Rho-GAP domain-containing protein

Overview
NameRho-GAP domain-containing protein
Smed IDSMED30022429
Length (bp)1970
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho-GAP domain-containing protein (SMED30022429) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho-GAP domain-containing protein (SMED30022429) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho-GAP domain-containing protein (SMED30022429) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho-GAP domain-containing protein (SMED30022429) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022429

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30022429h1SMcG0014016 dd_Smed_v4_8320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022429h1SMcG0014016 dd_Smed_v6_8320_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30022429h1SMcG0014016 SMED30022429smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
enteric muscle cellSMED30022429h1SMcG0014016 dd_Smed_v4_8320_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: ARHGAP20 (Rho GTPase activating protein 20 [Source:HGNC Symbol;Acc:HGNC:18357])

HSP 1 Score: 77.7962 bits (190), Expect = 3.696e-14
Identity = 54/203 (26.60%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FG+ L  + +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +G+E+     +++ +A+V+K +  ++PG +F        +S      D+ + +   ++L Q+P AN  L   +FG+L  +  H                 S   + T F LA  VA S+   ++   +SSPE +E   T    L++ F
Sbjct:  337 FGISLPNICEND--NLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEVHLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFGVLHNIEQH-----------------SSSNQMTAFNLAVCVAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 516          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: ARHGAP20 (Rho GTPase activating protein 20 [Source:HGNC Symbol;Acc:HGNC:18357])

HSP 1 Score: 77.7962 bits (190), Expect = 3.855e-14
Identity = 54/203 (26.60%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FG+ L  + +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +G+E+     +++ +A+V+K +  ++PG +F        +S      D+ + +   ++L Q+P AN  L   +FG+L  +  H                 S   + T F LA  VA S+   ++   +SSPE +E   T    L++ F
Sbjct:  363 FGISLPNICEND--NLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEVHLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFGVLHNIEQH-----------------SSSNQMTAFNLAVCVAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 542          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: ARHGAP20 (Rho GTPase activating protein 20 [Source:HGNC Symbol;Acc:HGNC:18357])

HSP 1 Score: 77.7962 bits (190), Expect = 3.980e-14
Identity = 54/203 (26.60%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FG+ L  + +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +G+E+     +++ +A+V+K +  ++PG +F        +S      D+ + +   ++L Q+P AN  L   +FG+L  +  H                 S   + T F LA  VA S+   ++   +SSPE +E   T    L++ F
Sbjct:  327 FGISLPNICEND--NLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEVHLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFGVLHNIEQH-----------------SSSNQMTAFNLAVCVAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 506          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: ARHGAP20 (Rho GTPase activating protein 20 [Source:HGNC Symbol;Acc:HGNC:18357])

HSP 1 Score: 77.7962 bits (190), Expect = 3.980e-14
Identity = 54/203 (26.60%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FG+ L  + +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +G+E+     +++ +A+V+K +  ++PG +F        +S      D+ + +   ++L Q+P AN  L   +FG+L  +  H                 S   + T F LA  VA S+   ++   +SSPE +E   T    L++ F
Sbjct:  327 FGISLPNICEND--NLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEVHLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFGVLHNIEQH-----------------SSSNQMTAFNLAVCVAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 506          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Match: ARHGAP20 (Rho GTPase activating protein 20 [Source:HGNC Symbol;Acc:HGNC:18357])

HSP 1 Score: 77.7962 bits (190), Expect = 4.280e-14
Identity = 54/203 (26.60%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FG+ L  + +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +G+E+     +++ +A+V+K +  ++PG +F        +S      D+ + +   ++L Q+P AN  L   +FG+L  +  H                 S   + T F LA  VA S+   ++   +SSPE +E   T    L++ F
Sbjct:  340 FGISLPNICEND--NLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEVHLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFGVLHNIEQH-----------------SSSNQMTAFNLAVCVAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 519          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Match: rga-9 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2X0T1Z3])

HSP 1 Score: 115.161 bits (287), Expect = 5.516e-27
Identity = 106/381 (27.82%), Postives = 175/381 (45.93%), Query Frame = 1
Query:  205 GKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYS--MVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLC-----TSSPENVE--KAATVLRCLIL----DFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNI-----SESYKTKSSNSGNIPNSQKQLQRRPEYFELPI-VMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEY 1290
            G++ K+KFGVP+    +   H +P  L  LL+ + ++G    D++R PGN  Q+RK+  ++ +G  +   ++ +YT A+V+KK+   LP G+FGR  E  L ++ S  M  +++R VF++I   +P A++ L +L+FG  FR+V+   + +S  A N                   A+A SVA S+FH C     T+  E+++  K A+ + C I+    D   F  E  ++Y R T  +      R F F +    S F   +     +E  + + S S         + R        +  +L     DVE +S D   +  +     D  +S           V + Q   MR RS+WFL+  S  N     S S +Y
Sbjct:   21 GRIEKVKFGVPIN---EAFAHDIPATLLMLLLKVNKDGPAKKDIWRAPGNQAQVRKLSQVMQHGRLVNIENFTVYTAASVIKKFLSKLPNGIFGRDNEETLFNSASTGMDIEKQRQVFYRIFGSLPVASQHLLVLLFGT-FRVVADSSDGHS-NAMN-----------------PNAIAISVAPSLFHTCIHDGRTARVEDLQRFKLASNIVCSIICSFGDTKLFPRECYEYYARYTGRTLRIDENRMFTFHNPS--SCFSMRVPTIQENEPMRNQPSTSRATTKPMPTMARLNNRLSSSVGEVLIEGISDVEELS-DLDIIRPLTACGGDRSLSY-------LQYVHENQARRMRSRSEWFLSPVS--NAKKTSSKSVDY 367          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Match: rga-9 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2X0T1Z3])

HSP 1 Score: 109.768 bits (273), Expect = 1.351e-26
Identity = 78/253 (30.83%), Postives = 132/253 (52.17%), Query Frame = 1
Query:  205 GKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYS--MVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLC-----TSSPENVE--KAATVLRCLIL----DFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSD 924
            G++ K+KFGVP+    +   H +P  L  LL+ + ++G    D++R PGN  Q+RK+  ++ +G  +   ++ +YT A+V+KK+   LP G+FGR  E  L ++ S  M  +++R VF++I   +P A++ L +L+FG  FR+V+   + +S  A N                   A+A SVA S+FH C     T+  E+++  K A+ + C I+    D   F  E  ++Y R T  +      R F F +
Sbjct:   21 GRIEKVKFGVPIN---EAFAHDIPATLLMLLLKVNKDGPAKKDIWRAPGNQAQVRKLSQVMQHGRLVNIENFTVYTAASVIKKFLSKLPNGIFGRDNEETLFNSASTGMDIEKQRQVFYRIFGSLPVASQHLLVLLFGT-FRVVADSSDGHS-NAMN-----------------PNAIAISVAPSLFHTCIHDGRTARVEDLQRFKLASNIVCSIICSFGDTKLFPRECYEYYARYTGRTLRIDENRMFTFHN 251          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Match: rga-9 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2X0T1Z3])

HSP 1 Score: 111.309 bits (277), Expect = 1.839e-26
Identity = 78/251 (31.08%), Postives = 131/251 (52.19%), Query Frame = 1
Query:  205 GKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYS--MVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLC-----TSSPENVE--KAATVLRCLIL----DFPSFDEEFVDFYYRSTLISYGSQYQRYFQF 918
            G++ K+KFGVP+    +   H +P  L  LL+ + ++G    D++R PGN  Q+RK+  ++ +G  +   ++ +YT A+V+KK+   LP G+FGR  E  L ++ S  M  +++R VF++I   +P A++ L +L+FG  FR+V+   + +S  A N                   A+A SVA S+FH C     T+  E+++  K A+ + C I+    D   F  E  ++Y R T  +      R F F
Sbjct:   21 GRIEKVKFGVPIN---EAFAHDIPATLLMLLLKVNKDGPAKKDIWRAPGNQAQVRKLSQVMQHGRLVNIENFTVYTAASVIKKFLSKLPNGIFGRDNEETLFNSASTGMDIEKQRQVFYRIFGSLPVASQHLLVLLFGT-FRVVADSSDGHS-NAMN-----------------PNAIAISVAPSLFHTCIHDGRTARVEDLQRFKLASNIVCSIICSFGDTKLFPRECYEYYARYTGRTLRIDENRMFTF 249          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: RhoGAP71E (gene:FBgn0036518 transcript:FBtr0332092)

HSP 1 Score: 99.7525 bits (247), Expect = 9.522e-23
Identity = 62/206 (30.10%), Postives = 107/206 (51.94%), Query Frame = 1
Query:  160 IMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTS 774
            + SC     + AY   +L K+KFGVPLE++  K  +++P PL  L++ L +E     D+FR PG+   M+K+I  L  G  +   +Y+++T+A+V+KK+   +P G+FGR  E+ L +   +  E ++    H++   +P   + L +L+FG  FR+++                  S     +  + +EA+  SVA S F  C S
Sbjct:   19 VTSCGHPATAPAY-PYRLEKVKFGVPLEEVC-KHNNNIPGPLLVLILKLNKESPNRRDVFRAPGHQGAMKKLIHFLQAGRLVNVDNYSVFTIASVLKKFLRKIPNGIFGRSGEMELFAINDLQNEAEQTERLHRLFGSLPKYTQHLLVLLFGT-FRVIA------------------SNAAHASTGMTSEALGVSVAPSFFQSCVS 203          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: RhoGAP71E (gene:FBgn0036518 transcript:FBtr0332093)

HSP 1 Score: 100.523 bits (249), Expect = 3.628e-22
Identity = 62/206 (30.10%), Postives = 107/206 (51.94%), Query Frame = 1
Query:  160 IMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTS 774
            + SC     + AY   +L K+KFGVPLE++  K  +++P PL  L++ L +E     D+FR PG+   M+K+I  L  G  +   +Y+++T+A+V+KK+   +P G+FGR  E+ L +   +  E ++    H++   +P   + L +L+FG  FR+++                  S     +  + +EA+  SVA S F  C S
Sbjct:   19 VTSCGHPATAPAY-PYRLEKVKFGVPLEEVC-KHNNNIPGPLLVLILKLNKESPNRRDVFRAPGHQGAMKKLIHFLQAGRLVNVDNYSVFTIASVLKKFLRKIPNGIFGRSGEMELFAINDLQNEAEQTERLHRLFGSLPKYTQHLLVLLFGT-FRVIA------------------SNAAHASTGMTSEALGVSVAPSFFQSCVS 203          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: RhoGAP71E (gene:FBgn0036518 transcript:FBtr0075567)

HSP 1 Score: 101.293 bits (251), Expect = 4.960e-22
Identity = 62/206 (30.10%), Postives = 107/206 (51.94%), Query Frame = 1
Query:  160 IMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTS 774
            + SC     + AY   +L K+KFGVPLE++  K  +++P PL  L++ L +E     D+FR PG+   M+K+I  L  G  +   +Y+++T+A+V+KK+   +P G+FGR  E+ L +   +  E ++    H++   +P   + L +L+FG  FR+++                  S     +  + +EA+  SVA S F  C S
Sbjct:   19 VTSCGHPATAPAYPY-RLEKVKFGVPLEEVC-KHNNNIPGPLLVLILKLNKESPNRRDVFRAPGHQGAMKKLIHFLQAGRLVNVDNYSVFTIASVLKKFLRKIPNGIFGRSGEMELFAINDLQNEAEQTERLHRLFGSLPKYTQHLLVLLFGT-FRVIA------------------SNAAHASTGMTSEALGVSVAPSFFQSCVS 203          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: RhoGAP71E (gene:FBgn0036518 transcript:FBtr0303510)

HSP 1 Score: 101.293 bits (251), Expect = 4.991e-22
Identity = 62/206 (30.10%), Postives = 107/206 (51.94%), Query Frame = 1
Query:  160 IMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTS 774
            + SC     + AY   +L K+KFGVPLE++  K  +++P PL  L++ L +E     D+FR PG+   M+K+I  L  G  +   +Y+++T+A+V+KK+   +P G+FGR  E+ L +   +  E ++    H++   +P   + L +L+FG  FR+++                  S     +  + +EA+  SVA S F  C S
Sbjct:   19 VTSCGHPATAPAYPY-RLEKVKFGVPLEEVC-KHNNNIPGPLLVLILKLNKESPNRRDVFRAPGHQGAMKKLIHFLQAGRLVNVDNYSVFTIASVLKKFLRKIPNGIFGRSGEMELFAINDLQNEAEQTERLHRLFGSLPKYTQHLLVLLFGT-FRVIA------------------SNAAHASTGMTSEALGVSVAPSFFQSCVS 203          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Match: RhoGAP71E (gene:FBgn0036518 transcript:FBtr0290065)

HSP 1 Score: 101.679 bits (252), Expect = 5.692e-22
Identity = 62/206 (30.10%), Postives = 107/206 (51.94%), Query Frame = 1
Query:  160 IMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTS 774
            + SC     + AY   +L K+KFGVPLE++  K  +++P PL  L++ L +E     D+FR PG+   M+K+I  L  G  +   +Y+++T+A+V+KK+   +P G+FGR  E+ L +   +  E ++    H++   +P   + L +L+FG  FR+++                  S     +  + +EA+  SVA S F  C S
Sbjct:   19 VTSCGHPATAPAYPY-RLEKVKFGVPLEEVC-KHNNNIPGPLLVLILKLNKESPNRRDVFRAPGHQGAMKKLIHFLQAGRLVNVDNYSVFTIASVLKKFLRKIPNGIFGRSGEMELFAINDLQNEAEQTERLHRLFGSLPKYTQHLLVLLFGT-FRVIA------------------SNAAHASTGMTSEALGVSVAPSFFQSCVS 203          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: tagapa (T cell activation RhoGTPase activating protein a [Source:ZFIN;Acc:ZDB-GENE-040426-1877])

HSP 1 Score: 73.559 bits (179), Expect = 3.803e-13
Identity = 38/133 (28.57%), Postives = 76/133 (57.14%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLF-GRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILF 621
            FG  L ++ QK     P+P+ D+L+ L ++G+ T  +FRR GN+  +++I   L +GIE++  ++ +  +A+++K +   LPGGL    K++  + +     EDQ+ +    +++ +P  N +L   +  +LF
Sbjct:   70 FGRALSEICQKD-GSPPEPIMDILILLQRKGLHTEGVFRRAGNTKAVKEIKAQLNDGIEVDLKEHPVIWLADLIKDFLRHLPGGLLMSEKYKDWMDAMEKEDEDQKCAEIKMLINTLPVPNIQLLKHLIVLLF 201          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: tagapa (T cell activation RhoGTPase activating protein a [Source:ZFIN;Acc:ZDB-GENE-040426-1877])

HSP 1 Score: 73.1738 bits (178), Expect = 4.722e-13
Identity = 38/133 (28.57%), Postives = 76/133 (57.14%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLF-GRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILF 621
            FG  L ++ QK     P+P+ D+L+ L ++G+ T  +FRR GN+  +++I   L +GIE++  ++ +  +A+++K +   LPGGL    K++  + +     EDQ+ +    +++ +P  N +L   +  +LF
Sbjct:   87 FGRALSEICQKD-GSPPEPIMDILILLQRKGLHTEGVFRRAGNTKAVKEIKAQLNDGIEVDLKEHPVIWLADLIKDFLRHLPGGLLMSEKYKDWMDAMEKEDEDQKCAEIKMLINTLPVPNIQLLKHLIVLLF 218          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: tagapa (T cell activation RhoGTPase activating protein a [Source:ZFIN;Acc:ZDB-GENE-040426-1877])

HSP 1 Score: 73.1738 bits (178), Expect = 4.722e-13
Identity = 38/133 (28.57%), Postives = 76/133 (57.14%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLF-GRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILF 621
            FG  L ++ QK     P+P+ D+L+ L ++G+ T  +FRR GN+  +++I   L +GIE++  ++ +  +A+++K +   LPGGL    K++  + +     EDQ+ +    +++ +P  N +L   +  +LF
Sbjct:   87 FGRALSEICQKD-GSPPEPIMDILILLQRKGLHTEGVFRRAGNTKAVKEIKAQLNDGIEVDLKEHPVIWLADLIKDFLRHLPGGLLMSEKYKDWMDAMEKEDEDQKCAEIKMLINTLPVPNIQLLKHLIVLLF 218          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: dlc1 (DLC1 Rho GTPase activating protein [Source:ZFIN;Acc:ZDB-GENE-130206-12])

HSP 1 Score: 57.7658 bits (138), Expect = 4.313e-8
Identity = 53/204 (25.98%), Postives = 87/204 (42.65%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDM----LANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCT-----SSPENVEKAATV 807
            FGVPL+ + Q+S   LP+ +   + YL  + +    LFR+ G  ++++ +  M     A G  + +     Y VA+++K+YF  LP  L   K     L  Y  V ++QR       +  +P+ NRE A+         V+  V E  +   N                    +A  +A S+FHL T     SSP  + +  T+
Sbjct:  683 FGVPLQVIVQRSGQPLPQSIQQAMRYLRSQCLDQVGLFRKSGVKSRIQALRQMNESCGAVGGGVNYEGQLAYDVADMLKQYFRDLPEPLLTSKLSDTFLQIYQYVPKEQRLQAVRAAVLLLPDENRE-ALQTLLCFLSDVTASVGENQMTCTN--------------------LAVCLAPSLFHLNTLRRESSSPRVMNRKNTL 865          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-23e4.3 (si:dkeyp-23e4.3 [Source:ZFIN;Acc:ZDB-GENE-091118-19])

HSP 1 Score: 56.9954 bits (136), Expect = 6.084e-8
Identity = 90/398 (22.61%), Postives = 161/398 (40.45%), Query Frame = 1
Query:  214 SKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDML-ANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYS-MVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNS-----QKQLQRRPEYFELPIVMLTNPFGDVENM-STDSSPVLKIKFTKDDDDISLKSSR-SSDYDRVQQRQLD-LMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQ-YQIIATSGP 1374
            S+  F VPL +  Q+S   LP  +   + +L  + +    LFR+ G  ++++ + DM+ A+   + + + + + VA++VK+YF  LP  +F  K     L  Y    +DQ+       ++ +P+ NRE A+    +  + V   V E  +   N                    +A  +A S+FHL  S   +      V R   L  P   +   +      L    ++  R FQ         +ET+ + S+K  S  +  +P+S     + +L  R   F L   +L       +   S  SS  + +   K DD   L+  R +++ D  QQ     ++R +S W  +      + T   D   Y Y     G         L+ +Q+ +++GP
Sbjct:  576 SRKVFEVPLLQSVQQSGKPLPPSILRAMEFLRTKCLDQVGLFRKSGVKSRIQNLRDMVEADPDGVSFENQSAFDVADMVKQYFRDLPEPIFSSKLCESFLHIYQYFPKDQQFVGVQAAIYLLPDENRE-ALQSLLLFLQEVVACVEENQMTPTN--------------------IAVCLAPSLFHL-NSFKRDRTSMRWVQRKYSLGRPDQRDLSENLAATQGLSHMVTECSRLFQIP-----KYWETHGAGSFKEDSQQNDAVPSSVSRSGENELPDRARLFLLTQKLLREARDKSKGWTSCLSSDHVDVAVKKVDDGYPLRLWRGTTEVDAPQQEVFQRILREQSQWQRDLTHSEVVETLDKDVEVYHYTLQAAGARPPLQHVLLRTWQLDSSTGP 946          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: gapvd1 (GTPase activating protein and VPS9 domains 1 [Source:Xenbase;Acc:XB-GENE-997388])

HSP 1 Score: 67.3958 bits (163), Expect = 6.639e-11
Identity = 38/134 (28.36%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLS--TYSMVEDQRRSVFHKILHQMPNANRELAILMFGILF 621
            FG+ L+ +      ++PKP+ D+L  L ++G  T  +FRR  N+   R++ + L +G EI +   ++   A+V K +  ++PG +F  K     +S   Y   ED+ ++V   ++  +P  N  L   +FG+L+
Sbjct:  363 FGLSLDAICDND--NIPKPVMDMLCVLCRDGPFTRGIFRRSANAKSCREMKERLDSGCEINFERESILVTASVFKDFLRNIPGSIFSSKLYEKWVSVLAYESQEDKIKAV-KMLIETLPQINVLLLRYLFGVLY 493          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: gapvd1 (GTPase activating protein and VPS9 domains 1 [Source:Xenbase;Acc:XB-GENE-997388])

HSP 1 Score: 67.0106 bits (162), Expect = 8.009e-11
Identity = 38/134 (28.36%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLS--TYSMVEDQRRSVFHKILHQMPNANRELAILMFGILF 621
            FG+ L+ +      ++PKP+ D+L  L ++G  T  +FRR  N+   R++ + L +G EI +   ++   A+V K +  ++PG +F  K     +S   Y   ED+ ++V   ++  +P  N  L   +FG+L+
Sbjct:  303 FGLSLDAICDND--NIPKPVMDMLCVLCRDGPFTRGIFRRSANAKSCREMKERLDSGCEINFERESILVTASVFKDFLRNIPGSIFSSKLYEKWVSVLAYESQEDKIKAV-KMLIETLPQINVLLLRYLFGVLY 433          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: gapvd1 (GTPase activating protein and VPS9 domains 1 [Source:Xenbase;Acc:XB-GENE-997388])

HSP 1 Score: 66.6254 bits (161), Expect = 8.983e-11
Identity = 38/134 (28.36%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLS--TYSMVEDQRRSVFHKILHQMPNANRELAILMFGILF 621
            FG+ L+ +      ++PKP+ D+L  L ++G  T  +FRR  N+   R++ + L +G EI +   ++   A+V K +  ++PG +F  K     +S   Y   ED+ ++V   ++  +P  N  L   +FG+L+
Sbjct:  303 FGLSLDAICDND--NIPKPVMDMLCVLCRDGPFTRGIFRRSANAKSCREMKERLDSGCEINFERESILVTASVFKDFLRNIPGSIFSSKLYEKWVSVLAYESQEDKIKAV-KMLIETLPQINVLLLRYLFGVLY 433          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: trhd (tumorhead [Source:Xenbase;Acc:XB-GENE-1214876])

HSP 1 Score: 65.0846 bits (157), Expect = 3.109e-10
Identity = 37/146 (25.34%), Postives = 76/146 (52.05%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRK-FELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLE 660
            FG+ L  + +    +LPKP+ D+L+ L +EG  T  +FRR  N+   +++ + L +G E++    +++  A V+  +  ++P  +     + L + +T     + +  +  ++L Q+P AN  L   +FG+L     H++ + S E
Sbjct:  354 FGLSLSSVCRNG--NLPKPIMDMLLLLYEEGPNTKGIFRRSANAKTWKELKEKLISGDEVQIDGESVFVAAAVITDFLRNIPDSILSSDMYGLWMEATEIEQHEYKIDIIKRLLEQLPEANFILLQHLFGVL-----HHIEKKSEE 492          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000033897.1 (rho GTPase-activating protein 7-like [Source:NCBI gene;Acc:100490096])

HSP 1 Score: 58.9214 bits (141), Expect = 2.252e-8
Identity = 55/225 (24.44%), Postives = 98/225 (43.56%), Query Frame = 1
Query:  106 TKQTFNYFSCGTMSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYS-MVEDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCT 771
            +KQ +N++       + N+   +R  R+  Y    +    FGVP     Q++ H +PK +   + YL    +    LFR+ G  ++++ + +M     + + +   + + VA++VK+YF  LP  +F  K     L  Y  + +DQ+       +  +P+ NRE L IL++    R V   V E  +   N                    +A  +A S+FHL T
Sbjct:  580 SKQGWNWY-------VMNVPKFIRKIRAPDYKDKNV----FGVPFLLNVQRTGHPIPKSILQAMEYLRIHFLDQVGLFRKSGVKSRIQTLREMNEQDSKYVNYEGQSAFDVADMVKQYFRDLPEPIFTSKLCESFLHIYQYLPKDQQPHAVQAAILLLPDENREALKILLY--FLRDVVACVTENQMTPTN--------------------IAVCLAPSLFHLNT 771          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Arhgap20 (Rho GTPase activating protein 20 [Source:MGI Symbol;Acc:MGI:2445175])

HSP 1 Score: 75.0998 bits (183), Expect = 2.157e-13
Identity = 54/203 (26.60%), Postives = 99/203 (48.77%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FGV L  L +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +GIE+     +++ +A+V+K +  ++P  +F        +       D+ + ++  ++L Q+P AN      +FG+L     H + ++SL  +             T F LA  +A S+   ++   +SSPE +E   T    L++ F
Sbjct:  327 FGVSLPDLCEND--NLPKPILDMLSFLNQKGPLTKGIFRQSANMKSCRELKEKLNSGIEVHLDCESIFVIASVLKDFLRNIPESIFSSDLYDHWVCVMDQGNDEEKINIIQRLLDQLPRANVVFLRYLFGVL-----HNIEQHSLSNQ------------MTAFNLAVCIAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 506          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Arhgap20 (Rho GTPase activating protein 20 [Source:MGI Symbol;Acc:MGI:2445175])

HSP 1 Score: 75.0998 bits (183), Expect = 2.180e-13
Identity = 54/203 (26.60%), Postives = 99/203 (48.77%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FGV L  L +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +GIE+     +++ +A+V+K +  ++P  +F        +       D+ + ++  ++L Q+P AN      +FG+L     H + ++SL  +             T F LA  +A S+   ++   +SSPE +E   T    L++ F
Sbjct:  363 FGVSLPDLCEND--NLPKPILDMLSFLNQKGPLTKGIFRQSANMKSCRELKEKLNSGIEVHLDCESIFVIASVLKDFLRNIPESIFSSDLYDHWVCVMDQGNDEEKINIIQRLLDQLPRANVVFLRYLFGVL-----HNIEQHSLSNQ------------MTAFNLAVCIAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 542          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Dlc1 (deleted in liver cancer 1 [Source:MGI Symbol;Acc:MGI:1354949])

HSP 1 Score: 58.151 bits (139), Expect = 3.683e-8
Identity = 51/190 (26.84%), Postives = 82/190 (43.16%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPEN 786
            FGVPL    Q+S   LP+ +   + YL    +    LFR+ G  ++++ +  M  +  + + +   + Y VA+++K+YF  LP  L   K     L  Y  V +DQR       +  +P+ NRE L  L++      V+  V E  +   N                    +A  +A S+FHL T   EN
Sbjct: 1091 FGVPLTVNVQRSGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNESAEDNVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREVLQTLLY--FLSDVTAAVKENQMTPTN--------------------LAVCLAPSLFHLNTLKREN 1258          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Dlc1 (deleted in liver cancer 1 [Source:MGI Symbol;Acc:MGI:1354949])

HSP 1 Score: 57.3806 bits (137), Expect = 5.159e-8
Identity = 51/190 (26.84%), Postives = 82/190 (43.16%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPEN 786
            FGVPL    Q+S   LP+ +   + YL    +    LFR+ G  ++++ +  M  +  + + +   + Y VA+++K+YF  LP  L   K     L  Y  V +DQR       +  +P+ NRE L  L++      V+  V E  +   N                    +A  +A S+FHL T   EN
Sbjct:  640 FGVPLTVNVQRSGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNESAEDNVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREVLQTLLY--FLSDVTAAVKENQMTPTN--------------------LAVCLAPSLFHLNTLKREN 807          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Match: Dlc1 (deleted in liver cancer 1 [Source:MGI Symbol;Acc:MGI:1354949])

HSP 1 Score: 57.3806 bits (137), Expect = 5.615e-8
Identity = 51/190 (26.84%), Postives = 82/190 (43.16%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPEN 786
            FGVPL    Q+S   LP+ +   + YL    +    LFR+ G  ++++ +  M  +  + + +   + Y VA+++K+YF  LP  L   K     L  Y  V +DQR       +  +P+ NRE L  L++      V+  V E  +   N                    +A  +A S+FHL T   EN
Sbjct:  674 FGVPLTVNVQRSGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNESAEDNVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREVLQTLLY--FLSDVTAAVKENQMTPTN--------------------LAVCLAPSLFHLNTLKREN 841          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P2F6|RHG20_HUMAN (Rho GTPase-activating protein 20 OS=Homo sapiens OX=9606 GN=ARHGAP20 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 1.851e-13
Identity = 54/203 (26.60%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FG+ L  + +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +G+E+     +++ +A+V+K +  ++PG +F        +S      D+ + +   ++L Q+P AN  L   +FG+L  +  H                 S   + T F LA  VA S+   ++   +SSPE +E   T    L++ F
Sbjct:  363 FGISLPNICEND--NLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEVHLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFGVLHNIEQH-----------------SSSNQMTAFNLAVCVAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 542          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6IFT4|RHG20_MOUSE (Rho GTPase-activating protein 20 OS=Mus musculus OX=10090 GN=Arhgap20 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.525e-12
Identity = 54/203 (26.60%), Postives = 99/203 (48.77%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            FGV L  L +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +GIE+     +++ +A+V+K +  ++P  +F        +       D+ + ++  ++L Q+P AN      +FG+L     H + ++SL  +             T F LA  +A S+   ++   +SSPE +E   T    L++ F
Sbjct:  363 FGVSLPDLCEND--NLPKPILDMLSFLNQKGPLTKGIFRQSANMKSCRELKEKLNSGIEVHLDCESIFVIASVLKDFLRNIPESIFSSDLYDHWVCVMDQGNDEEKINIIQRLLDQLPRANVVFLRYLFGVL-----HNIEQHSLSNQ------------MTAFNLAVCIAPSI---LWPPASSSPE-LENEFTKKVSLLIQF 542          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6REY9|RHG20_RAT (Rho GTPase-activating protein 20 OS=Rattus norvegicus OX=10116 GN=Arhgap20 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 6.554e-12
Identity = 49/187 (26.20%), Postives = 91/187 (48.66%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPE 783
            FGV L  + +    +LPKP+ D+L +L Q+G  T  +FR+  N    R++ + L +GIE+     +++ +A+V+K +  ++P  +F        +       D+ + +   ++L Q+P AN      +FG+L     H + ++SL  +             T F LA  +A S+   ++   +SSPE
Sbjct:  363 FGVSLPDICEND--NLPKPILDMLSFLNQKGPLTKGIFRQSANMKSCRELKEKLNSGIEVHLDCESIFVIASVLKDFLRNIPESIFSSDLYDHWVCVMDQGNDEEKINTIQRLLDQLPRANVVFLRYLFGVL-----HNIEQHSLSNQ------------MTAFNLAVCIAPSI---LWPPASSSPE 527          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|B9VTT2|RHG07_CANLF (Rho GTPase-activating protein 7 OS=Canis lupus familiaris OX=9615 GN=DLC1 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 5.049e-8
Identity = 51/190 (26.84%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPEN 786
            FGVPL    Q++   LP+ +   + YL    +    LFR+ G  ++++ +  M  + I+ + +   + Y VA+++K+YF  LP  L   K     L  Y  V +DQR       +  +P+ NRE L  L++      V+  V E  +   N                    +A  +A S+FHL T   EN
Sbjct:  639 FGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNESAIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQCVPKDQRLQAMKAAIMLLPDENREVLQTLLY--FLSDVTAAVKENQMTPTN--------------------LAVCLAPSLFHLNTLKREN 806          
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96QB1|RHG07_HUMAN (Rho GTPase-activating protein 7 OS=Homo sapiens OX=9606 GN=DLC1 PE=1 SV=4)

HSP 1 Score: 60.077 bits (144), Expect = 6.740e-8
Identity = 51/190 (26.84%), Postives = 82/190 (43.16%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPEN 786
            FGVPL    Q++   LP+ +   + YL    +    LFR+ G  ++++ +  M    I+ + +   + Y VA+++K+YF  LP  L   K     L  Y  V +DQR       +  +P+ NRE L  L++      V+  V E  +   N                    +A  +A S+FHL T   EN
Sbjct: 1076 FGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNEGAIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREVLQTLLY--FLSDVTAAVKENQMTPTN--------------------LAVCLAPSLFHLNTLKREN 1243          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A267G3Y3 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013813g2 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.691e-41
Identity = 90/225 (40.00%), Postives = 126/225 (56.00%), Query Frame = 1
Query:  214 SKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQ-RRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPS---FDEEFVDFYYRST 876
            S++KFGVPL ++ + S   LP PL DLLV++A++G+  NDLFRRPGN   M++II  L  G  I+W DYN +T ANV KK+ +++P G+FGR  E  LL+     +   R      I+  +    R+L  L+FG   RM                   CS  P+  + V  EAVAKSVAGS+FH CT  P+ VE AA V+  LI  F +   F E+ + ++  +T
Sbjct:   69 SRLKFGVPLAEVCRVSGGSLPTPLCDLLVHVARDGVAVNDLFRRPGNPGDMKRIIRCLGEGRPIDWRDYNYWTAANVAKKFLLAIPDGVFGRDGEAALLAAIDQPDRAVRLKTMRDIIRGLSPPVRQLTSLLFGTWHRM-------------------CSASPE-ADGVPVEAVAKSVAGSMFHSCTDDPKKVEHAAKVMEALISGFTNPELFGEDLIRYFAVAT 273          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A267GRD0 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013813g1 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.865e-41
Identity = 90/225 (40.00%), Postives = 126/225 (56.00%), Query Frame = 1
Query:  214 SKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQ-RRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPS---FDEEFVDFYYRST 876
            S++KFGVPL ++ + S   LP PL DLLV++A++G+  NDLFRRPGN   M++II  L  G  I+W DYN +T ANV KK+ +++P G+FGR  E  LL+     +   R      I+  +    R+L  L+FG   RM                   CS  P+  + V  EAVAKSVAGS+FH CT  P+ VE AA V+  LI  F +   F E+ + ++  +T
Sbjct:   69 SRLKFGVPLAEVCRVSGGSLPTPLCDLLVHVARDGVAVNDLFRRPGNPGDMKRIIRCLGEGRPIDWRDYNYWTAANVAKKFLLAIPDGVFGRDGEAALLAAIDQPDRAVRLKTMRDIIRGLSPPVRQLTSLLFGTWHRM-------------------CSASPE-ADGVPVEAVAKSVAGSMFHSCTDDPKKVEHAAKVMEALISGFTNPELFGEDLIRYFAVAT 273          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: R7TWZ0 (Rho-GAP domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225958 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.130e-40
Identity = 88/205 (42.93%), Postives = 124/205 (60.49%), Query Frame = 1
Query:  220 IKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDF 831
            +KFGVP+    +     LP PL D++VY+AQEG+ T+DLFRR GN   +R II  L+ G ++++S+YN YT+A+V+KK+ + +PGG FG + E  LL    +    R+  + H IL  +P A ++L  L+FG  FR+V+HY  EY+                    + +EAVAKSVA S+FH C  SPE VEKA  VL+ LI DF
Sbjct:   25 VKFGVPIADALRDD--KLPAPLVDMMVYIAQEGVTTSDLFRRNGNPTDLRMIIKRLSEGKDVDYSNYNFYTLASVLKKFLLKIPGGAFGPEKEQQLLDVLELDTRIRQYDIIHDILETLPEATQQLLALLFGTWFRLVNHY--EYN-------------------SMSSEAVAKSVAPSLFHTCADSPEMVEKAVNVLQILIDDF 206          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A4Z2CV90 (Rho GTPase-activating protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_007320 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.003e-39
Identity = 124/410 (30.24%), Postives = 198/410 (48.29%), Query Frame = 1
Query:  142 MSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHY-VNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPS---FDEEFVDFYY--RSTLISYGSQYQRYFQFSDSGKQSQ---------FETNISESYKTKSSNSG-----NIPNSQKQLQRRPEYFELPIVM------------LTNPFGDVENMSTDSSPVLKIKFTKDDD----DISLK-------SSRSSDYDRVQQRQLDLMRLRSDWFLN 1239
            M + +NI  C+        +S +++++ F V + +  +    ++P  + DLLVY+A+EG+   DLFRRPGN   M+KII  L  G  I+W+DYN YT+AN+ K+Y + + GG+ G + E  LLST  + +DQ R    H ++       ++L  L+FGI FRM+ H  VN  S+                      EAVAKSVAGS+F  CT++P  VE+A+ V+  LI  F S   F  E ++++     T IS   +++  F+F     + +          E      +   + ++G     N P  Q+  ++R      PI              L NP     N    S+   K+  ++ D     D  +K       SS+S  ++ V++RQL+ ++ RSDWFL+
Sbjct:    4 MPLFENIRKCVSRRHG---LSRRVTRVLFNVKINESFK--SQNVPSQIRDLLVYIAREGVAVTDLFRRPGNPQDMKKIISDLEAGRPIKWTDYNFYTLANIAKRYLLHIEGGILGPESEEKLLSTLDIPDDQARIEAMHSVIVSQSKPVQQLLALLFGIWFRMIYHTEVNAMSV----------------------EAVAKSVAGSVFPSCTTTPRKVERASKVMEYLITGFASADLFSRELIEYFTLETKTSISRVEKFKYEFRFPKDVPREKSVRLFVRMLLEEGRKHGFHLINDDTGEFDLMNAP-IQQTSEKRTCVTTAPIGKTVVNLDPLKTHDLPNPISTGNNADHPST-NFKLPSSQPDGNRGHDTKIKSAAYRTPSSQSVCFNSVKRRQLERLQKRSDWFLS 384          
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Match: A0A4E0RHY1 (RhoGAP OS=Fasciola hepatica OX=6192 GN=D915_001858 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.845e-39
Identity = 98/266 (36.84%), Postives = 145/266 (54.51%), Query Frame = 1
Query:  142 MSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRR-SVFHKILHQMPNANRELAILMFGILFRMVSHY-VNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPS---FDEEFVDFYYRSTL--ISYGSQYQRYFQF 918
            M ++ NI  C+        ++ + +++ F V +E   +    ++P  L DLLVY+A+EG+   DLFRRPGN   M+KII  L  G  I WSDYN YT+AN+ K+Y + + GG+ GR  E  L+S  ++ +DQ R    H +L   P   ++L  L+FGI FRM+ H  VN  S+                      EAVAKSVAGS+F  CT+SP+ VE+A+ V+  LI  F S   F  E ++++   T   IS   +++  F+F
Sbjct:    1 MPLLDNIRKCVSRRHG---LTRRPTRVLFNVRIEDSFK--TQNVPSQLRDLLVYIAREGVAVTDLFRRPGNPQDMKKIISDLEAGRPITWSDYNFYTLANIAKRYLLHIEGGILGRSSEEKLISMLNLPDDQSRIEGMHSVLISQPKPVQQLLALLFGIWFRMIYHTEVNAMSV----------------------EAVAKSVAGSLFPSCTTSPQKVERASKVMEYLITGFASADLFSRELIEYFTSETRTSISRVEKFKYEFRF 239          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: arhgap20b (Rho GTPase activating protein 20b [Source:ZFIN;Acc:ZDB-GENE-060526-383])

HSP 1 Score: 71.633 bits (174), Expect = 1.225e-13
Identity = 47/159 (29.56%), Postives = 76/159 (47.80%), Query Frame = 1
Query:  175 RGYRSNAYVSGK-----LSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSH 636
            RGY S +   GK      S   FG PL  +      +LP+P+ DLL  L  EG KT  +FRR  N+   R + + L +G  +     +++T A+++ ++   LPG + G +     +      + Q R    K+L ++P  +R L   +FGIL  +  H
Sbjct:   19 RGYSSQS--EGKNQPDSASSKLFGQPLTSVCTDG--NLPRPVMDLLCVLYHEGPKTLGVFRRSANAKNCRVLKERLNSGHHVPLHGESVFTAASLLTEFLRKLPGSVLGCELYEDWMEVMDSDDLQDRYALAKVLEKLPQESRSLLCYVFGILHSIHKH 173          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000053633.1 (rho GTPase-activating protein 20-like [Source:NCBI gene;Acc:103036999])

HSP 1 Score: 67.3958 bits (163), Expect = 4.259e-11
Identity = 40/152 (26.32%), Postives = 77/152 (50.66%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSM---VEDQRRSVFHKILHQMPNAN----RELAILMFGILFRMVSHYVNEYSL 657
            FG+PL  +     + LPKP+ D+LV+L QEG  T  +FRR   +   R++ D+L +G + I+ +  +++ +A V K +  S+PG L         ++T       ED +      ++  +P+ N    + +  +++ I  R   + +N ++L
Sbjct:  362 FGLPLSVVCTD--NSLPKPIMDMLVFLYQEGPFTRGIFRRSAGAKACRELRDILDSGFQDIQLARQSIFVIAAVFKDFLRSIPGSLLLSDLYEKWMATMDSSDEAEDNQLQAIQSLVTSLPSENILLLKHILAVLYNIQLRAEENQMNAFNL 511          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: si:dkeyp-23e4.3 (rho GTPase-activating protein 7-like [Source:NCBI gene;Acc:103036387])

HSP 1 Score: 63.1586 bits (152), Expect = 6.633e-10
Identity = 56/198 (28.28%), Postives = 89/198 (44.95%), Query Frame = 1
Query:  181 YRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDML-ANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYS-MVEDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHL 765
            YR       K  K+ FGVPL +  Q+S   LP  +   + YL  E +    LFR+PG  ++++ + DM+ A+     +   + + VA+++K+YF  LP  +F  K     L  Y    +DQ+ +     +  +P+ NRE L  L+F    R V   + E  + A N                    VA  +A S+FHL
Sbjct:  575 YRKTKASEHKGRKV-FGVPLLQSVQQSGKPLPPSILRAMEYLKTECLDQVGLFRKPGVKSRIQYLRDMVEADPDGFSFEGQSAFDVADMLKQYFRDLPEPVFSSKLCESFLHIYQYFPKDQKFAAAQAAIFLLPDENREALQSLLF--FLREVVACMEENQMTATN--------------------VAVCLAPSLFHL 749          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: si:dkeyp-23e4.3 (rho GTPase-activating protein 7-like [Source:NCBI gene;Acc:103036387])

HSP 1 Score: 63.1586 bits (152), Expect = 6.933e-10
Identity = 56/198 (28.28%), Postives = 89/198 (44.95%), Query Frame = 1
Query:  181 YRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDML-ANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYS-MVEDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHL 765
            YR       K  K+ FGVPL +  Q+S   LP  +   + YL  E +    LFR+PG  ++++ + DM+ A+     +   + + VA+++K+YF  LP  +F  K     L  Y    +DQ+ +     +  +P+ NRE L  L+F    R V   + E  + A N                    VA  +A S+FHL
Sbjct:  609 YRKTKASEHKGRKV-FGVPLLQSVQQSGKPLPPSILRAMEYLKTECLDQVGLFRKPGVKSRIQYLRDMVEADPDGFSFEGQSAFDVADMLKQYFRDLPEPVFSSKLCESFLHIYQYFPKDQKFAAAQAAIFLLPDENREALQSLLF--FLREVVACMEENQMTATN--------------------VAVCLAPSLFHL 783          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Match: si:dkeyp-23e4.3 (rho GTPase-activating protein 7-like [Source:NCBI gene;Acc:103036387])

HSP 1 Score: 63.1586 bits (152), Expect = 8.255e-10
Identity = 56/198 (28.28%), Postives = 89/198 (44.95%), Query Frame = 1
Query:  181 YRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDML-ANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYS-MVEDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHL 765
            YR       K  K+ FGVPL +  Q+S   LP  +   + YL  E +    LFR+PG  ++++ + DM+ A+     +   + + VA+++K+YF  LP  +F  K     L  Y    +DQ+ +     +  +P+ NRE L  L+F    R V   + E  + A N                    VA  +A S+FHL
Sbjct:  510 YRKTKASEHKGRKV-FGVPLLQSVQQSGKPLPPSILRAMEYLKTECLDQVGLFRKPGVKSRIQYLRDMVEADPDGFSFEGQSAFDVADMLKQYFRDLPEPVFSSKLCESFLHIYQYFPKDQKFAAAQAAIFLLPDENREALQSLLF--FLREVVACMEENQMTATN--------------------VAVCLAPSLFHL 684          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: arhgap18 (Rho GTPase activating protein 18 [Source:ZFIN;Acc:ZDB-GENE-070502-1])

HSP 1 Score: 58.151 bits (139), Expect = 4.573e-9
Identity = 44/156 (28.21%), Postives = 78/156 (50.00%), Query Frame = 1
Query:  199 VSGKLSKIKFGVPLEKLA---QKSCHHLPKPLF--DLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGI---EIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVE-----DQRRSVFHKILHQMPNANRELAILMFGILFRM 627
            V  K S++ FGVPL  L    QK    +  PLF  +LL +L Q G+ T  +FR PG+S++++ +   L  G     + W D   +  A+++K +   LP  L   ++    L+ ++ VE      QR    + ++  +P ANR++   +  +L ++
Sbjct:  255 VRAKDSRL-FGVPLSTLLEQDQKISPGVKVPLFLQELLTHLEQTGLDTEGIFRIPGSSSRIKSLRQELEAGFYDGAVTWDDVRPHDAASLLKLFIRELPAPLLTAEY----LTAFTSVEKIEIRKQRIRALNLLIILLPAANRDVLKAILELLLKV 405          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: dlc1 (DLC1 Rho GTPase activating protein [Source:ZFIN;Acc:ZDB-GENE-130206-12])

HSP 1 Score: 55.8398 bits (133), Expect = 1.775e-8
Identity = 49/190 (25.79%), Postives = 86/190 (45.26%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRE-LAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPEN 786
            FGVPL    Q++   LP+ +   + YL  + +    LFR+ G  ++++ + +M  +G E + +   + Y VA+++K+YF  LP  +F  K     L  Y  V ++Q+          +P+ NRE L  L++      V+  V E  + + N                    +A  +A S+FHL T   +N
Sbjct:   26 FGVPLLLNVQRTGQPLPQSIQQAMRYLRSQCLDQVGLFRKSGVKSRIQALREMNESGAESVNYEGQSAYDVADMLKQYFRDLPEPMFTSKLADTFLQIYQYVPKEQQLQALQAGTMLLPDENREALQTLLY--FLSDVAAAVGENQMSSVN--------------------LAVCLAPSLFHLNTVKRDN 193          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002340.1 (pep scaffold:Pmarinus_7.0:GL481985:13400:22843:-1 gene:ENSPMAG00000002118.1 transcript:ENSPMAT00000002340.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 1.637e-7
Identity = 36/150 (24.00%), Postives = 74/150 (49.33%), Query Frame = 1
Query:  223 KFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFI-SLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAEN 669
            +FGV L++LA+ S   +P  + D + YL + G++T  +FRR  ++  +R+  +    G  +++       +A V+ K F+  LP  L        ++S   + +D R +   +++ ++P  NR +   +   L ++VS +     +  EN
Sbjct:  195 QFGVGLKRLAENSGQLIPLVVRDTVAYLKEHGLQTEGIFRRSASTQALRETQERYNRGQPVDFQALGDVHLAAVILKTFLRELPEPLLTFSLFPYIVSVQGLEKDARGAAVVEMVKKLPEENRAVLHHLLDFL-KLVSPHSGVNKMSGEN 343          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: arhgap5 (Rho GTPase activating protein 5 [Source:ZFIN;Acc:ZDB-GENE-081014-1])

HSP 1 Score: 48.9062 bits (115), Expect = 3.687e-6
Identity = 48/194 (24.74%), Postives = 83/194 (42.78%), Query Frame = 1
Query:  208 KLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLA--NGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSV-FHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHP----DTKCSGDPKCTEFVLAEAVAKSVAGSIFHLC 768
            K   + FG+PL ++ Q   + +P  +   ++YL   GI T  L+R  GN  +   +       + I  E  D N+ TVA  +K +F  LP  L        L+   ++ +   R +     L ++P+ N E+   +   L + VS Y +E  + +EN       T    D +  + + A  V K +  +  H C
Sbjct: 1214 KKESVYFGLPLVEVVQSPDNPIPLFVEKCVLYLESCGITTEGLYRVSGNKTEQDSLQKQFECDHSISYEAMDVNVNTVAGSLKIFFAELPDPLLPYDIHQDLMEAINIPDKTGRLLALRGKLKKLPHVNHEVFKYIITHLHK-VSQYSSENYMTSENLSICFWPTLMRPDFQTVDALTATRVNKLIIETFIHQC 1406          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO49778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFT9])

HSP 1 Score: 57.3806 bits (137), Expect = 1.206e-8
Identity = 37/156 (23.72%), Postives = 77/156 (49.36%), Query Frame = 1
Query:  163 MSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLST----YSMVEDQRRSVFHKILHQMPNANREL--AILMF 609
            M  ++ +++  Y   K+    FGVP+  + Q+S   LP+P+   + YL +  +++  +FR+ G   ++  + DM+ +  E  ++   + Y +A+++K+YF  LP  +   K     ++     Y +  + R       +  MP+ NRE    +L+F
Sbjct:    1 MRFLKKFKTPDYRDKKV----FGVPMSVVLQRSGQPLPRPILCAINYLQRTCVESVGIFRKSGGKQRINNLKDMMEDNPEHTDFEGMSPYDLADMLKQYFRDLPDPILTSKLAETFITIHTCKYYIPAELRVEAMQAAILLMPDENREALQTLLLF 152          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO34021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL1])

HSP 1 Score: 48.9062 bits (115), Expect = 5.876e-6
Identity = 30/132 (22.73%), Postives = 69/132 (52.27%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCH----HLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSM---VEDQRRSV--FHKILHQMPNANREL 594
            FG+PLEK  ++S       LP+   + ++Y+ + G+    ++R  G  +++  + ++   G +++  +Y    VA++VK+Y   LP  +      +ML   ++    ++D++  +    ++L ++P+ NR L
Sbjct:   99 FGIPLEKAVKQSILPDGVELPRLFREGIMYVEENGLNVEGIYRVSGVKSKVDALKELYDQGKQVDLKEYEPEVVASIVKQYLRELPESVLT----MMLAPRFNELIGIQDKKEQLEKTKQLLAELPSPNRTL 226          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: si:ch211-122h15.4 (T-cell activation Rho GTPase-activating protein [Source:NCBI gene;Acc:101155816])

HSP 1 Score: 72.4034 bits (176), Expect = 1.025e-12
Identity = 44/164 (26.83%), Postives = 85/164 (51.83%), Query Frame = 1
Query:  145 SIIQNIMSCMRGYRSNAYVSGKLSKIK-FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSV-FHKILHQMPNANRELAILMFGILFRMV 630
            S+++N M   +G  + A  +   SK + FG  L K+     + LPKP+ DLLV L ++G  T  +FR+P N+  M+ I + L   +E+++ D  +  +  ++K +   LPG L   +     ++   + + Q+R+    K++  +P AN+ L   +  +L  ++
Sbjct:  254 SLVRNKMKLKKGSSNKACRAESDSKAQLFGQQLSKICPDE-YSLPKPVMDLLVLLRKKGPSTEGVFRKPCNNKNMKDIRERLNCSMEVDYKDLPVVLIVGLLKSFLKELPGSLLRSELYDKWIAALDIEDAQQRTQEITKVVDDLPVANKLLLQYLICVLHHIL 416          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: arhgap20 (rho GTPase-activating protein 20 [Source:NCBI gene;Acc:101155476])

HSP 1 Score: 58.9214 bits (141), Expect = 1.443e-8
Identity = 31/87 (35.63%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLF 483
            FG PL  +     H LPKP+ D+LV+L  EG  T  +FRR   +   R++ D L NG +  E     ++ +A V+K +  ++PG L 
Sbjct:  335 FGRPLSSVCSAD-HGLPKPVMDMLVFLYLEGPYTKGVFRRSAGAKACRELRDRLDNGTDNPEIKHQPMFVIAAVLKDFLRNIPGSLL 420          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: stard13b (StAR related lipid transfer domain containing 13 [Source:NCBI gene;Acc:101155622])

HSP 1 Score: 57.7658 bits (138), Expect = 3.376e-8
Identity = 51/182 (28.02%), Postives = 77/182 (42.31%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHL 765
            FGVPL    Q+S   LP  L   L YL    +    LFR+ G  ++++ +  M  +  + + + D + Y VA++VK++F  LP  L   K     L  Y  V +DQR       +  M + NRE+   +   L   VS  V E  +   N                    +A  +A S+FHL
Sbjct:  942 FGVPLIVHVQRSGQPLPLGLQQALRYLRSRCLDQVGLFRKSGVKSRIQALRQMNESSADNVNYEDQSAYDVADMVKQFFRDLPEPLLTNKLGETFLHIYQYVPKDQRLQAVQAAIMLMSDENREVLQTLLCFLSD-VSSSVEENQMTPTN--------------------IAVCLAPSLFHL 1102          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: stard13b (StAR related lipid transfer domain containing 13 [Source:NCBI gene;Acc:101155622])

HSP 1 Score: 57.7658 bits (138), Expect = 3.376e-8
Identity = 51/182 (28.02%), Postives = 77/182 (42.31%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHL 765
            FGVPL    Q+S   LP  L   L YL    +    LFR+ G  ++++ +  M  +  + + + D + Y VA++VK++F  LP  L   K     L  Y  V +DQR       +  M + NRE+   +   L   VS  V E  +   N                    +A  +A S+FHL
Sbjct:  942 FGVPLIVHVQRSGQPLPLGLQQALRYLRSRCLDQVGLFRKSGVKSRIQALRQMNESSADNVNYEDQSAYDVADMVKQFFRDLPEPLLTNKLGETFLHIYQYVPKDQRLQAVQAAIMLMSDENREVLQTLLCFLSD-VSSSVEENQMTPTN--------------------IAVCLAPSLFHL 1102          
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Match: stard13b (StAR related lipid transfer domain containing 13 [Source:NCBI gene;Acc:101155622])

HSP 1 Score: 57.3806 bits (137), Expect = 5.039e-8
Identity = 53/194 (27.32%), Postives = 81/194 (41.75%), Query Frame = 1
Query:  226 FGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIE-IEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMV-EDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAA 801
            FGVPL    Q+S   LP  L   L YL    +    LFR+ G  ++++ +  M  +  + + + D + Y VA++VK++F  LP  L   K     L  Y  V +DQR       +  M + NRE+   +   L   VS  V E  +   N                    +A  +A S+FHL     +N+   A
Sbjct:  648 FGVPLIVHVQRSGQPLPLGLQQALRYLRSRCLDQVGLFRKSGVKSRIQALRQMNESSADNVNYEDQSAYDVADMVKQFFRDLPEPLLTNKLGETFLHIYQYVPKDQRLQAVQAAIMLMSDENREVLQTLLCFLSD-VSSSVEENQMTPTN--------------------IAVCLAPSLFHLNLLKKDNLSPKA 820          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000036300.1 (SMESG000036300.1)

HSP 1 Score: 979.548 bits (2531), Expect = 0.000e+0
Identity = 480/482 (99.59%), Postives = 481/482 (99.79%), Query Frame = 1
Query:  100 MVTKQTFNYFSCGTMSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQRRPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADFXXXXXXXXXXIGNTSRNSFIDEIYSDY 1545
            MVTKQTFNYFSCGTMSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQR PEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADF+SFRSSELSSIGNTSRNSFIDEIYSDY
Sbjct:    1 MVTKQTFNYFSCGTMSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQRHPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADFASFRSSELSSIGNTSRNSFIDEIYSDY 482          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000036300.1 (SMESG000036300.1)

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 466/468 (99.57%), Postives = 467/468 (99.79%), Query Frame = 1
Query:  142 MSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQRRPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADFXXXXXXXXXXIGNTSRNSFIDEIYSDY 1545
            MSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQR PEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADF+SFRSSELSSIGNTSRNSFIDEIYSDY
Sbjct:    1 MSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQRHPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADFASFRSSELSSIGNTSRNSFIDEIYSDY 468          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000036300.1 (SMESG000036300.1)

HSP 1 Score: 935.25 bits (2416), Expect = 0.000e+0
Identity = 459/461 (99.57%), Postives = 460/461 (99.78%), Query Frame = 1
Query:  163 MSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQRRPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADFXXXXXXXXXXIGNTSRNSFIDEIYSDY 1545
            MSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQR PEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADF+SFRSSELSSIGNTSRNSFIDEIYSDY
Sbjct:    1 MSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQRHPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADFASFRSSELSSIGNTSRNSFIDEIYSDY 461          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000036300.1 (SMESG000036300.1)

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 456/458 (99.56%), Postives = 457/458 (99.78%), Query Frame = 1
Query:  172 MRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQRRPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADFXXXXXXXXXXIGNTSRNSFIDEIYSDY 1545
            MRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQR PEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADF+SFRSSELSSIGNTSRNSFIDEIYSDY
Sbjct:    1 MRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNIPNSQKQLQRHPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDISLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYYESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVPKRADFASFRSSELSSIGNTSRNSFIDEIYSDY 458          
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000036300.1 (SMESG000036300.1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 287/288 (99.65%), Postives = 288/288 (100.00%), Query Frame = 1
Query:  100 MVTKQTFNYFSCGTMSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISE 963
            MVTKQTFNYFSCGTMSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNIS+
Sbjct:    1 MVTKQTFNYFSCGTMSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKLAQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGIEIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSVFHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDPKCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEEFVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISD 288          

HSP 2 Score: 53.5286 bits (127), Expect = 2.139e-7
Identity = 23/24 (95.83%), Postives = 24/24 (100.00%), Query Frame = 2
Query:  962 NHIRRNPATRETFQILKNNYKGVR 1033
            NHIRRNPATRETFQILKNNYKG+R
Sbjct:  299 NHIRRNPATRETFQILKNNYKGIR 322          
The following BLAST results are available for this feature:
BLAST of Rho-GAP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP203.696e-1426.60Rho GTPase activating protein 20 [Source:HGNC Symb... [more]
ARHGAP203.855e-1426.60Rho GTPase activating protein 20 [Source:HGNC Symb... [more]
ARHGAP203.980e-1426.60Rho GTPase activating protein 20 [Source:HGNC Symb... [more]
ARHGAP203.980e-1426.60Rho GTPase activating protein 20 [Source:HGNC Symb... [more]
ARHGAP204.280e-1426.60Rho GTPase activating protein 20 [Source:HGNC Symb... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rga-95.516e-2727.82Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-91.351e-2630.83Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-91.839e-2631.08Rho GTPase Activating protein [Source:UniProtKB/T... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP71E9.522e-2330.10gene:FBgn0036518 transcript:FBtr0332092[more]
RhoGAP71E3.628e-2230.10gene:FBgn0036518 transcript:FBtr0332093[more]
RhoGAP71E4.960e-2230.10gene:FBgn0036518 transcript:FBtr0075567[more]
RhoGAP71E4.991e-2230.10gene:FBgn0036518 transcript:FBtr0303510[more]
RhoGAP71E5.692e-2230.10gene:FBgn0036518 transcript:FBtr0290065[more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tagapa3.803e-1328.57T cell activation RhoGTPase activating protein a [... [more]
tagapa4.722e-1328.57T cell activation RhoGTPase activating protein a [... [more]
tagapa4.722e-1328.57T cell activation RhoGTPase activating protein a [... [more]
dlc14.313e-825.98DLC1 Rho GTPase activating protein [Source:ZFIN;Ac... [more]
si:dkeyp-23e4.36.084e-822.61si:dkeyp-23e4.3 [Source:ZFIN;Acc:ZDB-GENE-091118-1... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gapvd16.639e-1128.36GTPase activating protein and VPS9 domains 1 [Sour... [more]
gapvd18.009e-1128.36GTPase activating protein and VPS9 domains 1 [Sour... [more]
gapvd18.983e-1128.36GTPase activating protein and VPS9 domains 1 [Sour... [more]
trhd3.109e-1025.34tumorhead [Source:Xenbase;Acc:XB-GENE-1214876][more]
ENSXETT00000033897.12.252e-824.44rho GTPase-activating protein 7-like [Source:NCBI ... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgap202.157e-1326.60Rho GTPase activating protein 20 [Source:MGI Symbo... [more]
Arhgap202.180e-1326.60Rho GTPase activating protein 20 [Source:MGI Symbo... [more]
Dlc13.683e-826.84deleted in liver cancer 1 [Source:MGI Symbol;Acc:M... [more]
Dlc15.159e-826.84deleted in liver cancer 1 [Source:MGI Symbol;Acc:M... [more]
Dlc15.615e-826.84deleted in liver cancer 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P2F6|RHG20_HUMAN1.851e-1326.60Rho GTPase-activating protein 20 OS=Homo sapiens O... [more]
sp|Q6IFT4|RHG20_MOUSE1.525e-1226.60Rho GTPase-activating protein 20 OS=Mus musculus O... [more]
sp|Q6REY9|RHG20_RAT6.554e-1226.20Rho GTPase-activating protein 20 OS=Rattus norvegi... [more]
sp|B9VTT2|RHG07_CANLF5.049e-826.84Rho GTPase-activating protein 7 OS=Canis lupus fam... [more]
sp|Q96QB1|RHG07_HUMAN6.740e-826.84Rho GTPase-activating protein 7 OS=Homo sapiens OX... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G3Y31.691e-4140.00Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A267GRD01.865e-4140.00Rho-GAP domain-containing protein OS=Macrostomum l... [more]
R7TWZ02.130e-4042.93Rho-GAP domain-containing protein OS=Capitella tel... [more]
A0A4Z2CV903.003e-3930.24Rho GTPase-activating protein isoform 1 OS=Schisto... [more]
A0A4E0RHY13.845e-3936.84RhoGAP OS=Fasciola hepatica OX=6192 GN=D915_001858... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap20b1.225e-1329.56Rho GTPase activating protein 20b [Source:ZFIN;Acc... [more]
ENSAMXT00000053633.14.259e-1126.32rho GTPase-activating protein 20-like [Source:NCBI... [more]
si:dkeyp-23e4.36.633e-1028.28rho GTPase-activating protein 7-like [Source:NCBI ... [more]
si:dkeyp-23e4.36.933e-1028.28rho GTPase-activating protein 7-like [Source:NCBI ... [more]
si:dkeyp-23e4.38.255e-1028.28rho GTPase-activating protein 7-like [Source:NCBI ... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
arhgap184.573e-928.21Rho GTPase activating protein 18 [Source:ZFIN;Acc:... [more]
dlc11.775e-825.79DLC1 Rho GTPase activating protein [Source:ZFIN;Ac... [more]
ENSPMAT00000002340.11.637e-724.00pep scaffold:Pmarinus_7.0:GL481985:13400:22843:-1 ... [more]
arhgap53.687e-624.74Rho GTPase activating protein 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO497781.206e-823.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340215.876e-622.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-122h15.41.025e-1226.83T-cell activation Rho GTPase-activating protein [S... [more]
arhgap201.443e-835.63rho GTPase-activating protein 20 [Source:NCBI gene... [more]
stard13b3.376e-828.02StAR related lipid transfer domain containing 13 [... [more]
stard13b3.376e-828.02StAR related lipid transfer domain containing 13 [... [more]
stard13b5.039e-827.32StAR related lipid transfer domain containing 13 [... [more]
back to top
BLAST of Rho-GAP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036300.10.000e+099.59SMESG000036300.1[more]
SMESG000036300.10.000e+099.57SMESG000036300.1[more]
SMESG000036300.10.000e+099.57SMESG000036300.1[more]
SMESG000036300.10.000e+099.56SMESG000036300.1[more]
SMESG000036300.12.139e-799.65SMESG000036300.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022429 ID=SMED30022429|Name=Rho-GAP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1970bp
GGTCAATTTAAAATTACTATATAAAATCACTTGTGTTAAGGTAGATTTCA
TCAAATTGAAATTTTGAAGTGATTAAAATTGACATGCTGATATATTTATA
TGGTTACTAAACAAACATTTAACTATTTCTCTTGTGGAACTATGTCAATC
ATTCAGAATATTATGTCATGTATGCGTGGATATCGTTCCAATGCATACGT
GTCTGGTAAGTTATCTAAAATCAAATTTGGAGTTCCTCTGGAGAAATTAG
CACAAAAGTCATGTCATCATTTACCAAAGCCTTTATTTGATTTACTTGTC
TATCTTGCTCAAGAAGGCATTAAAACAAATGATTTGTTTCGAAGACCCGG
AAATTCTAATCAAATGAGAAAAATTATCGATATGCTTGCTAATGGAATCG
AAATTGAATGGTCAGATTATAATTTGTATACAGTGGCAAATGTTGTCAAA
AAATACTTCATCAGTTTACCTGGAGGATTGTTTGGCCGAAAATTTGAATT
AATGTTACTTTCTACTTATTCTATGGTAGAAGATCAACGTCGTTCTGTAT
TTCACAAAATTCTTCATCAAATGCCAAACGCAAATCGTGAATTAGCTATT
CTTATGTTTGGGATACTTTTTCGAATGGTCAGCCATTATGTAAATGAATA
CTCACTGGAAGCAGAAAATCATCCTGACACAAAATGTTCAGGTGACCCTA
AATGCACAGAATTTGTTTTAGCGGAAGCTGTTGCCAAATCCGTTGCGGGA
TCGATATTTCATTTGTGTACATCTTCTCCGGAAAATGTCGAAAAAGCAGC
GACTGTGCTTAGGTGTCTGATTCTGGATTTCCCAAGTTTTGACGAAGAAT
TTGTCGACTTCTACTATAGATCAACTCTTATTTCATATGGAAGTCAATAT
CAGAGATATTTCCAATTTAGTGATTCAGGGAAGCAATCGCAATTCGAAAC
TAACATTTCAGAATCATATAAGACGAAATCCAGCAACTCGGGAAACATTC
CAAATTCTCAAAAACAATTACAAAGGCGTCCGGAATACTTTGAACTGCCT
ATCGTAATGCTAACTAACCCTTTTGGCGATGTTGAAAATATGTCAACAGA
TAGTTCCCCTGTTTTAAAGATAAAGTTCACTAAAGATGATGATGACATCA
GTCTGAAATCTTCACGAAGTTCGGATTATGACAGGGTTCAACAAAGGCAG
CTTGACTTGATGCGATTAAGATCCGATTGGTTTCTTAATACCGGATCTTG
TCACAATATCAGCACAAAACCGTCAGATTCAGCCGAATACAGTTATTATG
AGAGCAACGAAGGAACTATCAGCATGGCATCAGATTCCAATTTGCAGTAC
CAAATCATCGCAACAAGCGGCCCAGATATTCTTCAAACTCTCCCACACAG
AAATCGAAATCAGAACATAAATAAAAATTCGTTTAATCTAACTGTTCCGA
AACGGGCGGATTTCTCAAGCTTTCGGTCCTCAGAATTATCGAGTATCGGA
AATACTAGCAGAAATTCTTTTATCGATGAAATCTATAGCGACTATTGAAT
ATTTGACCGATTGCATGACCTATTATTATATGATTTGTAAATCAATTATA
CAAATGCTCATCAATCAAATTGTTGATCTGAATCAATCTATAAATTAGAA
AAATGAAATAAAATTCCATATTATATCCAATAAATTTGTCTATTACCTAT
TTTAAATAATCTGTTCAACGCTTTGTAATAATTGAGATTCATAATAATTT
TGTCGCTTTTGTGAATTTTCTAGGAATTGACCAATTGAATCTCAAGGTTT
CGTTCTAATAATTTCGGTTGCCGCCATCAAGTGCTTGACTCGGGGGAATA
TTAAAATTCAAATATTGCAAGAAAAGTTGACCATCGGATTGTTCAGTGTT
GGCAGCGATGTTCATTTATTCATTTTATGACAGGTTTTATAAATTTATAA
GCTTTATATCGTTTTCGTCA
back to top

protein sequence of SMED30022429-orf-1

>SMED30022429-orf-1 ID=SMED30022429-orf-1|Name=SMED30022429-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MVTKQTFNYFSCGTMSIIQNIMSCMRGYRSNAYVSGKLSKIKFGVPLEKL
AQKSCHHLPKPLFDLLVYLAQEGIKTNDLFRRPGNSNQMRKIIDMLANGI
EIEWSDYNLYTVANVVKKYFISLPGGLFGRKFELMLLSTYSMVEDQRRSV
FHKILHQMPNANRELAILMFGILFRMVSHYVNEYSLEAENHPDTKCSGDP
KCTEFVLAEAVAKSVAGSIFHLCTSSPENVEKAATVLRCLILDFPSFDEE
FVDFYYRSTLISYGSQYQRYFQFSDSGKQSQFETNISESYKTKSSNSGNI
PNSQKQLQRRPEYFELPIVMLTNPFGDVENMSTDSSPVLKIKFTKDDDDI
SLKSSRSSDYDRVQQRQLDLMRLRSDWFLNTGSCHNISTKPSDSAEYSYY
ESNEGTISMASDSNLQYQIIATSGPDILQTLPHRNRNQNINKNSFNLTVP
KRADFSSFRSSELSSIGNTSRNSFIDEIYSDY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000198RhoGAP_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 56..246
e-value: 3.9E-7
score: 39.7
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 59..179
e-value: 8.9E-16
score: 58.1
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 45..248
score: 16.866
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 19..252
e-value: 6.3E-27
score: 96.2
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 42..179
NoneNo IPR availablePANTHERPTHR23179T-CELL ACTIVATION RHO GTPASE ACTIVATING PROTEIN-RELATEDcoord: 17..226
NoneNo IPR availablePANTHERPTHR23179:SF27RHO GTPASE ACTIVATING PROTEIN AT 71E, ISOFORM Dcoord: 17..226
NoneNo IPR availableCDDcd00159RhoGAPcoord: 59..179
e-value: 1.99347E-19
score: 83.5052