + G + ++A+ P             +CG+ ++D GE+CDCG  ++C   +N CC   TC  T G+ CA G CC  + C  K +G++CR    E CDLPEYC G+S+ CP D ++ +G  C  +  G    C+ G+C +R H C +L+G+ A+V  D+C++ NK+G+  ANCG        RDR        PCS     CG ++C +  + +    +  + +       C +AV  D    LD   MVPNG +CG  +IC    C  + S+ +NR +C +    +G CN++  CHC PG++ P C
Sbjct:  107 IQGEEDSSVSVQICSGISGFLRAQQQLFLIEPLGQTMEEDHAVYRSEQLKRSSGQHSTCGLKRSAEDRKQQGPQPAALFMSRSRRSK---------SVPDPQKFVELVVVADNAEYSRHGKETRQ----RILLAVNHVDKLYRRLNIRIVLVGLEIWSYRDLINVDLKAGTTLDNFLSWRQSDLLLRVQHDNAQFVTGTDFETDTVGLANKFAMCTPNS--GAVNQDHHENLIGLASTIAHEMGHNFGLSHDEDGCLCGSDDSSTDCVMTEKIKNGLFPEFFSSCSLRQLDEFMLRAQPSCL--ELPGS-GSVKSIALGP-------------RCGDAILDAGEECDCGTSEEC---NNACCEASTCRLTAGSQCAHGQCC--ENCQFKVTGSVCRKPASE-CDLPEYCTGDSQDCPEDAFEMNGKPCYTQTQG---FCFDGRCPTREHHCWRLFGEGAKVGPDLCFNSNKKGEDGANCG--------RDRS----GPIPCSAGNVKCGSMFCVNGGDSI--TGKLAVYNVFRFNLECRAAVEDDRSRNLD---MVPNGATCGPKKICLNHRCEDI-SVYENREDCAKKCNNNGVCNHKNQCHCDPGWAPPYC 661          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam8a (disintegrin and metalloproteinase domain-containing protein 8 [Source:NCBI gene;Acc:101166736])

HSP 1 Score: 239.58 bits (610), Expect = 2.584e-65
Identity = 196/709 (27.64%), Postives = 312/709 (44.01%), Query Frame = 1
Query:  211 PNVWLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYI-------------YFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWE-RDQIKLTD--ENHILMELQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKC------YGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHE-NERVLRLSEQFLNDEIVNGYHCS-AVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIE---QNRCN--CHEHGDCNNRGNCHCHPGFSAPNC 2247
            P+V     SI+  KY+L  HLE   +N++  LV KN                 ++ TS    YS++ + +T+T  +     +  +I  ++E   +  S+ LC+G+ G   L N    I               N K H +     V +           +       Y+         Q     +     ++   P  VEL ++VD+     +G      + SR+  I N ++  +    +   ++ L IW  RDQI+++   +  ++  ++  +R  + K +HD    I G +      G +   +MC  N   G   + ++ N I ++  + HE+GHN GL HDTE C C       GCIMA  +    +   +S+CSK +++  L+     CLLD P ++            G P          CGN  ++ GE+CDCG  K+C   +N CCN  TC    GA CA G CC    C LK +G ICR  +   CDL EYC G S  CP+D + Q+G+ C++       +CY G C SR+  C++LWG  AEV+ D C+                     R    + ++ + C+ +   CG L+C       V  +   ++   + NG  C+ A     D Y  D GMVP G  CG+  +C+ + C  + +I+   +N C+  C+ HG CN+   CHC PG++ P C
Sbjct:   42 PDVLQYSLSIDRGKYTL--HLE---KNRY--LVGKN-----------------FTVTS----YSDDGAQVTSTPDLRVHCYYHGHIVGVEE---SSASIELCSGMKGFVTLRNRMYLIEPLASEEAEMLDNRGNPKAHSDEGPHAVYNYKHLRRKRSSCSHGNTTTFYDHGARPSGVFQLGSLKSRAQTKQQADKPRTVELVVVVDNSEYKKYGSKK--TIESRVLEIANHVDKLYRPVGVRVMLVGLIIWSNRDQIEVSSNSDTTLIRFIEWRQRNLVQKIKHDNAQLITGIDFEGTTVGLANTNAMCTSNS--GAINEDHNTNAIGVASTIAHEMGHNLGLTHDTENCVCGSYTSKRGCIMAESL-GIVYPEQFSSCSKLQLRRFLEEYNPACLLDTPSTS---------RIFGGP---------VCGNAFLEPGEECDCGSAKEC---TNPCCNATTCKLNAGAQCAEGECC--HNCQLKPTGIICRP-KAGDCDLAEYCTGFSAACPADTFAQNGLRCNSG----KGYCYNGNCPSRQEHCRRLWGPDAEVAADECF--------------------SRHGSCRKFSQR-CAAKDQFCGTLFCSGGWTFPVTSMKSYYI---VGNGVTCNEATMKPEDNYPSDLGMVPTGTKCGNNMVCYNNRCEDIRNIKAYGKNDCSSKCNNHGVCNHESKCHCDPGWAPPFC 662          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam8a (disintegrin and metalloproteinase domain-containing protein 8 [Source:NCBI gene;Acc:101166736])

HSP 1 Score: 239.195 bits (609), Expect = 5.043e-65
Identity = 196/709 (27.64%), Postives = 312/709 (44.01%), Query Frame = 1
Query:  211 PNVWLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYI-------------YFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWE-RDQIKLTD--ENHILMELQLYKRRFINK-RHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKC------YGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHE-NERVLRLSEQFLNDEIVNGYHCS-AVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIE---QNRCN--CHEHGDCNNRGNCHCHPGFSAPNC 2247
            P+V     SI+  KY+L  HLE   +N++  LV KN                 ++ TS    YS++ + +T+T  +     +  +I  ++E   +  S+ LC+G+ G   L N    I               N K H +     V +           +       Y+         Q     +     ++   P  VEL ++VD+     +G      + SR+  I N ++  +    +   ++ L IW  RDQI+++   +  ++  ++  +R  + K +HD    I G +      G +   +MC  N   G   + ++ N I ++  + HE+GHN GL HDTE C C       GCIMA  +    +   +S+CSK +++  L+     CLLD P ++            G P          CGN  ++ GE+CDCG  K+C   +N CCN  TC    GA CA G CC    C LK +G ICR  +   CDL EYC G S  CP+D + Q+G+ C++       +CY G C SR+  C++LWG  AEV+ D C+                     R    + ++ + C+ +   CG L+C       V  +   ++   + NG  C+ A     D Y  D GMVP G  CG+  +C+ + C  + +I+   +N C+  C+ HG CN+   CHC PG++ P C
Sbjct:   77 PDVLQYSLSIDRGKYTL--HLE---KNRY--LVGKN-----------------FTVTS----YSDDGAQVTSTPDLRVHCYYHGHIVGVEE---SSASIELCSGMKGFVTLRNRMYLIEPLASEEAEMLDNRGNPKAHSDEGPHAVYNYKHLRRKRSSCSHGNTTTFYDHGARPSGVFQLGSLKSRAQTKQQADKPRTVELVVVVDNSEYKKYGSKK--TIESRVLEIANHVDKLYRPVGVRVMLVGLIIWSNRDQIEVSSNSDTTLIRFIEWRQRNLVQKIKHDNAQLITGIDFEGTTVGLANTNAMCTSNS--GAINEDHNTNAIGVASTIAHEMGHNLGLTHDTENCVCGSYTSKRGCIMAESL-GIVYPEQFSSCSKLQLRRFLEEYNPACLLDTPSTS---------RIFGGP---------VCGNAFLEPGEECDCGSAKEC---TNPCCNATTCKLNAGAQCAEGECC--HNCQLKPTGIICRP-KAGDCDLAEYCTGFSAACPADTFAQNGLRCNSG----KGYCYNGNCPSRQEHCRRLWGPDAEVAADECF--------------------SRHGSCRKFSQR-CAAKDQFCGTLFCSGGWTFPVTSMKSYYI---VGNGVTCNEATMKPEDNYPSDLGMVPTGTKCGNNMVCYNNRCEDIRNIKAYGKNDCSSKCNNHGVCNHESKCHCDPGWAPPFC 697          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam19a (disintegrin and metalloproteinase domain-containing protein 33-like [Source:NCBI gene;Acc:101160109])

HSP 1 Score: 235.728 bits (600), Expect = 1.291e-63
Identity = 187/615 (30.41%), Postives = 279/615 (45.37%), Query Frame = 1
Query:  475 IDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYN-AADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDENHILM--ELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY-------GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSK-CGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSH--CYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNG---YHCSAVRF----DLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +  H  +   +S C+G  G+  L NSS   Y      E +    + S+          A   +   +N ++DW  S H R KR+ +             ELYI+ D++M      D Y    +RI  I N ++  +   NI   +I LE+W +RDQ  ++ E +  +   LQ  ++    K+HD    + G        G + +  MC      G T D+ S   I  +  + HE+GHNFG+ HD + C C        GC+MA       F   +S CSK ++ S  + G   CL + P                   N++ L+  K CGNG V+ GE+CDCG   + E  +N CCN   C    GA CA G CC  Q C LK++GT+CR     +CDLPEYC G S +CP++VY  DG +C      +Y H  CY G C + + +C +LWG  A+ ++D C+ D+N  G+   NCG +           ++ N   C K  + CG++ C    ++    +   ++  I  G     C         D    L D G+V  G  CG G++C    C   +  E   C   CH +G CN+ GNCHC+ G++ P C
Sbjct:  106 VRGHPHSWVGISTCSGFRGLISL-NSSDTFYLEPLSDEASVRHSLRSTKHLPITGGSCAHPHHTSAFNLSSDWFPSHHSRVKRNTWGTT-------KYTELYIVADNEMFKRQNRD-YEKTKTRIMEIANYVDKFYRALNIRVPLIGLEVWTDRDQCIISKEPNATLWSFLQWRQKLKSRKKHDNAQLLTGVIFKGTTIGMAPLEGMCSLENSGGITVDH-SDLSIGAAATMAHEMGHNFGMSHDHDGC-CVEATANQGGCVMAAATGH-PFPRVFSRCSKRDLDSYFQKGGGMCLYNMP-------------------NMKDLVGGKKCGNGFVEDGEECDCG---EPEECTNNCCNANNCTLREGAQCAHGVCC--QNCKLKEAGTMCRG-PAGTCDLPEYCTGASPYCPANVYLLDGSAC------QYGHAYCYNGMCLTHQQQCLQLWGYGAQPAHDACFEDVNAAGNAFGNCGKD-----------EHGNYVKCDKSDAKCGKIQCHSAAKKPKGTNAVSIDTTIKTGGREVKCRGTYVYSTQDGQGDLPDPGLVVTGTKCGEGKVCRDRRCQNASFTELQGCIGRCHGNGVCNSNGNCHCNRGWAPPFC 666          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Match: adam19a (disintegrin and metalloproteinase domain-containing protein 33-like [Source:NCBI gene;Acc:101160109])

HSP 1 Score: 235.728 bits (600), Expect = 1.428e-63
Identity = 187/615 (30.41%), Postives = 279/615 (45.37%), Query Frame = 1
Query:  475 IDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYN-AADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIW-ERDQIKLTDENHILM--ELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCY-------GCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSK-CGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSH--CYRGKCASRRHRCQKLWGDTAEVSNDVCY-DMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNG---YHCSAVRF----DLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRC--NCHEHGDCNNRGNCHCHPGFSAPNC 2247
            +  H  +   +S C+G  G+  L NSS   Y      E +    + S+          A   +   +N ++DW  S H R KR+ +             ELYI+ D++M      D Y    +RI  I N ++  +   NI   +I LE+W +RDQ  ++ E +  +   LQ  ++    K+HD    + G        G + +  MC      G T D+ S   I  +  + HE+GHNFG+ HD + C C        GC+MA       F   +S CSK ++ S  + G   CL + P                   N++ L+  K CGNG V+ GE+CDCG   + E  +N CCN   C    GA CA G CC  Q C LK++GT+CR     +CDLPEYC G S +CP++VY  DG +C      +Y H  CY G C + + +C +LWG  A+ ++D C+ D+N  G+   NCG +           ++ N   C K  + CG++ C    ++    +   ++  I  G     C         D    L D G+V  G  CG G++C    C   +  E   C   CH +G CN+ GNCHC+ G++ P C
Sbjct:  132 VRGHPHSWVGISTCSGFRGLISL-NSSDTFYLEPLSDEASVRHSLRSTKHLPITGGSCAHPHHTSAFNLSSDWFPSHHSRVKRNTWGTT-------KYTELYIVADNEMFKRQNRD-YEKTKTRIMEIANYVDKFYRALNIRVPLIGLEVWTDRDQCIISKEPNATLWSFLQWRQKLKSRKKHDNAQLLTGVIFKGTTIGMAPLEGMCSLENSGGITVDH-SDLSIGAAATMAHEMGHNFGMSHDHDGC-CVEATANQGGCVMAAATGH-PFPRVFSRCSKRDLDSYFQKGGGMCLYNMP-------------------NMKDLVGGKKCGNGFVEDGEECDCG---EPEECTNNCCNANNCTLREGAQCAHGVCC--QNCKLKEAGTMCRG-PAGTCDLPEYCTGASPYCPANVYLLDGSAC------QYGHAYCYNGMCLTHQQQCLQLWGYGAQPAHDACFEDVNAAGNAFGNCGKD-----------EHGNYVKCDKSDAKCGKIQCHSAAKKPKGTNAVSIDTTIKTGGREVKCRGTYVYSTQDGQGDLPDPGLVVTGTKCGEGKVCRDRRCQNASFTELQGCIGRCHGNGVCNSNGNCHCNRGWAPPFC 692          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000076089.1 (SMESG000076089.1)

HSP 1 Score: 1932.92 bits (5006), Expect = 0.000e+0
Identity = 1028/1178 (87.27%), Postives = 1049/1178 (89.05%), Query Frame = 1
Query:  118 NDLSCNNEKYRYRLFNGNNLAELNKNSLTFCPNVWLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTNXXXXXXXXXXXXKFNHQSRXXXXXXXXXXXXXXXXXXXXXXXYHYRNRTWPYFVSFIKCPNYK--------FRRSKLLILCHKGIGKGHPKSSEIRNNESNVTLLSELRSIEGGSPDHLATVEIINAKNIEIRKVEKDNSQYSKPKRPVVINIDAKYISNEXXXXXXXXXXXXXXDRTFPVPMSVKEKAKYLENTK--EKLDFENHKCNEKVAIEKKPLNTHNFIKPEILSEKPTKNSNKTLNTVKPPILSAKPQKSVQSAKSPPVLGXXXXXXXXXXXXXXXTTEKPKKISNLEINSHETKSIPHKSVAIAPNIQENKSITEQPRGQNESLINKINKSKYTGKSVKPFKFQISEPTLDHSTNALASPTCQPFKPAREKGPDILSHIKPPKTEGDIKVFTNSKDEQNNIKLARPLKFQISQPRLEQTTCTDATQDLPVVDKTLTRTVAPHKVFKNDPSKAVNFRN 3621
            NDLSCNNEKYRYRLFNGNNLAELNKNSLTF PNVWLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKN FSVSLCNGISGIEKLYNSSK+IYFNSKKHENTTNVQVLSSSESESVPPRTADN YQQLYNAAD KFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSN+GKMNAVAMEPNGAPR IESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFD+DWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTNGDGGSIDSGPPPKFNHQSRLIITVILIVMIVILTIFVILVFIYHYRNRTWPYFVSFIKCPNYK        + + K  ++ +          ++  +NESN  L S        SPD    V                         P+ +   AKY+ N                         KEK  + EN K  EK+  E    N    I+ + L           SEKPTKNSNKTLNTVKPPILSAKPQKSVQSAKSPPVLGAKPQKPPAISPAPPITTEKPKKISNLEINSHETKSIPHKSVAIAPNIQ+NKSITEQPRGQNESL+NKINKSKYTGKSVKPFKFQISEPTLDHSTNALASPTCQPFKPAREKGPDILSHIKPPKTEGDIKVFTNSKDEQNNIKLARPLKFQISQPRLEQTTCTDAT+DLPVVDKTLTRTVAPHKVFKNDPSKAVNFRN
Sbjct:   17 NDLSCNNEKYRYRLFNGNNLAELNKNSLTFGPNVWLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNQFSVSLCNGISGIEKLYNSSKFIYFNSKKHENTTNVQVLSSSESESVPPRTADNFYQQLYNAADRKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNIGKMNAVAMEPNGAPRYIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDMDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTNGDGGSIDSGPPPKFNHQSRLIITVILIVMIVILTIFVILVFIYHYRNRTWPYFVSFIKCPNYKKVEKDNSQYSKPKRPVVIN--------IDAKYISNESNKPLYSPKSP---KSPDRTFPV-------------------------PMSVKEKAKYLEN------------------------TKEKLDF-ENHKCNEKVAIEKKPLNTHSVIKPEIL-----------SEKPTKNSNKTLNTVKPPILSAKPQKSVQSAKSPPVLGAKPQKPPAISPAPPITTEKPKKISNLEINSHETKSIPHKSVAIAPNIQQNKSITEQPRGQNESLVNKINKSKYTGKSVKPFKFQISEPTLDHSTNALASPTCQPFKPAREKGPDILSHIKPPKTEGDIKVFTNSKDEQNNIKLARPLKFQISQPRLEQTTCTDATRDLPVVDKTLTRTVAPHKVFKNDPSKAVNFRN 1122          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000076089.1 (SMESG000076089.1)

HSP 1 Score: 1599.72 bits (4141), Expect = 0.000e+0
Identity = 812/821 (98.90%), Postives = 815/821 (99.27%), Query Frame = 1
Query:  118 NDLSCNNEKYRYRLFNGNNLAELNKNSLTFCPNVWLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCNGISGIEKLYNSSKYIYFNSKKHENTTNVQVLXXXXXXXVPPRTADNLYQQLYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTNXXXXXXXXXXXXKFNHQSRXXXXXXXXXXXXXXXXXXXXXXXYHYRNRTWPYFVSFIKCPNYKFRRSKLLILCHKGIGKGHPKSSEIRNNESNVTLLSELRSIEGGSP 2580
            NDLSCNNEKYRYRLFNGNNLAELNKNSLTF PNVWLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKN FSVSLCNGISGIEKLYNSSK+IYFNSKKHENTTNVQVLSSSESESVPPRTADN YQQLYNAAD KFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSN+GKMNAVAMEPNGAPR IESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFD+DWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTNGDGGSIDSGPPPKFNHQSRLIITVILIVMIVILTIFVILVFIYHYRNRTWPYFVSFIKCPNYKFRRSKLLILCHKGIGKGHPKSSEIRNNESNVTLLSELRSIEGG P
Sbjct:   17 NDLSCNNEKYRYRLFNGNNLAELNKNSLTFGPNVWLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCLYSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNQFSVSLCNGISGIEKLYNSSKFIYFNSKKHENTTNVQVLSSSESESVPPRTADNFYQQLYNAADRKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNIGKMNAVAMEPNGAPRYIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLEIPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDMDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCTTNGDGGSIDSGPPPKFNHQSRLIITVILIVMIVILTIFVILVFIYHYRNRTWPYFVSFIKCPNYKFRRSKLLILCHKGIGKGHPKSSEIRNNESNVTLLSELRSIEGGIP 837          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000079144.1 (SMESG000079144.1)

HSP 1 Score: 372.859 bits (956), Expect = 7.803e-115
Identity = 202/498 (40.56%), Postives = 275/498 (55.22%), Query Frame = 1
Query:  763 LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN-KRGDLVANCGLEIP-READRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCT 2250
            +  LY+IVDS +         N    RI  I   IN  +    I F +I +EIW+ + I+++ E +IL EL++YK++ +N  HDCLH  LG      R+G++E  +MC  + CVGYT D  +QN    ++ V HE+ HNFGL HDT  C C  CIMATG+E  S   +WS+CS  +IKSLLK G          S    +     +P    +   S+  S CGNG+V+ GEQCDCG R  CE    KCCN  TC F+  + CA GSCC+ + C L  +GTICRN     CDL EYCNG+ E CP D+++QDG  C  K   + +HC+ G+C     +C+ LWG T+ VS+  CYD N +      NCGL +   +        +W TKPC K  SICGRLWC H+NE+    + QF          C A RF++DW   D GMVP+G  CG+  +C   +CV ++ I    C+C  +G C N+  C C   +  PNC+
Sbjct:   40 IFTLYLIVDSNLYQQSQESTEN----RIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKKKSVNINHDCLHLFLGSTYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFSTTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCE----KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRN-STTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNK-AHCFGGQCKDHGTQCRFLWGQTSNVSHSSCYDENTEENHAFKNCGLIVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEK----TNQF----------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCS 513          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000079144.1 (SMESG000079144.1)

HSP 1 Score: 372.859 bits (956), Expect = 8.985e-115
Identity = 202/498 (40.56%), Postives = 275/498 (55.22%), Query Frame = 1
Query:  763 LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN-KRGDLVANCGLEIP-READRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCT 2250
            +  LY+IVDS +         N    RI  I   IN  +    I F +I +EIW+ + I+++ E +IL EL++YK++ +N  HDCLH  LG      R+G++E  +MC  + CVGYT D  +QN    ++ V HE+ HNFGL HDT  C C  CIMATG+E  S   +WS+CS  +IKSLLK G          S    +     +P    +   S+  S CGNG+V+ GEQCDCG R  CE    KCCN  TC F+  + CA GSCC+ + C L  +GTICRN     CDL EYCNG+ E CP D+++QDG  C  K   + +HC+ G+C     +C+ LWG T+ VS+  CYD N +      NCGL +   +        +W TKPC K  SICGRLWC H+NE+    + QF          C A RF++DW   D GMVP+G  CG+  +C   +CV ++ I    C+C  +G C N+  C C   +  PNC+
Sbjct:   44 IFTLYLIVDSNLYQQSQESTEN----RIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKKKSVNINHDCLHLFLGSTYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFSTTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCE----KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRN-STTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNK-AHCFGGQCKDHGTQCRFLWGQTSNVSHSSCYDENTEENHAFKNCGLIVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEK----TNQF----------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCS 517          
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Match: SMESG000079144.1 (SMESG000079144.1)

HSP 1 Score: 372.474 bits (955), Expect = 1.150e-114
Identity = 202/498 (40.56%), Postives = 275/498 (55.22%), Query Frame = 1
Query:  763 LVELYIIVDSKMAAMFGGDNYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILMELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKDYYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNWSNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMPSKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCDLQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKITGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMN-KRGDLVANCGLEIP-READRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEIVNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNRCNCHEHGDCNNRGNCHCHPGFSAPNCT 2250
            +  LY+IVDS +         N    RI  I   IN  +    I F +I +EIW+ + I+++ E +IL EL++YK++ +N  HDCLH  LG      R+G++E  +MC  + CVGYT D  +QN    ++ V HE+ HNFGL HDT  C C  CIMATG+E  S   +WS+CS  +IKSLLK G          S    +     +P    +   S+  S CGNG+V+ GEQCDCG R  CE    KCCN  TC F+  + CA GSCC+ + C L  +GTICRN     CDL EYCNG+ E CP D+++QDG  C  K   + +HC+ G+C     +C+ LWG T+ VS+  CYD N +      NCGL +   +        +W TKPC K  SICGRLWC H+NE+    + QF          C A RF++DW   D GMVP+G  CG+  +C   +CV ++ I    C+C  +G C N+  C C   +  PNC+
Sbjct:   40 IFTLYLIVDSNLYQQSQESTEN----RIQSIFILINKIYLPLGIQFQIICIEIWKENLIEISQEEYILEELKIYKKKSVNINHDCLHLFLGSTYFFTRQGRAEFTTMCSKSSCVGYTVDSITQNIKYTAYTVSHELAHNFGLTHDTSDCGCENCIMATGVEFSSRKLDWSSCSISQIKSLLKLGFPCHSHLAQFSTTIFVKISRRQPMMKSKRTSSINISICGNGIVENGEQCDCGKRSDCE----KCCNFLTCKFSANSQCASGSCCNTEICKLYPTGTICRN-STTFCDLTEYCNGQDENCPIDIFRQDGTECLTKFNNK-AHCFGGQCKDHGTQCRFLWGQTSNVSHSSCYDENTEENHAFKNCGLIVTLNDKTYFDSFLDWPTKPCQKSNSICGRLWCIHDNEK----TNQF----------CEASRFEVDWNNRDIGMVPDGAVCGNKMVCSNGDCVPLDGIFDKSCHCFNNGICTNQKKCQCFQQYLPPNCS 513          
The following BLAST results are available for this feature:
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAM91.748e-6129.96ADAM metallopeptidase domain 9 [Source:HGNC Symbol... [more]
ADAM91.843e-6129.96ADAM metallopeptidase domain 9 [Source:HGNC Symbol... [more]
ADAM191.731e-6026.17ADAM metallopeptidase domain 19 [Source:HGNC Symbo... [more]
ADAM192.327e-6026.17ADAM metallopeptidase domain 19 [Source:HGNC Symbo... [more]
ADAM331.166e-5929.75ADAM metallopeptidase domain 33 [Source:HGNC Symbo... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adm-22.561e-5630.75ADAM (Disintegrin plus metalloprotease) family [S... [more]
adm-22.911e-5630.75ADAM (Disintegrin plus metalloprotease) family [S... [more]
unc-712.752e-4127.81Disintegrin and metalloproteinase domain-containin... [more]
sup-174.596e-1231.42Disintegrin and metalloproteinase domain-containin... [more]
adt-12.702e-621.72A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meltrin2.633e-7032.73gene:FBgn0265140 transcript:FBtr0301499[more]
Meltrin5.247e-7032.73gene:FBgn0265140 transcript:FBtr0301498[more]
mmd2.567e-5327.79gene:FBgn0259110 transcript:FBtr0299534[more]
mmd5.241e-5328.93gene:FBgn0259110 transcript:FBtr0340310[more]
mmd5.501e-5328.93gene:FBgn0259110 transcript:FBtr0310306[more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam8a4.827e-6832.09ADAM metallopeptidase domain 8a [Source:ZFIN;Acc:Z... [more]
adam154.907e-6531.72ADAM metallopeptidase domain 15 [Source:ZFIN;Acc:Z... [more]
adam155.380e-6531.72ADAM metallopeptidase domain 15 [Source:ZFIN;Acc:Z... [more]
adam8b5.288e-6429.26ADAM metallopeptidase domain 8b [Source:ZFIN;Acc:Z... [more]
zgc:1741647.552e-6130.34zgc:174164 [Source:ZFIN;Acc:ZDB-GENE-030131-4971][more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam338.902e-7234.31ADAM metallopeptidase domain 33 [Source:NCBI gene;... [more]
adam339.381e-7234.31ADAM metallopeptidase domain 33 [Source:NCBI gene;... [more]
adam331.474e-7033.79ADAM metallopeptidase domain 33 [Source:NCBI gene;... [more]
adam333.684e-7034.35ADAM metallopeptidase domain 33 [Source:NCBI gene;... [more]
adam336.852e-7034.64ADAM metallopeptidase domain 33 [Source:NCBI gene;... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adam331.526e-6226.97a disintegrin and metallopeptidase domain 33 [Sour... [more]
Adam331.526e-6226.97a disintegrin and metallopeptidase domain 33 [Sour... [more]
Adam196.568e-6228.21a disintegrin and metallopeptidase domain 19 (melt... [more]
Adam91.552e-6027.15a disintegrin and metallopeptidase domain 9 (meltr... [more]
Adam91.751e-6027.15a disintegrin and metallopeptidase domain 9 (meltr... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q923W9|ADA33_MOUSE1.067e-6126.97Disintegrin and metalloproteinase domain-containin... [more]
sp|O35674|ADA19_MOUSE4.594e-6128.21Disintegrin and metalloproteinase domain-containin... [more]
sp|Q13443|ADAM9_HUMAN8.851e-6129.96Disintegrin and metalloproteinase domain-containin... [more]
sp|Q9H013|ADA19_HUMAN1.117e-5926.17Disintegrin and metalloproteinase domain-containin... [more]
sp|Q61072|ADAM9_MOUSE1.225e-5927.15Disintegrin and metalloproteinase domain-containin... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NN211.767e-11237.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0V0J9H24.621e-11237.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A564YET53.750e-11037.67Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YGG33.957e-11037.67Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A419Q5658.788e-11037.52Disintegrin and metalloproteinase domain-containin... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam153.175e-6532.11ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
adam153.252e-6532.11ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
adam153.537e-6532.11ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
adam154.758e-6532.11ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
adam155.150e-6532.11ADAM metallopeptidase domain 15 [Source:NCBI gene;... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004527.13.050e-5830.56pep scaffold:Pmarinus_7.0:GL476950:296064:347055:1... [more]
ENSPMAT00000004524.14.120e-5630.56pep scaffold:Pmarinus_7.0:GL476950:296055:347085:1... [more]
ENSPMAT00000007858.11.184e-4928.38pep scaffold:Pmarinus_7.0:GL476347:375920:389428:1... [more]
ENSPMAT00000007654.11.091e-4828.54pep scaffold:Pmarinus_7.0:GL476707:60529:77379:-1 ... [more]
adam221.808e-4329.35ADAM metallopeptidase domain 22 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO371297.891e-3333.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371311.008e-2238.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308036.490e-1126.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471841.942e-927.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339831.018e-726.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015906.29.121e-6930.02zinc metalloproteinase-disintegrin-like atrase-A [... [more]
adam8a2.584e-6527.64disintegrin and metalloproteinase domain-containin... [more]
adam8a5.043e-6527.64disintegrin and metalloproteinase domain-containin... [more]
adam19a1.291e-6330.41disintegrin and metalloproteinase domain-containin... [more]
adam19a1.428e-6330.41disintegrin and metalloproteinase domain-containin... [more]
back to top
BLAST of Disintegrin and metalloproteinase domain-containing protein 15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076089.10.000e+087.27SMESG000076089.1[more]
SMESG000076089.10.000e+098.90SMESG000076089.1[more]
SMESG000079144.17.803e-11540.56SMESG000079144.1[more]
SMESG000079144.18.985e-11540.56SMESG000079144.1[more]
SMESG000079144.11.150e-11440.56SMESG000079144.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022458 ID=SMED30022458|Name=Disintegrin and metalloproteinase domain-containing protein 15|organism=Schmidtea mediterranea sexual|type=transcript|length=3738bp
ATTTTTTTAAATTTTAAATTTTATTTAATTTGACGCTAATGCAATAAGTT
GAGTTTCATTGAAAAATATATGCTCTATTTATTATACTCTATTTATATTT
TAATTGTATTCCTTATTAATGACCTTAGTTGCAATAATGAGAAATACAGA
TATCGATTATTTAATGGAAACAATCTAGCGGAATTAAATAAAAATTCTCT
AACTTTTTGTCCAAATGTATGGTTGAGACTAAATTCAATAAATAATCCCA
AATACAGTTTGTGGTTGCATTTGGAATTGAAAAAGCAAAATCAATTTCCG
ATCTTGGTTCGTAAAAATGAGAATAAAGTTGATTGGATTCAGACTGACAC
ACAATCTCATAAATGTCTCTACTCAGCCACGTCTAATTTAATCCCATATT
CCAATGAATTTTCATCTATGACGACAACAGAACGAATTGAGAAAGAAATA
AAATTTGTGTCGAATATTGCAGACATCGATGAGCATCATAAGAATCATTT
CTCAGTTAGCCTATGCAATGGGATTAGTGGCATTGAGAAATTATACAACA
GCTCAAAATATATTTATTTCAATTCCAAGAAGCACGAAAATACAACAAAT
GTGCAAGTATTGTCGTCATCCGAATCCGAATCAGTACCCCCTCGGACAGC
AGACAATTTATACCAACAATTATATAATGCAGCTGATTGGAAATTTTCTC
GACATCAACGTAGCAAGCGGTCAGCATTTCACATGCCAGTCAAAGAAATG
CCGGGTCCATATCTTGTGGAGTTGTATATTATTGTGGATTCTAAAATGGC
CGCAATGTTTGGAGGGGACAATTACAACAACTTATTCAGCCGGATCTCAT
TCATAATGAACCAGATCAATTTGGCATTCAGCCAGTTCAATATTTATTTC
ACCGTGATTCAGCTAGAAATATGGGAGCGTGATCAAATCAAATTGACGGA
TGAGAATCATATTCTAATGGAATTGCAGTTATATAAACGCAGATTCATCA
ACAAGCGTCACGACTGCCTCCATGCAATTTTAGGGGAAAATCTCGGCACA
GCCCGGCGAGGACAATCAGAGATGGCGTCTATGTGTGGCTACAACAGATG
TGTCGGATACACCAAAGATTATTATTCACAAAACGAAATAGACATTTCTC
ATGCTGTATTGCACGAGATCGGTCACAATTTTGGTTTGCATCACGACACG
GAACAGTGTAAATGTTACGGTTGCATAATGGCCACCGGTATCGAGTCGGG
TAGTTTTTCATTCAATTGGTCAAACTGTTCCAAACATGAGATAAAAAGTC
TTTTAAAATCTGGCATGGCTGACTGTTTGTTGGATGAGCCTCCATCTAAT
ATGGGAAAGATGAATGCTGTTGCCATGGAGCCAAATGGTGCCCCAAGAAA
TATTGAAAGTTTAATGCCATCAAAATGTGGCAATGGAGTCGTTGATAAAG
GCGAGCAATGTGATTGCGGAGGAAGGAAACAATGTGAAGCTGAATCTAAT
AAATGTTGCAATCCGGAAACGTGCTTATTTACTGTTGGGGCATCTTGCGC
TGGGGGTAGTTGTTGTGATTTGCAGAGATGTTCGTTAAAAAAATCTGGAA
CGATATGCAGAAATATTGAATTGGAAAGCTGTGATCTACCTGAGTATTGC
AATGGAGAATCAGAGTGGTGTCCTTCTGATGTTTACAAACAAGACGGAAT
TAGTTGCTCTAATAAAATAACTGGAGAATATTCTCATTGTTATCGAGGCA
AGTGTGCCAGTCGTAGACATCGGTGTCAAAAACTTTGGGGTGATACTGCA
GAGGTTTCTAATGATGTATGTTATGATATGAACAAAAGAGGTGATTTAGT
AGCTAATTGTGGGTTGGAAATACCCAGGGAAGCTGACAGAGACAGGCAAC
CGAAGAACTGGAATACAAAACCATGTTCGAAAGAAACCTCTATTTGTGGT
AGGCTTTGGTGCAGGCATGAAAATGAAAGAGTTTTGAGATTATCAGAGCA
ATTTTTAAATGATGAAATTGTGAATGGCTATCATTGCAGTGCTGTAAGAT
TTGATTTGGATTGGTACTTGGATGACTTTGGAATGGTGCCAAATGGAGTA
TCGTGTGGATCTGGAAGGATATGTTGGAAGAGTGAATGCGTTCTTGTGAA
TAGTATAGAACAGAATCGATGTAATTGTCACGAACATGGGGATTGTAACA
ATCGTGGAAATTGCCATTGTCATCCTGGATTTTCTGCTCCGAATTGTACG
ACAAATGGAGATGGCGGCAGCATTGACAGTGGACCGCCTCCAAAATTTAA
TCATCAATCAAGATTGATAATCACTGTCATTCTCATCGTAATGATAGTAA
TTCTCACTATTTTTGTAATATTGGTCTTTATATATCACTATCGAAATCGT
ACTTGGCCATATTTCGTCAGCTTTATCAAATGCCCTAATTACAAATTCCG
TCGATCAAAATTGTTGATATTGTGCCATAAAGGCATTGGAAAAGGACACC
CGAAATCGAGTGAAATTCGGAATAATGAATCCAATGTCACTCTTCTATCA
GAACTGCGGTCGATTGAAGGGGGATCCCCTGATCATTTGGCCACTGTTGA
AATAATTAATGCAAAAAATATTGAAATAAGAAAAGTGGAAAAGGATAATT
CTCAATATTCAAAACCCAAACGTCCAGTCGTAATAAACATTGATGCTAAA
TACATATCCAATGAATCTAATAAACCTCTCTACTCACCAAAATCGCCAAA
GAGTCCAGATAGAACCTTTCCAGTACCAATGTCTGTCAAAGAAAAAGCAA
AATATTTAGAAAATACCAAAGAAAAACTAGATTTTGAAAATCATAAATGT
AATGAAAAGGTTGCGATTGAAAAGAAACCTTTAAACACTCACAACTTCAT
TAAGCCTGAAATTCTCTCTGAAAAGCCCACGAAAAATTCCAATAAAACTT
TGAATACTGTTAAACCTCCCATTTTAAGTGCTAAACCACAGAAAAGCGTT
CAATCGGCAAAAAGTCCACCCGTATTAGGTGCAAAACCACAGAAACCACC
TGCAATCTCACCAGCTCCTCCTATAACCACAGAAAAACCCAAAAAGATCT
CAAATCTAGAAATCAATTCCCATGAAACTAAATCCATCCCTCACAAAAGT
GTTGCTATTGCACCCAATATCCAAGAAAACAAATCAATAACTGAACAGCC
TCGTGGCCAAAATGAAAGTTTGATCAACAAAATCAATAAATCTAAATATA
CAGGCAAATCTGTGAAACCGTTTAAATTCCAAATTTCTGAACCTACACTT
GACCACTCTACGAATGCTTTGGCATCGCCAACTTGTCAACCGTTTAAACC
AGCGAGAGAGAAAGGACCAGATATATTATCTCACATCAAGCCTCCGAAAA
CTGAAGGCGACATTAAAGTTTTCACGAATTCCAAAGATGAGCAGAATAAT
ATAAAATTGGCAAGACCTTTGAAATTTCAAATTTCTCAACCTCGACTTGA
ACAAACTACATGTACAGATGCAACCCAAGATCTTCCGGTTGTGGACAAAA
CTCTTACTAGAACTGTAGCTCCGCACAAAGTTTTTAAAAATGATCCAAGT
AAAGCTGTGAATTTTCGAAATTAGATTTATTATAATAACTTATTGGTATA
TTGTTTTTATCCTATGCCCTTTTTTGTTGTAAATCTGTTTTCGATCAGAT
ATTGATGAAGTAGTGCAATTTCTGATTTCAATTCTCAC
back to top

protein sequence of SMED30022458-orf-1

>SMED30022458-orf-1 ID=SMED30022458-orf-1|Name=SMED30022458-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1185bp
MLYLLYSIYILIVFLINDLSCNNEKYRYRLFNGNNLAELNKNSLTFCPNV
WLRLNSINNPKYSLWLHLELKKQNQFPILVRKNENKVDWIQTDTQSHKCL
YSATSNLIPYSNEFSSMTTTERIEKEIKFVSNIADIDEHHKNHFSVSLCN
GISGIEKLYNSSKYIYFNSKKHENTTNVQVLSSSESESVPPRTADNLYQQ
LYNAADWKFSRHQRSKRSAFHMPVKEMPGPYLVELYIIVDSKMAAMFGGD
NYNNLFSRISFIMNQINLAFSQFNIYFTVIQLEIWERDQIKLTDENHILM
ELQLYKRRFINKRHDCLHAILGENLGTARRGQSEMASMCGYNRCVGYTKD
YYSQNEIDISHAVLHEIGHNFGLHHDTEQCKCYGCIMATGIESGSFSFNW
SNCSKHEIKSLLKSGMADCLLDEPPSNMGKMNAVAMEPNGAPRNIESLMP
SKCGNGVVDKGEQCDCGGRKQCEAESNKCCNPETCLFTVGASCAGGSCCD
LQRCSLKKSGTICRNIELESCDLPEYCNGESEWCPSDVYKQDGISCSNKI
TGEYSHCYRGKCASRRHRCQKLWGDTAEVSNDVCYDMNKRGDLVANCGLE
IPREADRDRQPKNWNTKPCSKETSICGRLWCRHENERVLRLSEQFLNDEI
VNGYHCSAVRFDLDWYLDDFGMVPNGVSCGSGRICWKSECVLVNSIEQNR
CNCHEHGDCNNRGNCHCHPGFSAPNCTTNGDGGSIDSGPPPKFNHQSRLI
ITVILIVMIVILTIFVILVFIYHYRNRTWPYFVSFIKCPNYKFRRSKLLI
LCHKGIGKGHPKSSEIRNNESNVTLLSELRSIEGGSPDHLATVEIINAKN
IEIRKVEKDNSQYSKPKRPVVINIDAKYISNESNKPLYSPKSPKSPDRTF
PVPMSVKEKAKYLENTKEKLDFENHKCNEKVAIEKKPLNTHNFIKPEILS
EKPTKNSNKTLNTVKPPILSAKPQKSVQSAKSPPVLGAKPQKPPAISPAP
PITTEKPKKISNLEINSHETKSIPHKSVAIAPNIQENKSITEQPRGQNES
LINKINKSKYTGKSVKPFKFQISEPTLDHSTNALASPTCQPFKPAREKGP
DILSHIKPPKTEGDIKVFTNSKDEQNNIKLARPLKFQISQPRLEQTTCTD
ATQDLPVVDKTLTRTVAPHKVFKNDPSKAVNFRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001762Disintegrin_dom
IPR006586ADAM_Cys-rich
IPR024079MetalloPept_cat_dom_sf
IPR001590Peptidase_M12B
IPR013032EGF-like_CS
IPR000742EGF-like_dom
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008237metallopeptidase activity
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007229integrin-mediated signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane