G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30022430
Length (bp)1779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30022430) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30022430) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30022430) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30022430) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022430

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30022430h1SMcG0004198 dd_Smed_v4_18274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022430h1SMcG0004198 dd_Smed_v6_18274_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR2 (gene:FBgn0264002 transcript:FBtr0330360)

HSP 1 Score: 66.2402 bits (160), Expect = 4.741e-11
Identity = 44/151 (29.14%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  378 YFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLL---RTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKY 821
            YF   +CI+G+I N +N +VLTR  + + T  +++ LA  D + +L     TV  Y+    LP  E   L Y    F+ +  V    +   +S W+T+ LAV  YI + +  ++R++C +  +   I     +  LV  P+ +L+T   K+
Sbjct:   28 YFSLIVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTVHDYILSVRLPREE--QLSYSWACFIKFHSV-FPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIATAYVVCVLVVSPWLYLVTAIAKF 175          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR2 (gene:FBgn0264002 transcript:FBtr0330359)

HSP 1 Score: 65.4698 bits (158), Expect = 7.162e-11
Identity = 47/158 (29.75%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  378 YFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLL---RTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKY-ETNQRN 839
            YF   +CI+G+I N +N +VLTR  + + T  +++ LA  D + +L     TV  Y+    LP  E   L Y    F+ +  V    +   +S W+T+ LAV  YI + +  ++R++C +  +   I     +  LV  P+ +L+T   K+ ET   N
Sbjct:   28 YFSLIVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTVHDYILSVRLPREE--QLSYSWACFIKFHSV-FPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIATAYVVCVLVVSPWLYLVTAIAKFLETLDAN 182          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR2 (gene:FBgn0264002 transcript:FBtr0330358)

HSP 1 Score: 65.4698 bits (158), Expect = 7.162e-11
Identity = 47/158 (29.75%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  378 YFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLL---RTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKY-ETNQRN 839
            YF   +CI+G+I N +N +VLTR  + + T  +++ LA  D + +L     TV  Y+    LP  E   L Y    F+ +  V    +   +S W+T+ LAV  YI + +  ++R++C +  +   I     +  LV  P+ +L+T   K+ ET   N
Sbjct:   28 YFSLIVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTVHDYILSVRLPREE--QLSYSWACFIKFHSV-FPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIATAYVVCVLVVSPWLYLVTAIAKFLETLDAN 182          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR1 (gene:FBgn0035331 transcript:FBtr0072887)

HSP 1 Score: 63.929 bits (154), Expect = 1.950e-10
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  378 YFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLL---RTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKY 821
            Y    +CI+G+I N +N +VLTR  + + T  +++ LA  D + +L     T+  Y+  ++LP  E   L Y    F+ +  +    +   +S W+T+ LAV  YI + +  K+R++C +  +   I     +  LV  P  +L+T   +Y
Sbjct:   30 YVSLVVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTIHDYILTDSLPREE--KLSYSWACFIKFHSI-FAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITITTAYVVCVLVVSPSLYLITAITEY 177          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR1 (gene:FBgn0035331 transcript:FBtr0330187)

HSP 1 Score: 64.3142 bits (155), Expect = 1.988e-10
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  378 YFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLL---RTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKY 821
            Y    +CI+G+I N +N +VLTR  + + T  +++ LA  D + +L     T+  Y+  ++LP  E   L Y    F+ +  +    +   +S W+T+ LAV  YI + +  K+R++C +  +   I     +  LV  P  +L+T   +Y
Sbjct:   30 YVSLVVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTIHDYILTDSLPREE--KLSYSWACFIKFHSI-FAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITITTAYVVCVLVVSPSLYLITAITEY 177          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: W6UXS1 (Putative G-protein coupled receptor OS=Echinococcus granulosus OX=6210 GN=EGR_01868 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 3.100e-40
Identity = 134/351 (38.18%), Postives = 190/351 (54.13%), Query Frame = 3
Query:  375 IYFQFPICIIGSILNFINFLVLTRIGI-SNATYILMSALAFTDASTLLLRTVQ--TYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQK---AQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSF 1409
            +Y Q  IC+IG ILN IN  V  R    S   Y+L+ AL+  DA TL LR  Q  TY R  +        +    YI+  YAEVPITN+TEN+S W+T+ LA+E Y+ M+ +  +R Y T +N+K+LI  +  +S L NLP+F +     K   N   + I    A +R    S FY ++SW R  IVQ+ PL+ LC+ N LL + VY+ N+  F  N +    + + S  L    +   E +    +S        + LI ++QK   AQ KL ILLI +I+LFL G IP AF+Y+ I   F  C++  +   CP + +YR VT  + L  Y L FF+Y FLN H++N  
Sbjct:   33 VYVQPCICLIGFILNIINIYVFQRKTFCSTPAYMLVLALSIADAITLGLRIPQGLTYYRGSS---SVTQTMAIYAYIYATYAEVPITNMTENMSAWLTVCLALERYVAMRHWNFARQYSTRQNTKRLIISIALVSVLFNLPYFMIHRIEFKRFANGSMRVITNATALRR----STFYTVYSWFRMTIVQIIPLVFLCILNVLLITIVYQHNKK-FGKNTE----VEQKSNHL----SLGTEGTGADETSLKDTTVGDLQLIQRRQKKRNAQRKLNILLIAVILLFLFGAIPQAFSYIRIFEAFGTCEEAFHY--CPTYVVYRMVTTNIALISYGLTFFLYFFLNQHFRNEL 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A068WK46 (G protein coupled receptor OS=Echinococcus granulosus OX=6210 GN=EgrG_000234800 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 3.157e-40
Identity = 134/351 (38.18%), Postives = 190/351 (54.13%), Query Frame = 3
Query:  375 IYFQFPICIIGSILNFINFLVLTRIGI-SNATYILMSALAFTDASTLLLRTVQ--TYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQK---AQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSF 1409
            +Y Q  IC+IG ILN IN  V  R    S   Y+L+ AL+  DA TL LR  Q  TY R  +        +    YI+  YAEVPITN+TEN+S W+T+ LA+E Y+ M+ +  +R Y T +N+K+LI  +  +S L NLP+F +     K   N   + I    A +R    S FY ++SW R  IVQ+ PL+ LC+ N LL + VY+ N+  F  N +    + + S  L    +   E +    +S        + LI ++QK   AQ KL ILLI +I+LFL G IP AF+Y+ I   F  C++  +   CP + +YR VT  + L  Y L FF+Y FLN H++N  
Sbjct:   41 VYVQPCICLIGFILNIINIYVFQRKTFCSTPAYMLVLALSIADAITLGLRIPQGLTYYRGSS---SVTQTMAIYAYIYATYAEVPITNMTENMSAWLTVCLALERYVAMRHWNFARQYSTRQNTKRLIISIALVSVLFNLPYFMIHRIEFKRFANGSMRVITNATALRR----STFYTVYSWFRMTIVQIIPLVFLCILNVLLITIVYQHNKK-FGKNTE----VEQKSNHL----SLGTEGTGADETSLKDTTVGDLQLIQRRQKKRNAQRKLNILLIAVILLFLFGAIPQAFSYIRIFEAFGTCEEAFHY--CPTYVVYRMVTTNIALISYGLTFFLYFFLNQHFRNEL 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A087W1C0 (G protein coupled receptor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000234800 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 5.402e-39
Identity = 134/348 (38.51%), Postives = 187/348 (53.74%), Query Frame = 3
Query:  375 IYFQFPICIIGSILNFINFLVLTRIGI-SNATYILMSALAFTDASTLLLRTVQ--TYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSF 1409
            +Y Q  IC+IG ILN IN  V  R    S   Y+L+ AL+  DA TL LR  Q  TY R  +        +    YI+  YAEVPITN+TEN+S W+T+ LA+E Y+ M+ +  +R Y T + +K+LI  +  +S L NLP+F +     K   N   + I    A +R    S FY ++SW R  IVQ+ PL+ LC+ N LL + VY+ N+  F  N +  +     S  L +    A E S    +    +L  R     KK+ AQ KL ILLI +I+LFL G IP AF+Y+ I   F  C++  +   CP + +YR VT  + L  Y L FF+Y FLN H++N  
Sbjct:   41 VYVQPCICLIGFILNIINIYVFQRKTFCSTPAYMLVLALSIADAITLGLRIPQGLTYYRGSS---SVTQTMAIYAYIYATYAEVPITNMTENMSAWLTVCLALERYVAMRHWNFARQYSTRQITKRLIISIALVSVLFNLPYFMIHRIEFKRFANGSMRVITNATALRR----STFYTVYSWFRMTIVQIIPLVFLCILNVLLITIVYQHNKK-FGKNTEVEQKGNHLS--LGTEGTGADETSLKDTTVGDSQLIQRR---QKKRNAQRKLNILLIAVILLFLFGAIPQAFSYIRIFEAFGTCEEAFHY--CPTYVVYRMVTTNIALISYGLTFFLYFFLNRHFRNEL 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3X330 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7715 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.033e-38
Identity = 132/350 (37.71%), Postives = 190/350 (54.29%), Query Frame = 3
Query:  375 IYFQFPICIIGSILNFINFLVLTRIGI-SNATYILMSALAFTDASTLLLRTVQ--TYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSI--KAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSF 1409
            +Y Q  IC+IG ILN IN  V  R    S   Y+L+ AL+  DA TL LR  Q  TY R  +        +    YI+  YAEVPITN+TEN+S W+T+ LA+E Y+ M+ +  +R YCT +N+K+LI  +  +S   NLP+F +     +  TN   + +    A +R    S FY ++SW R   VQ+ PL+ LC+ N LL + VY+ N+    +      T+ K   +  S+  +    E +S + ++      T+     KK+ AQ KL ILLI II+LFL G IP AF+Y+ I   F  CK+  +   CP + +YR VT  + L  Y L FF+Y FLN H++N  
Sbjct:   33 VYVQPCICLIGFILNIINSYVFQRKTFCSTPAYMLVLALSIADAITLGLRIPQGLTYYRGSS---SVTQTMAIYAYIYATYAEVPITNMTENMSAWLTVCLALERYVAMRHWNFTRQYCTRQNTKRLIVGIALVSVFFNLPYFMIHRIEFRRFTNGSMRVVTNPTALRR----SQFYTVYSWFRMIAVQIIPLVFLCILNVLLITIVYQHNKKIGKN------TVMKGKDNRLSLCTEGSGAEEASLKETTVGDSRSTQRR--QKKRNAQRKLNILLIAIILLFLFGAIPQAFSYIRIFEAFGTCKEAFHY--CPTYVIYRMVTTNIALISYGLTFFLYFFLNRHFRNEL 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3W7Y4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6427 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.850e-38
Identity = 133/346 (38.44%), Postives = 186/346 (53.76%), Query Frame = 3
Query:  375 IYFQFPICIIGSILNFINFLVLTRIGISNA-TYILMSALAFTDASTLLLRTVQ--TYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQN 1403
            +Y Q  IC +G ILN IN  V  R   S+   Y+L+ AL+  DA TL LR  Q  TY R  +        +    YI+  YAEVPITN+TEN+S W+T+ LA+E Y+ M+ +  +R Y T +N+K+LI  +  +S   NLP+F +     +   N   + I    A +R    S FY ++SW R   VQ+ PL+ LC+ N LL + VY+ N+  F  N +  +   + S  L +  + A E S    +     L  R     KK+ AQ KL ILLI II+LFL G IP AF+Y+ I   F  CK+      CP + +YR VT  + L  Y L FF+Y FLN H++N
Sbjct:   33 VYVQPCICFVGFILNIINSYVFQRRTFSSTPAYMLVLALSIADAITLGLRIPQGLTYYRGSS---SVTQTMAIYAYIYATYAEVPITNMTENMSAWLTVCLALERYVAMRHWNFTRQYSTRQNTKRLIISIALVSVFFNLPYFMIHRIEFRRFANGSMRVITNTTALRR----SQFYTVYSWFRMTTVQIIPLVFLCILNVLLITIVYQHNKK-FGKNTEMEQKGNRLS--LGAEGSGAEELSLKDTTMGDSWLTQRR---QKKRNAQRKLNILLIAIILLFLFGAIPQAFSYIRIFEAFGTCKEA--FHYCPTYVIYRMVTTNIALISYGLTFFLYFFLNRHFRN 363          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000035759.1 (SMESG000035759.1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 389/391 (99.49%), Postives = 389/391 (99.49%), Query Frame = 3
Query:  306 MKNFSNLTLENGTNHEPLIDLLLIYFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSFFTLFRIPKQNCLNFRLFEIKLKN 1478
            MKNFSNLT ENGTNHEPLID LLIYFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMFPLLLLCVFNGLLFSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKLTILLIVIIILFLIGQIPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSFFTLFRIPKQNCLNFRLFEIKLKN
Sbjct:    1 MKNFSNLTPENGTNHEPLIDFLLIYFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMFPLLLLCVFNGLLFSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKLTILLIVIIILFLIGQIPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSFFTLFRIPKQNCLNFRLFEIKLKN 391          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000035759.1 (SMESG000035759.1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 334/334 (100.00%), Postives = 334/334 (100.00%), Query Frame = 3
Query:  477 MSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSFFTLFRIPKQNCLNFRLFEIKLKN 1478
            MSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMFPLLLLCVFNGLLFSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKLTILLIVIIILFLIGQIPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSFFTLFRIPKQNCLNFRLFEIKLKN
Sbjct:    1 MSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMFPLLLLCVFNGLLFSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKLTILLIVIIILFLIGQIPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSFFTLFRIPKQNCLNFRLFEIKLKN 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000068527.1 (SMESG000068527.1)

HSP 1 Score: 209.92 bits (533), Expect = 9.415e-61
Identity = 153/368 (41.58%), Postives = 215/368 (58.42%), Query Frame = 3
Query:  324 LTLENGTNHE-PLIDLLLIYFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETN-QRNQSIPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNSFFTLF 1421
            +T  NGTN   P  +LL+++ Q PICI+G  LN INF V  +     A Y+L+SAL+  DA TLLL   +T  +C+ L FC+ P L+   Y+F LY + P++NITE +S  IT+ALA E Y+ M+ +   ++Y TV+N++  + L++  STL N PFFF  T  + +E      Q +PVVY+     +DS FY  HSW R   +QM PLL LC+ N LL + +   N+   +    Y            SI       S   C SP      + S+  +KQ AQ KLTILL +II L+LIGQIP A AY+ I+R F +C +   + +CP +++YR+VT I+ LA Y+LNFFVY FLNSH++ S    F
Sbjct:    1 MTAVNGTNDNVPTTELLVVFLQGPICIVGFGLNIINFSVFVKRKYFAAPYVLLSALSLADAVTLLLYFTETMAKCQHLAFCKQPYLQLSAYVFALYVKNPLSNITETISSIITVALATERYLAMRHYNFRKIYFTVKNTRLFVLLISVFSTLFNTPFFFTTTIKISWENETSTKQKVPVVYSNYTSLIDSYFYSTHSWTRAIAIQMLPLLYLCICNSLLLALICHHNKRLDSIRTSY------------SISTDCRSTSHMVCESPMSNQTNQSSIRERKQIAQTKLTILLSIIIFLYLIGQIPSALAYIKIYRKFHSCDNFEVIHECPSYDMYRTVTSIMMLASYALNFFVYFFLNSHFRKSLCDCF 356          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000044466.1 (SMESG000044466.1)

HSP 1 Score: 199.134 bits (505), Expect = 1.113e-57
Identity = 146/347 (42.07%), Postives = 213/347 (61.38%), Query Frame = 3
Query:  378 YFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQSIP-VVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVYKRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPS---PKLETRMSLISKKQKAQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNS 1406
            Y Q PIC+IG  LN +N +V  +    ++ Y L+S+LA  DA TL+LR  Q  +  E  P C  P L+  +Y+FV++ E P+TNITE +S W+TL+LA+E ++ MK  + S++YCT++N K L   +  ++ ++NLP+FF     +K E N  +Q     +Y  +  F  S  Y +HSW+R  IVQ  PLLLLCVFN LLF  VY  NR  F + R             NSI   + + S    S PS     ++ + + I KK +AQ KLTILLI +I+LFLIGQIPH+FAY+ I++  S  K   +  +  ++ ++R+ TM+LTL CYSLNFF+Y+FLN+H+++S
Sbjct:   31 YIQIPICLIGFCLNVVNVIVFYKNIHHSSLYFLVSSLALADAVTLILRASQGLLGKECWPLCSSPQLRMYVYMFVIFLEFPVTNITETISNWLTLSLAIERFLAMKHHSFSKVYCTLKNFKILTSFICIIALIINLPYFFTYNVILKKEYNNESQMYEKAIYTNESHFSLSQIYEVHSWIRQVIVQFLPLLLLCVFNFLLFQIVYNHNRKLFVTPRC----------GTNSIIIDSTKESQRLISKPSLSKHPIKEKSTAIEKKLRAQKKLTILLITVILLFLIGQIPHSFAYIKIYKAVS--KYSKFDPEGFEYRMFRTSTMVLTLLCYSLNFFIYLFLNTHFRHS 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000051347.1 (SMESG000051347.1)

HSP 1 Score: 191.43 bits (485), Expect = 1.352e-54
Identity = 138/352 (39.20%), Postives = 206/352 (58.52%), Query Frame = 3
Query:  363 DLLLIYFQFPICIIGSILNFINFLVLTRIGISNATYILMSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVLYAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFLLTFLSTLVNLPFFFLMTTSVKYETNQRNQS-IPVVYAKKRQFMDSIFYPIHSWLRFCIVQMXXXXXXXXXXXXXXSTVY--KRNRNYFNSNRQYFKTLRKWSKDLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKXXXXXXXXXXXXXXXXXPHAFAYVGIHRFFSN-CKDLTYLKDCPKHELYRSVTMILTLACYSLNFFVYIFLNSHYQNS 1406
            + L +Y Q P+C+IG ILN INF +  +   S A Y+L+ A++  D+ TL+ R  +  V+C +L FC  P L+  +Y+F ++ EVPITNITE++S W  +ALA E YI M ++  S+ Y TV N+K  +  +T LS ++N PFF++    +++E    +Q  +PV+Y+       S FY  H+W R  IV++ PLL LCV N LL + V+  K+    F S R  +      +KD N I                           +KQ+AQ KLT+LLIV+I+LFLIGQIP +F+Y+ ++    N C    YL DCP +++Y SV+ +L + CY  NFFVY+ LN+H++NS
Sbjct:   12 EFLDVYVQAPLCLIGFILNLINFSIFAQKKFSAAPYVLLMAMSLVDSITLIFRISEAVVKCTSLSFCRNPYLQMVMYLFAVFIEVPITNITESISNWTAVALATERYIAMCYYNLSKQYSTVYNAKLFLLFVTLLSIVLNSPFFYINYVVIEWENTTSHQGMVPVIYSSFSSLALSKFYTFHTWFRPFIVKVIPLLFLCVCNFLLLALVWEHKKKLKQFQSKRSGYLN----TKDNNKIT-------------------------QRKQRAQNKLTMLLIVVIVLFLIGQIPVSFSYLKVYENLPNRCNAYKYLTDCPNYKVYSSVSHLLMITCYCTNFFVYLALNNHFRNS 334          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MsR24.741e-1129.14gene:FBgn0264002 transcript:FBtr0330360[more]
MsR27.162e-1129.75gene:FBgn0264002 transcript:FBtr0330359[more]
MsR27.162e-1129.75gene:FBgn0264002 transcript:FBtr0330358[more]
MsR11.950e-1027.81gene:FBgn0035331 transcript:FBtr0072887[more]
MsR11.988e-1027.81gene:FBgn0035331 transcript:FBtr0330187[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UXS13.100e-4038.18Putative G-protein coupled receptor OS=Echinococcu... [more]
A0A068WK463.157e-4038.18G protein coupled receptor OS=Echinococcus granulo... [more]
A0A087W1C05.402e-3938.51G protein coupled receptor OS=Echinococcus multilo... [more]
A0A0R3X3301.033e-3837.71G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3W7Y42.850e-3838.44G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035759.10.000e+099.49SMESG000035759.1[more]
SMESG000035759.10.000e+0100.00SMESG000035759.1[more]
SMESG000068527.19.415e-6141.58SMESG000068527.1[more]
SMESG000044466.11.113e-5742.07SMESG000044466.1[more]
SMESG000051347.11.352e-5439.20SMESG000051347.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022430 ID=SMED30022430|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1779bp
GTCATAACAGAGCCTTCTACAGTAAACATAGGCATTTCAGAAATTCGGCT
GTTTATTTGACGAAGAACTTTTTTAATTCTTTCTAGTTAAAGGGATTTAT
CGTAACAATGTTTGTATGAAGTTACAAATTGTATGAAGTTAAACTCGTGG
GTGCCACTTCAATTCTCGTTGGATTCAACTATGCTGTGACAAAATTTTCA
AAACGGTTCTAAAGGTTTACAAAATCGTTTCCAGATCACGGAATTCCCAA
CATTAACAGGACAATTTTCTAAATCGAAATCGAGCAATATTTAAACAAAT
TTTCAATGAAAAACTTTTCAAACCTCACTCTGGAAAATGGCACAAATCAT
GAACCGTTGATCGATTTGTTATTGATTTATTTCCAATTTCCGATTTGTAT
TATCGGATCAATTTTAAATTTTATTAATTTTTTGGTATTGACGAGAATCG
GCATTTCAAATGCCACTTACATCCTGATGAGTGCCCTGGCATTTACGGAC
GCGTCGACTCTGTTGCTGAGAACAGTTCAGACTTATGTCAGATGTGAAAC
GCTGCCATTTTGTGAAATGCCTAACCTCAAATACAAACTTTACATATTCG
TTCTTTATGCAGAGGTGCCGATCACAAACATCACCGAGAATTTGTCATGT
TGGATCACCCTAGCCCTTGCCGTTGAACACTATATTCAAATGAAATTCTT
CACCAAGTCTCGACTTTACTGTACAGTGGAAAACTCGAAAAAACTAATTT
TTCTTTTAACATTTTTAAGCACTCTCGTAAATTTGCCCTTCTTTTTCCTA
ATGACAACCAGCGTCAAGTACGAAACTAATCAGAGAAATCAGTCAATTCC
AGTCGTTTATGCTAAAAAGCGGCAGTTTATGGATTCCATATTCTACCCGA
TTCATTCTTGGTTGAGATTTTGCATCGTCCAGATGTTTCCACTGCTTCTT
TTGTGCGTCTTCAACGGTCTTTTGTTTTCAACGGTTTACAAACGAAACAG
AAATTATTTCAACAGCAATCGGCAATACTTTAAAACACTGCGCAAATGGT
CAAAAGACTTGAATTCCATCAAAGCCCAGGCGATTGAACATTCTTCAGGT
CAGTGCTCGTCACCGAGTCCGAAACTCGAGACTCGAATGTCATTGATTTC
GAAAAAGCAGAAAGCTCAATATAAATTAACAATTTTATTAATTGTCATAA
TTATTCTGTTTCTGATTGGTCAAATTCCCCACGCGTTCGCATATGTTGGA
ATTCACAGATTTTTCAGTAACTGCAAAGATTTGACATATCTCAAAGATTG
CCCGAAACACGAATTATATCGATCAGTAACGATGATCCTCACTCTCGCCT
GTTACTCGCTGAATTTTTTCGTCTACATTTTTCTTAACTCCCACTACCAA
AATTCATTTTTCACTTTGTTTAGAATTCCAAAACAAAATTGTTTGAATTT
TCGATTGTTCGAAATCAAATTAAAAAATTGAATTAAAAACGATTTTTTGT
TTAAATTGATGTTTGATTTAATGATTAGATGTTTTTGGAGGTCAAATCGA
GCTGGTAAACAAATCGAAACGAACCAGATTTTGTCCAGCTGACTTATTTG
ATCACAACCCTGAAGAGAGAAAATTATATATATATATATTTTTTTTCATA
TTTTTTGACAAACAGAAATTTGGGTGAGATTTATTTTTATCATGAAATTC
TTTGTGAAATTCTTTGTGGGAGGAAATGACTTTTTTTCTAATTATTCATT
GTTTATGACGGTTAAAAGTTCAGATTTTG
back to top

protein sequence of SMED30022430-orf-1

>SMED30022430-orf-1 ID=SMED30022430-orf-1|Name=SMED30022430-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
MKNFSNLTLENGTNHEPLIDLLLIYFQFPICIIGSILNFINFLVLTRIGI
SNATYILMSALAFTDASTLLLRTVQTYVRCETLPFCEMPNLKYKLYIFVL
YAEVPITNITENLSCWITLALAVEHYIQMKFFTKSRLYCTVENSKKLIFL
LTFLSTLVNLPFFFLMTTSVKYETNQRNQSIPVVYAKKRQFMDSIFYPIH
SWLRFCIVQMFPLLLLCVFNGLLFSTVYKRNRNYFNSNRQYFKTLRKWSK
DLNSIKAQAIEHSSGQCSSPSPKLETRMSLISKKQKAQYKLTILLIVIII
LFLIGQIPHAFAYVGIHRFFSNCKDLTYLKDCPKHELYRSVTMILTLACY
SLNFFVYIFLNSHYQNSFFTLFRIPKQNCLNFRLFEIKLKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR0194277TM_GPCR_serpentine_rcpt_Srw
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0008528G-protein coupled peptide receptor activity
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 9..379
e-value: 2.0E-33
score: 117.7
NoneNo IPR availablePANTHERPTHR47760FAMILY NOT NAMEDcoord: 24..378
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 21..247
e-value: 1.10414E-24
score: 100.4
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 10..378
NoneNo IPR availableTMHMMTMhelixcoord: 23..45
NoneNo IPR availableTMHMMTMhelixcoord: 202..224
NoneNo IPR availableTMHMMTMhelixcoord: 291..313
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 147..169
IPR0194277TM GPCR, serpentine receptor class w (Srw)PFAMPF103247TM_GPCR_Srwcoord: 26..238
e-value: 3.9E-10
score: 39.5
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 34..357
score: 13.411