Glycogen [starch] synthase

Overview
NameGlycogen [starch] synthase
Smed IDSMED30022423
Length (bp)2627
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycogen [starch] synthase (SMED30022423) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycogen [starch] synthase (SMED30022423) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycogen [starch] synthase (SMED30022423) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycogen [starch] synthase (SMED30022423) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022423

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30022423SMESG000055140.1 SMESG000028231.1 SMESG000020698.1 Contig35729uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022423SMESG000055140.1 SMESG000028231.1 SMESG000020698.1 Contig35729newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022423SMESG000028231.1 Contig18293newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022423SMESG000028231.1 Contig18293uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022423SMESG000028231.1 Contig19651newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022423SMESG000028231.1 Contig19651uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Match: GYS1 (glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4706])

HSP 1 Score: 302.753 bits (774), Expect = 1.035e-139
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HC+H FT VS++T +EAQ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KT+Y F AGRYEF NKGAD+F+E+LARLNY L++  S+ TVVAF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L GS+P    + D +D   +KR +FA QR S PP+CTHN+  D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVK 474          

HSP 2 Score: 216.468 bits (550), Expect = 1.035e-139
Identity = 99/207 (47.83%), Postives = 137/207 (66.18%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTV++TKAK T  E  D Y L+GP  E  +R++V++ ++    +  ++ +M S G ++  GRWL+EG P V+L DV ++   L  WK ELW+   IG+P  D+E ND+V+FG L  WF+G F  +  +       +++HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPH----VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDK 231          

HSP 3 Score: 213.001 bits (541), Expect = 1.153e-57
Identity = 119/213 (55.87%), Postives = 146/213 (68.54%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLP-HLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS----EHDFQDPPN 2362
            S+    KVIFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L      AR +++++  P H   + N A AA                 +   RP S P SPS+S  S      D +DP N
Sbjct:  468 SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQ---------------GYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRN 665          
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Match: GYS2 (glycogen synthase 2 [Source:HGNC Symbol;Acc:HGNC:4707])

HSP 1 Score: 300.827 bits (769), Expect = 1.881e-135
Identity = 138/245 (56.33%), Postives = 189/245 (77.14%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERA+ HC+H FT VS++T +EA+ +L RKPDV+TPNGLN+++F+A+HEFQNLH + K +I  F++ HFYG+LDFDLEKT++LF AGRYEF NKGAD+F+ESL+RLN+ L++  SD+TV+ F I P +TNNFN+ET + QA+ KQ+ D    ++   G +L D+ L+G IP    + D DD+  +KR +F+ QR SLPP+ THN+  D  DPIL  +RR  LFNNRTDRVK
Sbjct:  230 DKEAGERQIYHRYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDITVMVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDILDRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVK 474          

HSP 2 Score: 204.142 bits (518), Expect = 1.881e-135
Identity = 96/204 (47.06%), Postives = 137/204 (67.16%), Query Frame = 2
Query:  227 IAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            +AWEV NKVGGIYTVI+TKAK+T  E  + Y L+GP  E  ++++V+ C+   + V  ++ AM   G ++  GRWL+EG+P+V+LFD+  +   L  WK +LW    +GIP +D+E ND ++FG L AWF+   +E  +     YV  ++ FHEW  G GLI  R R++  AT+F+THATLLGRYL A+++D YN+L KF IDK
Sbjct:   33 VAWEVTNKVGGIYTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDIGYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFL---KEVTDHADGKYV--VAQFHEWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDK 231          

HSP 3 Score: 206.068 bits (523), Expect = 1.581e-55
Identity = 104/149 (69.80%), Postives = 122/149 (81.88%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQ 2203
            KVI HPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFM+EH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L      AR L+++R  P  F 
Sbjct:  474 KVILHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYQHARHLTLSRAFPDKFH 622          
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Match: GYS1 (glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4706])

HSP 1 Score: 302.753 bits (774), Expect = 7.311e-100
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HC+H FT VS++T +EAQ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KT+Y F AGRYEF NKGAD+F+E+LARLNY L++  S+ TVVAF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L GS+P    + D +D   +KR +FA QR S PP+CTHN+  D  DPIL  +RR  LFN+  DRVK
Sbjct:  166 DKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVK 410          

HSP 2 Score: 83.5741 bits (205), Expect = 7.311e-100
Identity = 34/57 (59.65%), Postives = 43/57 (75.44%), Query Frame = 2
Query:  668 IISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            +++HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:  111 VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDK 167          

HSP 3 Score: 213.386 bits (542), Expect = 2.673e-58
Identity = 119/213 (55.87%), Postives = 146/213 (68.54%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLP-HLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS----EHDFQDPPN 2362
            S+    KVIFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L      AR +++++  P H   + N A AA                 +   RP S P SPS+S  S      D +DP N
Sbjct:  404 SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQ---------------GYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRN 601          

HSP 4 Score: 73.1738 bits (178), Expect = 1.294e-12
Identity = 33/75 (44.00%), Postives = 51/75 (68.00%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVS 442
            LFE+AWEV NKVGGIYTV++TKAK T  E  D Y L+GP  E  +R++V++ ++    +  ++ +M S G + ++
Sbjct:   29 LFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKFLA 103          
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Match: GYS1 (glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4706])

HSP 1 Score: 56.225 bits (134), Expect = 4.964e-9
Identity = 34/52 (65.38%), Postives = 42/52 (80.77%), Query Frame = 2
Query: 1997 IYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL 2152
            IY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L
Sbjct:    2 IYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYL 53          
BLAST of Glycogen [starch] synthase vs. Ensembl Celegans
Match: gsy-1 (Glycogen [starch] synthase [Source:UniProtKB/Swiss-Prot;Acc:Q9U2D9])

HSP 1 Score: 276.174 bits (705), Expect = 7.661e-130
Identity = 138/247 (55.87%), Postives = 182/247 (73.68%), Query Frame = 1
Query:  835 QAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANS----DVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +AG R+IYH+YC+ERAA   +H FT VS++TGLEA+  L RKPDV+TPNGLN+ +FAA+HEFQNLH   K KIN+FI+ HF+G+LDFDL+KT+Y FTAGRYEF NKG DMFIESLARLN+ LK  +      VTVVAFLI+P   N+FN+E+ + QA+ KQ+++ V+ I+  +G R+ D CL+G +P    +    D + LKRC+ +    SLPPICTHN+ +   DP+L +LRR +LFN   DRVK
Sbjct:  250 EAGKRKIYHQYCLERAACQTAHIFTTVSEITGLEAEHFLCRKPDVLTPNGLNVVKFAALHEFQNLHAQNKEKINQFIRGHFHGHLDFDLDKTLYFFTAGRYEFSNKGGDMFIESLARLNHYLKTTSDPRHMGVTVVAFLIYPAPANSFNVESLKGQAVTKQLKEAVDRIKEKVGQRIFDICLQGHLPEPEELMSPADNILLKRCIMSLHNSSLPPICTHNMIRAD-DPVLESLRRTSLFNKPEDRVK 495          

HSP 2 Score: 208.764 bits (530), Expect = 7.661e-130
Identity = 99/214 (46.26%), Postives = 143/214 (66.82%), Query Frame = 2
Query:  212 RFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKLETGK 853
            RF+FE AWEV NKVGGIYTV+R+KA+ +  EL D+Y + GP+ +   R EVD  + +   +  ++   ++ G R + GRWL+EG P VILFD+ S    + +WK+EL+   +IGIP+ D E+ND+V+ G ++A F+  FRE +  Y+     +++HFHEW  G GL+  R  ++D ATV++THATLLGR+L A   DLYNNL  F++D  E GK
Sbjct:   44 RFVFECAWEVANKVGGIYTVLRSKAQISTEELGDQYCMFGPMKDGKWRLEVDPIEPENRTIRAAMKRFQADGFRCMYGRWLIEGYPKVILFDLGSGAVKMNEWKHELFEQCKIGIPHEDIESNDAVILGFMVALFLKHFRESVTSYTPL---VVAHFHEWQAGVGLLMTRLWKLDIATVYTTHATLLGRHLCAGGADLYNNLDSFDLDA-EAGK 253          

HSP 3 Score: 216.083 bits (549), Expect = 1.094e-59
Identity = 98/145 (67.59%), Postives = 116/145 (80.00%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLP 2191
            KV+FHPEF++S +PLIG+DYE+F RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFM+EH+ED +  GIYVIDRR K+ EES+ +L   +++FC  SRRQRIILRN  E LS LLDW NL       R L++ R  P
Sbjct:  495 KVVFHPEFLSSVSPLIGLDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMQEHVEDHEQKGIYVIDRRHKAAEESVQELAQVMYDFCGQSRRQRIILRNSNEGLSALLDWQNLGVFYRDCRRLALERLHP 639          
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Match: GlyS (gene:FBgn0266064 transcript:FBtr0083037)

HSP 1 Score: 322.398 bits (825), Expect = 6.428e-144
Identity = 152/245 (62.04%), Postives = 199/245 (81.22%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            + +AG RQIYHRYC+ER ATH +H FT VS++TG EA+ LL RKPD+ITPNGLN+++F+AIHEFQNLH VAK KIN+F++ HFYG++DFDL+KT+Y F AGRYEF NKGAD+FIE+LARLN  LK    D TVVAFLIFPT+TNNFN+++ R  A++KQ+RDT+  +Q  +G R+ D+CL+G+IP A  +   DD++K+KRC+FA QR S+PP+ THNV  D  DP+L ++RRC+LFN+R DRVK
Sbjct:  261 DEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVK 505          

HSP 2 Score: 210.305 bits (534), Expect = 6.428e-144
Identity = 109/223 (48.88%), Postives = 152/223 (68.16%), Query Frame = 2
Query:  212 RFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDME-----PVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYST---FYVP-IISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKLETGK 853
            R+ FE+AWEV NKVGGIYTVIR+KA  +  E+ ++  ++GP  E C R+E++    +ME     P+ ++++++RS G +I +GRWLV+GNP +ILFD+ SA   L  +K+E+W    IGIP+ D ETND+++ G +IA F+  FR     YS       P I++HFHEW  G GLI +RTR ++ ATVF+THATLLGRYL A + D YNNL KF +D+ E GK
Sbjct:   49 RWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEME----EMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDE-EAGK 266          

HSP 3 Score: 213.001 bits (541), Expect = 3.753e-58
Identity = 119/222 (53.60%), Postives = 149/222 (67.12%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQD--KNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGL 2428
            K++FHPEF+TSTNPL G+DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEH+ DPKSYGIY++DRR+   E S+ QL+ ++ EF   +RRQRII RNRTERLS+LLDW  L      +  + L  ++ D    L++  ++N+ I S             RP+S P SP+ S  +      P      + + D VD+  E  ELG+
Sbjct:  505 KMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGSKNNLIFS-------------RPHSEPPSPTSSRHTT-----PAPSVHGSDDEDSVDEETELKELGI 708          
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Match: GlyS (gene:FBgn0266064 transcript:FBtr0333276)

HSP 1 Score: 322.013 bits (824), Expect = 1.123e-143
Identity = 152/245 (62.04%), Postives = 199/245 (81.22%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            + +AG RQIYHRYC+ER ATH +H FT VS++TG EA+ LL RKPD+ITPNGLN+++F+AIHEFQNLH VAK KIN+F++ HFYG++DFDL+KT+Y F AGRYEF NKGAD+FIE+LARLN  LK    D TVVAFLIFPT+TNNFN+++ R  A++KQ+RDT+  +Q  +G R+ D+CL+G+IP A  +   DD++K+KRC+FA QR S+PP+ THNV  D  DP+L ++RRC+LFN+R DRVK
Sbjct:  241 DEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVK 485          

HSP 2 Score: 209.92 bits (533), Expect = 1.123e-143
Identity = 109/223 (48.88%), Postives = 152/223 (68.16%), Query Frame = 2
Query:  212 RFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDME-----PVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYST---FYVP-IISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKLETGK 853
            R+ FE+AWEV NKVGGIYTVIR+KA  +  E+ ++  ++GP  E C R+E++    +ME     P+ ++++++RS G +I +GRWLV+GNP +ILFD+ SA   L  +K+E+W    IGIP+ D ETND+++ G +IA F+  FR     YS       P I++HFHEW  G GLI +RTR ++ ATVF+THATLLGRYL A + D YNNL KF +D+ E GK
Sbjct:   29 RWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEME----EMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDE-EAGK 246          

HSP 3 Score: 212.616 bits (540), Expect = 2.833e-58
Identity = 119/222 (53.60%), Postives = 149/222 (67.12%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQD--KNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGL 2428
            K++FHPEF+TSTNPL G+DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEH+ DPKSYGIY++DRR+   E S+ QL+ ++ EF   +RRQRII RNRTERLS+LLDW  L      +  + L  ++ D    L++  ++N+ I S             RP+S P SP+ S  +      P      + + D VD+  E  ELG+
Sbjct:  485 KMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGSKNNLIFS-------------RPHSEPPSPTSSRHTT-----PAPSVHGSDDEDSVDEETELKELGI 688          
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Match: GlyS (gene:FBgn0266064 transcript:FBtr0083035)

HSP 1 Score: 322.013 bits (824), Expect = 1.123e-143
Identity = 152/245 (62.04%), Postives = 199/245 (81.22%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            + +AG RQIYHRYC+ER ATH +H FT VS++TG EA+ LL RKPD+ITPNGLN+++F+AIHEFQNLH VAK KIN+F++ HFYG++DFDL+KT+Y F AGRYEF NKGAD+FIE+LARLN  LK    D TVVAFLIFPT+TNNFN+++ R  A++KQ+RDT+  +Q  +G R+ D+CL+G+IP A  +   DD++K+KRC+FA QR S+PP+ THNV  D  DP+L ++RRC+LFN+R DRVK
Sbjct:  241 DEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVK 485          

HSP 2 Score: 209.92 bits (533), Expect = 1.123e-143
Identity = 109/223 (48.88%), Postives = 152/223 (68.16%), Query Frame = 2
Query:  212 RFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDME-----PVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYST---FYVP-IISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKLETGK 853
            R+ FE+AWEV NKVGGIYTVIR+KA  +  E+ ++  ++GP  E C R+E++    +ME     P+ ++++++RS G +I +GRWLV+GNP +ILFD+ SA   L  +K+E+W    IGIP+ D ETND+++ G +IA F+  FR     YS       P I++HFHEW  G GLI +RTR ++ ATVF+THATLLGRYL A + D YNNL KF +D+ E GK
Sbjct:   29 RWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEME----EMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDE-EAGK 246          

HSP 3 Score: 212.616 bits (540), Expect = 2.833e-58
Identity = 119/222 (53.60%), Postives = 149/222 (67.12%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQD--KNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGL 2428
            K++FHPEF+TSTNPL G+DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEH+ DPKSYGIY++DRR+   E S+ QL+ ++ EF   +RRQRII RNRTERLS+LLDW  L      +  + L  ++ D    L++  ++N+ I S             RP+S P SP+ S  +      P      + + D VD+  E  ELG+
Sbjct:  485 KMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGSKNNLIFS-------------RPHSEPPSPTSSRHTT-----PAPSVHGSDDEDSVDEETELKELGI 688          
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Match: GlyS (gene:FBgn0266064 transcript:FBtr0083036)

HSP 1 Score: 322.013 bits (824), Expect = 1.123e-143
Identity = 152/245 (62.04%), Postives = 199/245 (81.22%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            + +AG RQIYHRYC+ER ATH +H FT VS++TG EA+ LL RKPD+ITPNGLN+++F+AIHEFQNLH VAK KIN+F++ HFYG++DFDL+KT+Y F AGRYEF NKGAD+FIE+LARLN  LK    D TVVAFLIFPT+TNNFN+++ R  A++KQ+RDT+  +Q  +G R+ D+CL+G+IP A  +   DD++K+KRC+FA QR S+PP+ THNV  D  DP+L ++RRC+LFN+R DRVK
Sbjct:  241 DEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVK 485          

HSP 2 Score: 209.92 bits (533), Expect = 1.123e-143
Identity = 109/223 (48.88%), Postives = 152/223 (68.16%), Query Frame = 2
Query:  212 RFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDME-----PVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYST---FYVP-IISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKLETGK 853
            R+ FE+AWEV NKVGGIYTVIR+KA  +  E+ ++  ++GP  E C R+E++    +ME     P+ ++++++RS G +I +GRWLV+GNP +ILFD+ SA   L  +K+E+W    IGIP+ D ETND+++ G +IA F+  FR     YS       P I++HFHEW  G GLI +RTR ++ ATVF+THATLLGRYL A + D YNNL KF +D+ E GK
Sbjct:   29 RWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEME----EMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDE-EAGK 246          

HSP 3 Score: 212.616 bits (540), Expect = 2.833e-58
Identity = 119/222 (53.60%), Postives = 149/222 (67.12%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQD--KNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGL 2428
            K++FHPEF+TSTNPL G+DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEH+ DPKSYGIY++DRR+   E S+ QL+ ++ EF   +RRQRII RNRTERLS+LLDW  L      +  + L  ++ D    L++  ++N+ I S             RP+S P SP+ S  +      P      + + D VD+  E  ELG+
Sbjct:  485 KMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGSKNNLIFS-------------RPHSEPPSPTSSRHTT-----PAPSVHGSDDEDSVDEETELKELGI 688          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys1 (glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1243])

HSP 1 Score: 297.745 bits (761), Expect = 1.211e-138
Identity = 136/245 (55.51%), Postives = 189/245 (77.14%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA  C+H FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KTV+LF AGRYEF NKGAD+F+E+LARLNY L++ +S+VTV+AF I P +TNNFN+ET + QA+ KQ+ DT + ++   G +L +S L G +P    + D +D   +KR +FA QR   PP+CTHN+ +D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGDRQIYHRYCLERAACRCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSEVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQSVKERFGKKLYESLLVGQLPDVSKMLDKEDFTMMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCIRRIGLFNSAQDRVK 474          

HSP 2 Score: 217.624 bits (553), Expect = 1.211e-138
Identity = 101/207 (48.79%), Postives = 140/207 (67.63%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFEIAWEV NKVGGIYTVI+TKA+ TC E  + Y L+GP  E+ +R++V++ +     +  +I  M S G ++  GRWL+EG+P+V+L DV      L  WK+ELW    IG+P  D+E ND+V+FG L AW +G +  + ++       I++HFHEWL G GL+  R RQ+  +T+F+THATLLGRYL A +VD YNNL +F +DK
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTCEEWGENYFLVGPYMESNVRTQVELIEPCNAALRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVGFTAWSLDRWKSELWEKCNIGVPWFDREANDAVLFGFLTAWLLGEYAAQCDEPPH----IVAHFHEWLAGLGLVLCRQRQLPVSTIFTTHATLLGRYLCAGNVDFYNNLAEFNVDK 231          

HSP 3 Score: 214.927 bits (546), Expect = 8.430e-59
Identity = 116/185 (62.70%), Postives = 137/185 (74.05%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAA-ENSKIISDTDIFSEGSFHLERPYSAPNSPS 2320
            KVIFHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRR++S +ES  QLT +LF+FC  SRRQRII RNRTERLS+LLDW  L   R    ARH         LA+A A  ++ I    +  S   F   RP S P SP+
Sbjct:  474 KVIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYL--GRYYVSARH---------LALAKAYPDTYIYEPQEPSSAAGFRYPRPASVPPSPA 647          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys1 (glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1243])

HSP 1 Score: 297.745 bits (761), Expect = 1.211e-138
Identity = 136/245 (55.51%), Postives = 189/245 (77.14%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA  C+H FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KTV+LF AGRYEF NKGAD+F+E+LARLNY L++ +S+VTV+AF I P +TNNFN+ET + QA+ KQ+ DT + ++   G +L +S L G +P    + D +D   +KR +FA QR   PP+CTHN+ +D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGDRQIYHRYCLERAACRCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSEVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQSVKERFGKKLYESLLVGQLPDVSKMLDKEDFTMMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCIRRIGLFNSAQDRVK 474          

HSP 2 Score: 217.624 bits (553), Expect = 1.211e-138
Identity = 101/207 (48.79%), Postives = 140/207 (67.63%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFEIAWEV NKVGGIYTVI+TKA+ TC E  + Y L+GP  E+ +R++V++ +     +  +I  M S G ++  GRWL+EG+P+V+L DV      L  WK+ELW    IG+P  D+E ND+V+FG L AW +G +  + ++       I++HFHEWL G GL+  R RQ+  +T+F+THATLLGRYL A +VD YNNL +F +DK
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTCEEWGENYFLVGPYMESNVRTQVELIEPCNAALRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVGFTAWSLDRWKSELWEKCNIGVPWFDREANDAVLFGFLTAWLLGEYAAQCDEPPH----IVAHFHEWLAGLGLVLCRQRQLPVSTIFTTHATLLGRYLCAGNVDFYNNLAEFNVDK 231          

HSP 3 Score: 214.927 bits (546), Expect = 8.430e-59
Identity = 116/185 (62.70%), Postives = 137/185 (74.05%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAA-ENSKIISDTDIFSEGSFHLERPYSAPNSPS 2320
            KVIFHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRR++S +ES  QLT +LF+FC  SRRQRII RNRTERLS+LLDW  L   R    ARH         LA+A A  ++ I    +  S   F   RP S P SP+
Sbjct:  474 KVIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYL--GRYYVSARH---------LALAKAYPDTYIYEPQEPSSAAGFRYPRPASVPPSPA 647          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys2 (glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-030826-31])

HSP 1 Score: 303.523 bits (776), Expect = 1.316e-138
Identity = 141/245 (57.55%), Postives = 188/245 (76.73%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +R+AG+RQIYHRYC+ERAA HC+H FT VS++T +EA  +LHR PDV+TPNGLN+++F+A+HEFQNLH + K KI +F++ HFYG+LDF+LEKT++ F AGRYEF NKGAD+F+ESL+RLNY L++  SDVTVV F I P +TNNFN+E+ + QA+ KQ+ DT + ++   G +L +S L+G IP    + D DD   +KR ++A QR SLPP+ THN+  D  DPIL N+RR  LFN R DRVK
Sbjct:  231 DREAGERQIYHRYCLERAAVHCAHVFTTVSQITAVEADHMLHRNPDVVTPNGLNVRKFSAMHEFQNLHSMNKSKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSDVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKKLYESLLRGEIPDMSKILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSTDPILGNIRRIGLFNGRNDRVK 475          

HSP 2 Score: 211.46 bits (537), Expect = 1.316e-138
Identity = 97/208 (46.63%), Postives = 143/208 (68.75%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
             LFE+AWEV NKVGGIYTVI+TKAK T  E  + Y ++GP  E   +++V+ C+   + +  ++ ++ + G ++  GRWL+EG+P+VILFD+ +A   L  WK +LW+   IG+P +D+E NDS++ G L+AWF   F+E  +Q     + +++HFHEW  G GL+  R+R +  AT+F+THATLLGRYL A + D YNNL KF+ID+
Sbjct:   29 LLFEVAWEVTNKVGGIYTVIQTKAKITVDEWGENYFMMGPYYEHNFKTQVEKCEPPNQAIRAAMDSLINNGCQVHFGRWLIEGSPYVILFDIGAAAWNLDRWKGDLWSACGIGLPYHDREANDSLILGSLVAWF---FKELTDQLQD-KLNVVAHFHEWQAGTGLVLSRSRNLPLATIFTTHATLLGRYLCAGNADFYNNLDKFDIDR 232          

HSP 3 Score: 213.386 bits (542), Expect = 2.456e-58
Identity = 105/159 (66.04%), Postives = 128/159 (80.50%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAE 2233
            K++FHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFMEEH+ DP  YGIY++DRRF+S +ES  QLT ++F FC  SRRQRII RNRTERLS+LLDW  L      AR L+++R  P  F+ ++L + + +
Sbjct:  475 KIVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHVSDPSEYGIYIVDRRFRSADESCNQLTQFMFSFCQKSRRQRIIQRNRTERLSDLLDWRYLGRFYMHARHLALSRSFPEKFRPEHLNLTSTQ 633          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys2 (glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-030826-31])

HSP 1 Score: 303.908 bits (777), Expect = 1.395e-138
Identity = 141/245 (57.55%), Postives = 188/245 (76.73%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +R+AG+RQIYHRYC+ERAA HC+H FT VS++T +EA  +LHR PDV+TPNGLN+++F+A+HEFQNLH + K KI +F++ HFYG+LDF+LEKT++ F AGRYEF NKGAD+F+ESL+RLNY L++  SDVTVV F I P +TNNFN+E+ + QA+ KQ+ DT + ++   G +L +S L+G IP    + D DD   +KR ++A QR SLPP+ THN+  D  DPIL N+RR  LFN R DRVK
Sbjct:  231 DREAGERQIYHRYCLERAAVHCAHVFTTVSQITAVEADHMLHRNPDVVTPNGLNVRKFSAMHEFQNLHSMNKSKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSDVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKKLYESLLRGEIPDMSKILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSTDPILGNIRRIGLFNGRNDRVK 475          

HSP 2 Score: 211.46 bits (537), Expect = 1.395e-138
Identity = 97/208 (46.63%), Postives = 143/208 (68.75%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
             LFE+AWEV NKVGGIYTVI+TKAK T  E  + Y ++GP  E   +++V+ C+   + +  ++ ++ + G ++  GRWL+EG+P+VILFD+ +A   L  WK +LW+   IG+P +D+E NDS++ G L+AWF   F+E  +Q     + +++HFHEW  G GL+  R+R +  AT+F+THATLLGRYL A + D YNNL KF+ID+
Sbjct:   29 LLFEVAWEVTNKVGGIYTVIQTKAKITVDEWGENYFMMGPYYEHNFKTQVEKCEPPNQAIRAAMDSLINNGCQVHFGRWLIEGSPYVILFDIGAAAWNLDRWKGDLWSACGIGLPYHDREANDSLILGSLVAWF---FKELTDQLQD-KLNVVAHFHEWQAGTGLVLSRSRNLPLATIFTTHATLLGRYLCAGNADFYNNLDKFDIDR 232          

HSP 3 Score: 213.386 bits (542), Expect = 2.462e-58
Identity = 105/159 (66.04%), Postives = 128/159 (80.50%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAE 2233
            K++FHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFMEEH+ DP  YGIY++DRRF+S +ES  QLT ++F FC  SRRQRII RNRTERLS+LLDW  L      AR L+++R  P  F+ ++L + + +
Sbjct:  475 KIVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHVSDPSEYGIYIVDRRFRSADESCNQLTQFMFSFCQKSRRQRIIQRNRTERLSDLLDWRYLGRFYMHARHLALSRSFPEKFRPEHLNLTSTQ 633          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys2 (glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-030826-31])

HSP 1 Score: 303.138 bits (775), Expect = 2.063e-138
Identity = 141/245 (57.55%), Postives = 188/245 (76.73%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +R+AG+RQIYHRYC+ERAA HC+H FT VS++T +EA  +LHR PDV+TPNGLN+++F+A+HEFQNLH + K KI +F++ HFYG+LDF+LEKT++ F AGRYEF NKGAD+F+ESL+RLNY L++  SDVTVV F I P +TNNFN+E+ + QA+ KQ+ DT + ++   G +L +S L+G IP    + D DD   +KR ++A QR SLPP+ THN+  D  DPIL N+RR  LFN R DRVK
Sbjct:  231 DREAGERQIYHRYCLERAAVHCAHVFTTVSQITAVEADHMLHRNPDVVTPNGLNVRKFSAMHEFQNLHSMNKSKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSDVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKKLYESLLRGEIPDMSKILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSTDPILGNIRRIGLFNGRNDRVK 475          

HSP 2 Score: 211.46 bits (537), Expect = 2.063e-138
Identity = 97/208 (46.63%), Postives = 143/208 (68.75%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
             LFE+AWEV NKVGGIYTVI+TKAK T  E  + Y ++GP  E   +++V+ C+   + +  ++ ++ + G ++  GRWL+EG+P+VILFD+ +A   L  WK +LW+   IG+P +D+E NDS++ G L+AWF   F+E  +Q     + +++HFHEW  G GL+  R+R +  AT+F+THATLLGRYL A + D YNNL KF+ID+
Sbjct:   29 LLFEVAWEVTNKVGGIYTVIQTKAKITVDEWGENYFMMGPYYEHNFKTQVEKCEPPNQAIRAAMDSLINNGCQVHFGRWLIEGSPYVILFDIGAAAWNLDRWKGDLWSACGIGLPYHDREANDSLILGSLVAWF---FKELTDQLQD-KLNVVAHFHEWQAGTGLVLSRSRNLPLATIFTTHATLLGRYLCAGNADFYNNLDKFDIDR 232          

HSP 3 Score: 213.386 bits (542), Expect = 2.982e-58
Identity = 105/159 (66.04%), Postives = 128/159 (80.50%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAE 2233
            K++FHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFMEEH+ DP  YGIY++DRRF+S +ES  QLT ++F FC  SRRQRII RNRTERLS+LLDW  L      AR L+++R  P  F+ ++L + + +
Sbjct:  475 KIVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHVSDPSEYGIYIVDRRFRSADESCNQLTQFMFSFCQKSRRQRIIQRNRTERLSDLLDWRYLGRFYMHARHLALSRSFPEKFRPEHLNLTSTQ 633          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 295.819 bits (756), Expect = 1.287e-137
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA  CSH FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +FI+ HFYG+LDF+L+KT++ F AGRYEF NKGAD+F+E+LARLNY L++ +S+ T+VAF I P +TNNFN+ET + QA+ KQ+ DT   I+   G +L +S L G++P    + D +D   LKR +FA QR S PPICTHN+  D  D IL  +RR  LFN+ +DRVK
Sbjct:  230 DKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVK 474          

HSP 2 Score: 216.468 bits (550), Expect = 1.287e-137
Identity = 102/207 (49.28%), Postives = 138/207 (66.67%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTVI+TKAK T  E  + Y L+GP  E  +R++V++ +     +  ++ +M + G ++  GRWL+EG+P+VIL D+ +    L  WK ELW+   IGIP  D+E ND+V+FG L AWF+G F  +  +       II+HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDK 231          

HSP 3 Score: 209.534 bits (532), Expect = 8.310e-57
Identity = 115/189 (60.85%), Postives = 134/189 (70.90%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS 2335
            KVIFHPEF++STNPL+ MD EEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+ DP +YGIY+ DRRF+S +ES  QLT +L+ F   +RRQRII RNRTERLS+LLDW  L   R  + ARH         +A+A A       +    +   F   RP S P SPS+S  S
Sbjct:  474 KVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYL--GRYYTYARH---------MALAKAFPDNFTYEPHEPTAQGFRYPRPASVPPSPSLSRHS 651          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 295.819 bits (756), Expect = 1.458e-137
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA  CSH FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +FI+ HFYG+LDF+L+KT++ F AGRYEF NKGAD+F+E+LARLNY L++ +S+ T+VAF I P +TNNFN+ET + QA+ KQ+ DT   I+   G +L +S L G++P    + D +D   LKR +FA QR S PPICTHN+  D  D IL  +RR  LFN+ +DRVK
Sbjct:  230 DKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVK 474          

HSP 2 Score: 216.468 bits (550), Expect = 1.458e-137
Identity = 102/207 (49.28%), Postives = 138/207 (66.67%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTVI+TKAK T  E  + Y L+GP  E  +R++V++ +     +  ++ +M + G ++  GRWL+EG+P+VIL D+ +    L  WK ELW+   IGIP  D+E ND+V+FG L AWF+G F  +  +       II+HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDK 231          

HSP 3 Score: 211.46 bits (537), Expect = 1.800e-57
Identity = 117/199 (58.79%), Postives = 139/199 (69.85%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS 2335
            S+    KVIFHPEF++STNPL+ MD EEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+ DP +YGIY+ DRRF+S +ES  QLT +L+ F   +RRQRII RNRTERLS+LLDW  L    T+AR +++A+  P  F  +     AA+               F   RP S P SPS+S  S
Sbjct:  468 SSSDRVKVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFPDNFTYEPHEPTAAQ--------------GFRYPRPASVPPSPSLSRHS 652          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 295.434 bits (755), Expect = 1.598e-137
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA  CSH FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +FI+ HFYG+LDF+L+KT++ F AGRYEF NKGAD+F+E+LARLNY L++ +S+ T+VAF I P +TNNFN+ET + QA+ KQ+ DT   I+   G +L +S L G++P    + D +D   LKR +FA QR S PPICTHN+  D  D IL  +RR  LFN+ +DRVK
Sbjct:  230 DKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVK 474          

HSP 2 Score: 216.853 bits (551), Expect = 1.598e-137
Identity = 102/207 (49.28%), Postives = 138/207 (66.67%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTVI+TKAK T  E  + Y L+GP  E  +R++V++ +     +  ++ +M + G ++  GRWL+EG+P+VIL D+ +    L  WK ELW+   IGIP  D+E ND+V+FG L AWF+G F  +  +       II+HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDK 231          

HSP 3 Score: 211.846 bits (538), Expect = 9.388e-58
Identity = 119/206 (57.77%), Postives = 142/206 (68.93%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS--EHDFQ 2350
            S+    KVIFHPEF++STNPL+ MD EEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+ DP +YGIY+ DRRF+S +ES  QLT +L+ F   +RRQRII RNRTERLS+LLDW  L    T+AR +++A+  P  F  +     AA+               F   RP S P SPS+S  S   H F+
Sbjct:  468 SSSDRVKVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFPDNFTYEPHEPTAAQ--------------GFRYPRPASVPPSPSLSRHSSPHHSFR 659          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 295.049 bits (754), Expect = 2.632e-137
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA  CSH FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +FI+ HFYG+LDF+L+KT++ F AGRYEF NKGAD+F+E+LARLNY L++ +S+ T+VAF I P +TNNFN+ET + QA+ KQ+ DT   I+   G +L +S L G++P    + D +D   LKR +FA QR S PPICTHN+  D  D IL  +RR  LFN+ +DRVK
Sbjct:  230 DKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVK 474          

HSP 2 Score: 216.468 bits (550), Expect = 2.632e-137
Identity = 102/207 (49.28%), Postives = 138/207 (66.67%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTVI+TKAK T  E  + Y L+GP  E  +R++V++ +     +  ++ +M + G ++  GRWL+EG+P+VIL D+ +    L  WK ELW+   IGIP  D+E ND+V+FG L AWF+G F  +  +       II+HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDK 231          

HSP 3 Score: 208.764 bits (530), Expect = 1.508e-56
Identity = 115/193 (59.59%), Postives = 135/193 (69.95%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS 2335
            KVIFHPEF++STNPL+ MD EEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+ DP +YGIY+ DRRF+S +ES  QLT +L+ F   +RRQRII RNRTERLS+LLDW  L    T+AR +++A+  P      N      E +             F   RP S P SPS+S  S
Sbjct:  474 KVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFP-----DNFTYEPHEPT-----------AGFRYPRPASVPPSPSLSRHS 650          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 283.878 bits (725), Expect = 5.749e-132
Identity = 133/239 (55.65%), Postives = 180/239 (75.31%), Query Frame = 1
Query:  847 RQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            + IYHRYC+ERAA  CSH FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +FI+ HFYG+LDF+L+KT++ F AGRYEF NKGAD+F+E+LARLNY L++ +S+ T+VAF I P +TNNFN+ET + QA+ KQ+ DT   I+   G +L +S L G++P    + D +D   LKR +FA QR S PPICTHN+  D  D IL  +RR  LFN+ +DRVK
Sbjct:  225 QSIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVK 463          

HSP 2 Score: 209.534 bits (532), Expect = 5.749e-132
Identity = 99/200 (49.50%), Postives = 134/200 (67.00%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNL 817
            LFE+AWEV NKVGGIYTVI+TKAK T  E  + Y L+GP  E  +R++V++ +     +  ++ +M + G ++  GRWL+EG+P+VIL D+ +    L  WK ELW+   IGIP  D+E ND+V+FG L AWF+G F  +  +       II+HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL
Sbjct:   29 LFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNL 224          

HSP 3 Score: 211.846 bits (538), Expect = 1.821e-57
Identity = 116/193 (60.10%), Postives = 137/193 (70.98%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS 2335
            KVIFHPEF++STNPL+ MD EEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+ DP +YGIY+ DRRF+S +ES  QLT +L+ F   +RRQRII RNRTERLS+LLDW  L    T+AR +++A+  P  F  +     AA+               F   RP S P SPS+S  S
Sbjct:  463 KVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFPDNFTYEPHEPTAAQ--------------GFRYPRPASVPPSPSLSRHS 641          
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Match: Gys1 (glycogen synthase 1, muscle [Source:MGI Symbol;Acc:MGI:101805])

HSP 1 Score: 302.368 bits (773), Expect = 2.744e-139
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HC+H FT VS++T +EAQ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KT+Y F AGRYEF NKGAD+F+E+LARLNY L++  S+ TVVAF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L GS+P    + D +D   +KR +FA QR S PP+CTHN+  D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVK 474          

HSP 2 Score: 215.312 bits (547), Expect = 2.744e-139
Identity = 103/216 (47.69%), Postives = 141/216 (65.28%), Query Frame = 2
Query:  191 DPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            DPE      LFE+AWEV NKVGGIYTV++TKAK T  E  D Y L+GP  E  +R++V++ +     +  ++ +M S G ++  GRWL+EG P V+L DV ++   L  WK ELW+   IG+P  D+E ND+V+FG L  WF+G F  + N+   +   +++HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   23 DPE---NAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQ-NEEKPY---VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDK 231          

HSP 3 Score: 210.69 bits (535), Expect = 4.258e-57
Identity = 116/203 (57.14%), Postives = 144/203 (70.94%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAAENSKIISDT-DIFSEGSFHLERPYSAPNSPSISE-ASEHDFQD 2353
            S+    KVIFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L   R    ARH         +A+A A       +  ++ +   +   RP S P SPS+S  +S H  +D
Sbjct:  468 SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYL--GRYYMSARH---------MALAKAFPDHFTYEPHEVDATQGYRYPRPASVPPSPSLSRHSSPHQSED 659          
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Match: Gys2 (glycogen synthase 2 [Source:MGI Symbol;Acc:MGI:2385254])

HSP 1 Score: 301.597 bits (771), Expect = 5.727e-137
Identity = 141/245 (57.55%), Postives = 190/245 (77.55%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERA+ HC+H FT VS++T +EA+ +L RKPDV+TPNGLN+++F+A+HEFQNLH + K +I  F++ HFYG+LDFDLEKT++LF AGRYEF NKGAD+F+ESL+RLN+ L++  S+VTVV F I P +TNNFN+ET + QA+ KQ+ DTV  ++   G +L D  L+G IP   S+ D DD+  +KR +F+ QR SLPP+ THN+  D  DPIL  +RR  LFNNR DRVK
Sbjct:  230 DKEAGERQIYHRYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNVTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHCLKEKFGKKLYDGLLRGEIPDMNSILDRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVK 474          

HSP 2 Score: 207.994 bits (528), Expect = 5.727e-137
Identity = 96/208 (46.15%), Postives = 139/208 (66.83%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
             LFE++WEV NKVGGI TVI+TKAK+T  E  + Y L+GP  E  ++++V+ C+   + V  ++ AM   G ++  GRWL+EG+P+V+LFD++S+   L  WK + W    +GIP++D+E ND ++FG L AWF+    +  +        +I+ FHEW  G GLI  R R++  ATVF+THATLLGRYL A+++D YN L KF+IDK
Sbjct:   29 LLFEVSWEVTNKVGGICTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPTNDAVRKAVDAMNKHGCQVHFGRWLIEGSPYVVLFDISSSAWNLDRWKGDFWEACGVGIPHHDREANDMLIFGSLTAWFLKEVTDHADGKH-----VIAQFHEWQAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNQLDKFDIDK 231          

HSP 3 Score: 204.142 bits (518), Expect = 5.236e-55
Identity = 103/149 (69.13%), Postives = 122/149 (81.88%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQ 2203
            KVI HPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCF++EH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L      AR L+++R  P  F 
Sbjct:  474 KVILHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFVQEHVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYQHARHLTLSRAFPDKFH 622          
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Match: Gys1 (glycogen synthase 1, muscle [Source:MGI Symbol;Acc:MGI:101805])

HSP 1 Score: 301.982 bits (772), Expect = 7.958e-100
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HC+H FT VS++T +EAQ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KT+Y F AGRYEF NKGAD+F+E+LARLNY L++  S+ TVVAF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L GS+P    + D +D   +KR +FA QR S PP+CTHN+  D  DPIL  +RR  LFN+  DRVK
Sbjct:  166 DKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVK 410          

HSP 2 Score: 83.9593 bits (206), Expect = 7.958e-100
Identity = 34/57 (59.65%), Postives = 43/57 (75.44%), Query Frame = 2
Query:  668 IISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            +++HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:  111 VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDK 167          

HSP 3 Score: 211.46 bits (537), Expect = 9.592e-58
Identity = 116/203 (57.14%), Postives = 144/203 (70.94%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAAENSKIISDT-DIFSEGSFHLERPYSAPNSPSISE-ASEHDFQD 2353
            S+    KVIFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L   R    ARH         +A+A A       +  ++ +   +   RP S P SPS+S  +S H  +D
Sbjct:  404 SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYL--GRYYMSARH---------MALAKAFPDHFTYEPHEVDATQGYRYPRPASVPPSPSLSRHSSPHQSED 595          

HSP 4 Score: 73.559 bits (179), Expect = 6.306e-13
Identity = 39/96 (40.62%), Postives = 58/96 (60.42%), Query Frame = 2
Query:  191 DPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVI 478
            DPE      LFE+AWEV NKVGGIYTV++TKAK T  E  D Y L+GP  E  +R++V++ +     +  ++ +M S G + ++     E  P+V+
Sbjct:   23 DPE---NAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKFLAQN---EEKPYVV 112          
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Match: Gys1 (glycogen synthase 1, muscle [Source:MGI Symbol;Acc:MGI:101805])

HSP 1 Score: 199.134 bits (505), Expect = 1.265e-58
Identity = 102/161 (63.35%), Postives = 126/161 (78.26%), Query Frame = 2
Query: 1775 IFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAENSKI 2245
            IFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L      AR +++A+  P  F  +   + A   + I
Sbjct:    2 IFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALAKAFPDHFTYEPHEVDAVSGAGI 162          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|Q9VFC8|GYS_DROME (Glycogen [starch] synthase OS=Drosophila melanogaster OX=7227 GN=GlyS PE=1 SV=2)

HSP 1 Score: 322.398 bits (825), Expect = 4.924e-143
Identity = 152/245 (62.04%), Postives = 199/245 (81.22%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            + +AG RQIYHRYC+ER ATH +H FT VS++TG EA+ LL RKPD+ITPNGLN+++F+AIHEFQNLH VAK KIN+F++ HFYG++DFDL+KT+Y F AGRYEF NKGAD+FIE+LARLN  LK    D TVVAFLIFPT+TNNFN+++ R  A++KQ+RDT+  +Q  +G R+ D+CL+G+IP A  +   DD++K+KRC+FA QR S+PP+ THNV  D  DP+L ++RRC+LFN+R DRVK
Sbjct:  261 DEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVK 505          

HSP 2 Score: 210.305 bits (534), Expect = 4.924e-143
Identity = 109/223 (48.88%), Postives = 152/223 (68.16%), Query Frame = 2
Query:  212 RFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDME-----PVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYST---FYVP-IISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKLETGK 853
            R+ FE+AWEV NKVGGIYTVIR+KA  +  E+ ++  ++GP  E C R+E++    +ME     P+ ++++++RS G +I +GRWLV+GNP +ILFD+ SA   L  +K+E+W    IGIP+ D ETND+++ G +IA F+  FR     YS       P I++HFHEW  G GLI +RTR ++ ATVF+THATLLGRYL A + D YNNL KF +D+ E GK
Sbjct:   49 RWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEME----EMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDE-EAGK 266          

HSP 3 Score: 213.001 bits (541), Expect = 3.762e-57
Identity = 119/222 (53.60%), Postives = 149/222 (67.12%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQD--KNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGL 2428
            K++FHPEF+TSTNPL G+DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEH+ DPKSYGIY++DRR+   E S+ QL+ ++ EF   +RRQRII RNRTERLS+LLDW  L      +  + L  ++ D    L++  ++N+ I S             RP+S P SP+ S  +      P      + + D VD+  E  ELG+
Sbjct:  505 KMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGSKNNLIFS-------------RPHSEPPSPTSSRHTT-----PAPSVHGSDDEDSVDEETELKELGI 708          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|P13807|GYS1_HUMAN (Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2)

HSP 1 Score: 302.753 bits (774), Expect = 4.565e-139
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HC+H FT VS++T +EAQ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KT+Y F AGRYEF NKGAD+F+E+LARLNY L++  S+ TVVAF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L GS+P    + D +D   +KR +FA QR S PP+CTHN+  D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVK 474          

HSP 2 Score: 216.468 bits (550), Expect = 4.565e-139
Identity = 99/207 (47.83%), Postives = 137/207 (66.18%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTV++TKAK T  E  D Y L+GP  E  +R++V++ ++    +  ++ +M S G ++  GRWL+EG P V+L DV ++   L  WK ELW+   IG+P  D+E ND+V+FG L  WF+G F  +  +       +++HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPH----VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDK 231          

HSP 3 Score: 213.001 bits (541), Expect = 5.537e-57
Identity = 119/213 (55.87%), Postives = 146/213 (68.54%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLP-HLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS----EHDFQDPPN 2362
            S+    KVIFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L      AR +++++  P H   + N A AA                 +   RP S P SPS+S  S      D +DP N
Sbjct:  468 SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQ---------------GYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRN 665          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|Q5R9H0|GYS1_PONAB (Glycogen [starch] synthase, muscle OS=Pongo abelii OX=9601 GN=GYS1 PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 4.641e-139
Identity = 138/245 (56.33%), Postives = 188/245 (76.73%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HC+H FT VS++T +EAQ+LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KT+Y F AGRYEF NKGAD+F+E+LARLNY L++  S+ TVVAF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L GS+P    + D +D   +KR +FA QR S PP+CTHN+  D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQYLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVK 474          

HSP 2 Score: 214.157 bits (544), Expect = 4.641e-139
Identity = 98/207 (47.34%), Postives = 137/207 (66.18%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTV++TKAK T  E    Y L+GP  E  +R++V++ ++    +  ++ +M S G ++  GRWL+EG P V+L DV ++   L  WK ELW+   IG+P  D+E ND+V+FG L  WF+G F  +  +     + +++HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVLQTKAKVTGDEWGANYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEE----KLHVVAHFHEWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDK 231          

HSP 3 Score: 213.001 bits (541), Expect = 4.934e-57
Identity = 119/213 (55.87%), Postives = 146/213 (68.54%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLP-HLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS----EHDFQDPPN 2362
            S+    KVIFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L      AR +++++  P H   + N A AA                 +   RP S P SPS+S  S      D +DP N
Sbjct:  468 SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQ---------------GYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRN 665          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|A7MB78|GYS1_BOVIN (Glycogen [starch] synthase, muscle OS=Bos taurus OX=9913 GN=GYS1 PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.324e-138
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HC+H FT VS++T +EAQ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KT+Y F AGRYEF NKGAD+F+E+LARLNY L++  S+ TVVAF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L GS+P    + D +D   +KR +FA QR S PP+CTHN+  D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVK 474          

HSP 2 Score: 214.927 bits (546), Expect = 1.324e-138
Identity = 99/207 (47.83%), Postives = 136/207 (65.70%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTV++TKAK T  E  D Y L+GP  E  +R++V++ +     +  ++ +M S G ++  GRWL+EG P V+L DV ++   L  WK ELW+   IG+P  D+E ND+V+FG L  WF+G F  +  +       +++HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPH----VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDK 231          

HSP 3 Score: 211.846 bits (538), Expect = 1.177e-56
Identity = 116/206 (56.31%), Postives = 143/206 (69.42%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISE-ASEHDFQD 2353
            S+    KVIFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L      AR +++A+  P  F  +     A +               +   RP S P SPS+S  +S H  +D
Sbjct:  468 SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALAKAFPEYFTYEPHEADATQG--------------YRYPRPASVPPSPSLSRHSSPHQSED 659          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|P13834|GYS1_RABIT (Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus OX=9986 GN=GYS1 PE=1 SV=4)

HSP 1 Score: 302.368 bits (773), Expect = 1.577e-138
Identity = 138/245 (56.33%), Postives = 187/245 (76.33%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HC+H FT VS++T +EAQ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+KT+Y F AGRYEF NKGAD+F+E+LARLNY L++  S+ TVVAF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L GS+P    + D +D   +KR +FA QR S PP+CTHN+  D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVK 474          

HSP 2 Score: 214.927 bits (546), Expect = 1.577e-138
Identity = 99/207 (47.83%), Postives = 136/207 (65.70%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFE+AWEV NKVGGIYTV++TKAK T  E  D Y L+GP  E  +R++V++ +     +  ++ +M S G ++  GRWL+EG P V+L DV ++   L  WK ELW+   IG+P  D+E ND+V+FG L  WF+G F  +  +       +++HFHEWL G GL   R R++  AT+F+THATLLGRYL A +VD YNNL  F +DK
Sbjct:   29 LFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPH----VVAHFHEWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDK 231          

HSP 3 Score: 210.305 bits (534), Expect = 4.198e-56
Identity = 117/202 (57.92%), Postives = 144/202 (71.29%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISE-ASEHDFQD 2353
            S+    KVIFHPEF++ST+PL+ +DYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRRF+S ++S  QLT +L+ FC  SRRQRII RNRTERLS+LLDW  L   R    ARH+        LA A  ++          ++G +   RP S P SPS+S  +S H  +D
Sbjct:  468 SSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYL--GRYYMSARHMA-------LAKAFPDHFTYEPHEADATQG-YRYPRPASVPPSPSLSRHSSPHQSED 659          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: A0A0R3S958 (Glycogen [starch] synthase OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS751 PE=3 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 4.638e-165
Identity = 161/245 (65.71%), Postives = 209/245 (85.31%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDR IYHRYC+ERAA HC+H FT VSK+TGLE+++LL R+PD+ITPNGLN+ +FAA+HEFQN H +AK K+++FIQ HFYG+ +FDL+KT+Y F AGRYEFQNKGAD+FIESLARLN+RL+   SDVTVVAFLIFP  TN+FN+++FRAQAIVKQ+R+T  +IQ+++G RL + CL+G IP    V   +D+++LKRC++AAQR +LPPICTHN+ QD++D +LCNLRRC LFNNR DRVK
Sbjct:  243 DKEAGDRNIYHRYCLERAAVHCAHAFTTVSKITGLESKYLLQREPDIITPNGLNVIKFAALHEFQNRHAIAKQKLHQFIQGHFYGHYNFDLDKTLYFFIAGRYEFQNKGADIFIESLARLNHRLQEQGSDVTVVAFLIFPAATNSFNVDSFRAQAIVKQLRETCNDIQNDMGTRLFEVCLRGRIPTGNDVLHQEDIVRLKRCIYAAQRNNLPPICTHNIVQDNIDLVLCNLRRCRLFNNRYDRVK 487          

HSP 2 Score: 280.796 bits (717), Expect = 4.638e-165
Identity = 130/235 (55.32%), Postives = 177/235 (75.32%), Query Frame = 2
Query:  137 FVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYST-FYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            F+++ T N +   +   VD EIY ++++FE AWEVVNKVGGIYTVIRTKA +T  EL DRY LLGP+NE C+R+EVD+ + + EP+  ++S MR   I +V GRWL+EG P+V+LFD+ S+   +  WK ELW++  IGIP +D E ND+++FG L+AWF+  FR+ +++ +    +PII+HFHEWL G GLIF RTR +D AT+F+THATLLGRYL A+SVDLYNNL KF++DK
Sbjct:   10 FIKDITANEDVLGLDKQVDEEIYKQKYVFECAWEVVNKVGGIYTVIRTKAATTGEELGDRYCLLGPLNEACMRTEVDIVEPNSEPLKRALSKMREHDINMVFGRWLIEGYPYVLLFDIGSSAWRIDSWKKELWDNCNIGIPVHDTECNDALIFGALVAWFLKEFRDALDEITEGVKLPIIAHFHEWLAGCGLIFSRTRHLDVATIFTTHATLLGRYLCAASVDLYNNLDKFDLDK 244          

HSP 3 Score: 249.98 bits (637), Expect = 9.829e-68
Identity = 112/148 (75.68%), Postives = 128/148 (86.49%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLF 2200
            KVIFHPEF++STNPL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEH+EDP SYGIY++DRRF+S + S+ QLT  L EFC YSRRQR++LRNRTERLSELLDW NL    + AR++++ R  P LF
Sbjct:  487 KVIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHIEDPASYGIYIVDRRFQSVDASVEQLTRCLHEFCQYSRRQRVVLRNRTERLSELLDWKNLGVYYSRARMVALYRQRPDLF 634          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: A0A4S2LHS0 (Glycogen [starch] synthase OS=Opisthorchis felineus OX=147828 GN=CRM22_007094 PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.178e-164
Identity = 165/245 (67.35%), Postives = 207/245 (84.49%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDR IYHRYC+ERAA HC+H FT VSK+TGLE+++LL R+PDVITPNGLN+ +FAA+HEFQN H +AK K+N+FIQ HFYG+ DFDL+KT+Y F AGRYEFQNKGAD+FIE+LARLN++L  A SDVTVVAFLIFP QTN+FN+++FRAQAIVKQ+R+TV  IQ ++G RL + CL+G IP    +   DD+ +LKRC++AAQR +LPPICTHNV QD++D +LCNLRRC LFN R DRVK
Sbjct:  260 DKEAGDRNIYHRYCLERAAVHCAHVFTTVSKITGLESKYLLRREPDVITPNGLNVVKFAALHEFQNRHALAKEKLNQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADVFIEALARLNHQLIQAQSDVTVVAFLIFPAQTNSFNVDSFRAQAIVKQLRETVNSIQGDMGHRLFEVCLRGRIPQGSDILTQDDIYRLKRCIYAAQRNNLPPICTHNVVQDNIDLVLCNLRRCQLFNGRNDRVK 504          

HSP 2 Score: 273.863 bits (699), Expect = 1.178e-164
Identity = 129/235 (54.89%), Postives = 168/235 (71.49%), Query Frame = 2
Query:  137 FVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYS-TFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            F+E D        ++  + P++Y R+++FE AWEVVNKVGGIYTVIRTKA +T  EL D Y+LLGP+NE C+R+EVDV +   E +  +ISAMR   I+IV GRWL+EG P V+LFD+ S+   +  WK +LW    IGIP  D E ND+++FG LIAWF+G F  ++ +   +   P+I+HFHEWLT  GL+F RTR +D ATVF+THATLLGRYL ASSVDLYNNL  F++DK
Sbjct:   32 FIENDL-----NALVQSISPDLYRRKYVFETAWEVVNKVGGIYTVIRTKAATTVEELGDHYVLLGPLNEICMRTEVDVTEPTNEALKRTISAMRQHDIKIVFGRWLIEGYPNVVLFDIGSSAWRIDSWKKDLWESCNIGIPVQDSECNDALIFGALIAWFLGEFCAQLERCEPSPRPPVIAHFHEWLTSVGLVFTRTRHLDVATVFTTHATLLGRYLCASSVDLYNNLPNFDLDK 261          

HSP 3 Score: 284.648 bits (727), Expect = 3.033e-80
Identity = 148/234 (63.25%), Postives = 169/234 (72.22%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSIS---------EASEHDFQDPPNEEQINFEVDIVDDNKERVELGLA 2431
            KVIFHPEF++STNPL+ MDYE+F RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+EDPKSYGIYVIDRRF++ E+SI QLT YL EFC YSRRQRIILRNRTERLSELLDW NL      ARL+++ +H P LF     AM          + D  SE SF L RPYSAP SPS+S          A   D   P +    + + D VD+  ER+ELGL+
Sbjct:  504 KVIFHPEFLSSTNPLLPMDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHVEDPKSYGIYVIDRRFQNVEDSIQQLTKYLVEFCQYSRRQRIILRNRTERLSELLDWKNLASYYRRARLMALHKHKPELFSATPSAM---------HNGDSISERSFCLSRPYSAPASPSLSGHSTPLPSAGADGSDRSSPTS----HLDEDEVDEATERLELGLS 724          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: G7Y9P6 (Glycogen [starch] synthase OS=Clonorchis sinensis OX=79923 GN=CLF_103419 PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.178e-164
Identity = 164/245 (66.94%), Postives = 207/245 (84.49%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDR IYHRYC+ERAA HC+H FT VSK+TGLE+++LL R+PDVITPNGLN+ +FAA+HEFQN H +AK K+N+FIQ HFYG+ DFDL+KT+Y F AGRYEFQNKGAD+FIE+LARLN++L  A SD+TVVAFLIFP QTN+FN+++FRAQAIVKQ+R+TV  IQ ++G RL + CL+G IP    +   DD+ +LKRC++AAQR +LPPICTHNV QD++D +LCNLRRC LFN R DRVK
Sbjct:  260 DKEAGDRNIYHRYCLERAAVHCAHVFTTVSKITGLESKYLLRREPDVITPNGLNVVKFAALHEFQNRHALAKEKLNQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADVFIEALARLNHQLIQAQSDITVVAFLIFPAQTNSFNVDSFRAQAIVKQLRETVNSIQGDMGHRLFEVCLRGRIPQGSDILTQDDIYRLKRCIYAAQRNNLPPICTHNVVQDNIDLVLCNLRRCQLFNGRNDRVK 504          

HSP 2 Score: 274.248 bits (700), Expect = 1.178e-164
Identity = 128/235 (54.47%), Postives = 169/235 (71.91%), Query Frame = 2
Query:  137 FVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYS-TFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            F+E D        ++  ++P++Y R+++FE AWEVVNKVGGIYTVIRTKA +T  EL D Y+LLGP+NE C+R+EVDV +   E +  +ISAMR   I+IV GRWL+EG P V+LFD+ S+   +  WK +LW    IGIP  D E ND+++FG L+AWF+G F  ++ +   +   P+I+HFHEWLT  GL+F RTR +D ATVF+THATLLGRYL ASSVDLYNNL  F++DK
Sbjct:   32 FIENDL-----NALVQSINPDLYRRKYVFETAWEVVNKVGGIYTVIRTKAATTVEELGDHYVLLGPLNEICMRTEVDVTEPTNEALKRTISAMRQHDIKIVFGRWLIEGYPNVVLFDIGSSAWRIDSWKKDLWESCNIGIPVQDSECNDALIFGALVAWFLGEFCAQLERCEPSPRPPVIAHFHEWLTSVGLVFTRTRHLDVATVFTTHATLLGRYLCASSVDLYNNLPNFDLDK 261          

HSP 3 Score: 284.648 bits (727), Expect = 2.685e-80
Identity = 149/234 (63.68%), Postives = 171/234 (73.08%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASE---------HDFQDPPNEEQINFEVDIVDDNKERVELGLA 2431
            KVIFHPEF++STNPL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+EDPKSYGIYVIDRRF++ E+SI QLT YL EFC YSRRQRIILRNRTERLSELLDW NL      ARL+++ +H P LF   ++  +A  N       D  SE SF L RPYSAP SPS+S  S           D   P +    + + D VD+  ER+ELGL+
Sbjct:  504 KVIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHVEDPKSYGIYVIDRRFQNVEDSIQQLTKYLVEFCQYSRRQRIILRNRTERLSELLDWKNLASYYRRARLMALHKHKPELF---SVPPSATHNG------DSISERSFCLSRPYSAPASPSLSGRSTPLPSAGADGSDRSSPTS----HLDEDEVDEATERLELGLS 724          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: A0A3R7CCK2 (Glycogen [starch] synthase OS=Clonorchis sinensis OX=79923 GN=GlyS PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.302e-164
Identity = 164/245 (66.94%), Postives = 207/245 (84.49%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDR IYHRYC+ERAA HC+H FT VSK+TGLE+++LL R+PDVITPNGLN+ +FAA+HEFQN H +AK K+N+FIQ HFYG+ DFDL+KT+Y F AGRYEFQNKGAD+FIE+LARLN++L  A SD+TVVAFLIFP QTN+FN+++FRAQAIVKQ+R+TV  IQ ++G RL + CL+G IP    +   DD+ +LKRC++AAQR +LPPICTHNV QD++D +LCNLRRC LFN R DRVK
Sbjct:  260 DKEAGDRNIYHRYCLERAAVHCAHVFTTVSKITGLESKYLLRREPDVITPNGLNVVKFAALHEFQNRHALAKEKLNQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADVFIEALARLNHQLIQAQSDITVVAFLIFPAQTNSFNVDSFRAQAIVKQLRETVNSIQGDMGHRLFEVCLRGRIPQGSDILTQDDIYRLKRCIYAAQRNNLPPICTHNVVQDNIDLVLCNLRRCQLFNGRNDRVK 504          

HSP 2 Score: 273.863 bits (699), Expect = 1.302e-164
Identity = 128/235 (54.47%), Postives = 169/235 (71.91%), Query Frame = 2
Query:  137 FVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYS-TFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            F+E D        ++  ++P++Y R+++FE AWEVVNKVGGIYTVIRTKA +T  EL D Y+LLGP+NE C+R+EVDV +   E +  +ISAMR   I+IV GRWL+EG P V+LFD+ S+   +  WK +LW    IGIP  D E ND+++FG L+AWF+G F  ++ +   +   P+I+HFHEWLT  GL+F RTR +D ATVF+THATLLGRYL ASSVDLYNNL  F++DK
Sbjct:   32 FIENDL-----NALVQSINPDLYRRKYVFETAWEVVNKVGGIYTVIRTKAATTVEELGDHYVLLGPLNEICMRTEVDVTEPTNEALKRTISAMRQHDIKIVFGRWLIEGYPNVVLFDIGSSAWRIDSWKKDLWESCNIGIPVQDSECNDALIFGALVAWFLGEFCAQLERCEPSPRPPVIAHFHEWLTSVGLVFTRTRHLDVATVFTTHATLLGRYLCASSVDLYNNLPNFDLDK 261          

HSP 3 Score: 284.648 bits (727), Expect = 2.854e-80
Identity = 149/234 (63.68%), Postives = 171/234 (73.08%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASE---------HDFQDPPNEEQINFEVDIVDDNKERVELGLA 2431
            KVIFHPEF++STNPL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+EDPKSYGIYVIDRRF++ E+SI QLT YL EFC YSRRQRIILRNRTERLSELLDW NL      ARL+++ +H P LF   ++  +A  N       D  SE SF L RPYSAP SPS+S  S           D   P +    + + D VD+  ER+ELGL+
Sbjct:  504 KVIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHVEDPKSYGIYVIDRRFQNVEDSIQQLTKYLVEFCQYSRRQRIILRNRTERLSELLDWKNLASYYRRARLMALHKHKPELF---SVPPSATHNG------DSISERSFCLSRPYSAPASPSLSGRSTPLPSAGADGSDRSSPTS----HLDEDEVDEATERLELGLS 724          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: A0A3Q0KCW2 (Glycogen [starch] synthase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 2.731e-164
Identity = 163/245 (66.53%), Postives = 204/245 (83.27%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDR IYHRYC+ERAA HC+H FT VSK+TGLE++FLL R+PD+ITPNGLN+ +FAA+HEFQN H +AK K+N+FIQ HFYG+ DFDL+KT+Y F AGRYEFQNKGAD+FIE+LARLN+ LK A +DVTVVAFLIFP  TN+FN+++FRAQAIVKQ+R+TV  IQ  +G RL + CL+G IP    +    DV +LKRC++A QR +LPPICTHNV QD++D +LCNLRRC LFN+R DRVK
Sbjct:  243 DKEAGDRNIYHRYCLERAAVHCAHVFTTVSKITGLESKFLLRREPDIITPNGLNVVKFAALHEFQNRHALAKEKLNQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADIFIEALARLNHHLKQAQTDVTVVAFLIFPAHTNSFNVDSFRAQAIVKQLRETVNSIQCEMGHRLFEVCLRGRIPQGSDLLTQGDVFRLKRCIYATQRNNLPPICTHNVVQDNIDLVLCNLRRCQLFNDRHDRVK 487          

HSP 2 Score: 278.87 bits (712), Expect = 2.731e-164
Identity = 130/223 (58.30%), Postives = 165/223 (73.99%), Query Frame = 2
Query:  173 NIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTF-YVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            ++I  ++PE+Y R+F+FE+AWEVVNKVGGIYTVIRTKA S   EL DRYIL GP+NE C+R+EVDV +   E +  +I AMR  G ++V GRWL+EG P V+LFD+ S+   +  WK ELW    IGIP +D E ND+V+FG LIAWF+  F E + +  T    PII+HFHEWLT  GL+F RTR +  ATVF+THATLLGRYL ASSVDLYN+L+ F++DK
Sbjct:   22 DLIQSINPEVYQRKFVFEVAWEVVNKVGGIYTVIRTKAASAVEELGDRYILFGPLNEVCMRTEVDVTEPTNEALKRTIKAMREHGTKVVFGRWLIEGYPNVVLFDIGSSAWRIDSWKKELWESCNIGIPVHDTECNDAVIFGALIAWFLKEFAENVRELETDPQPPIIAHFHEWLTSIGLVFTRTRHLPVATVFTTHATLLGRYLCASSVDLYNHLSDFDLDK 244          

HSP 3 Score: 283.878 bits (725), Expect = 4.270e-80
Identity = 142/230 (61.74%), Postives = 165/230 (71.74%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQ-----INFEVDIVDDNKERVELGLA 2431
            KVIFHPEF++STNPL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCF+EEH+EDPKSYGIY++DRRF+S E+S+ QLT YL EF  YSRRQRI+LRNRTERLSELLDW NL+     ARL+++ +  P LF   N             + D  S  SFH+ RPYSAP SPS+S  S        N         + + D +DDN ER+ELGL 
Sbjct:  487 KVIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFIEEHVEDPKSYGIYIVDRRFQSCEDSVQQLTKYLVEFSQYSRRQRIVLRNRTERLSELLDWKNLSCYYQRARLMALKKFSPELFTSNN-------------NDDALSTHSFHISRPYSAPVSPSLSGQSTPLRSAGANSSNRSSPTSHLDDDEIDDNTERLELGLG 703          
BLAST of Glycogen [starch] synthase vs. Ensembl Cavefish
Match: gys1 (glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1243])

HSP 1 Score: 300.827 bits (769), Expect = 2.168e-139
Identity = 138/245 (56.33%), Postives = 189/245 (77.14%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA  C+H FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +FI+ HFYG+LDF+L+KTV+LF AGRYEF NKGAD+F+E+LARLNY L++ +S+ TV+AF I P +TNNFN+ET + QA+ KQ+ DT + ++   G +L +S L G +P    + D +D   +KR +FA QR  LPPICTHN+ +D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGDRQIYHRYCLERAAARCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRIQEFIRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADLFLEALARLNYLLRVNHSETTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPEVSKMLDKEDFTMMKRAIFATQRQCLPPICTHNMLEDSSDPILTCIRRIGLFNSSQDRVK 474          

HSP 2 Score: 216.853 bits (551), Expect = 2.168e-139
Identity = 102/207 (49.28%), Postives = 139/207 (67.15%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFEIAWEV NKVGGIYTVI+TKA+ TC E  + Y L+GP  E+ +R++V++ +     +  +I  M S G ++  GRWL+EG+P+V+L DV      L  WK+ELW +  IG+P  D+E ND+V+FG L AW +G +  +          I++HFHEWL G GL+  R RQ+  AT+F+THATLLGRYL A +VD YNNL +F +DK
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTCEEWGENYFLVGPYMESNVRTQVELIEPTNPVLRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVGFTAWSLDRWKSELWENCAIGVPWFDREANDAVLFGFLTAWLLGEYAAQCEDPPH----ILAHFHEWLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDK 231          

HSP 3 Score: 214.927 bits (546), Expect = 6.276e-59
Identity = 116/185 (62.70%), Postives = 137/185 (74.05%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAA-ENSKIISDTDIFSEGSFHLERPYSAPNSPS 2320
            KVIFHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+ DP SYGIY++DRR++S +ES  QLT +LF+FC  SRRQRII RNRTERLS+LLDW  L   R    ARH         +A++ A  ++ +    D  S   F   RP S P SP+
Sbjct:  474 KVIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSSYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYL--GRYYVSARH---------MALSKAFPDTYVYEPHDPTSTSGFRYPRPASVPPSPA 647          
BLAST of Glycogen [starch] synthase vs. Ensembl Cavefish
Match: gys1 (glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1243])

HSP 1 Score: 300.056 bits (767), Expect = 5.643e-139
Identity = 138/245 (56.33%), Postives = 189/245 (77.14%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA  C+H FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +FI+ HFYG+LDF+L+KTV+LF AGRYEF NKGAD+F+E+LARLNY L++ +S+ TV+AF I P +TNNFN+ET + QA+ KQ+ DT + ++   G +L +S L G +P    + D +D   +KR +FA QR  LPPICTHN+ +D  DPIL  +RR  LFN+  DRVK
Sbjct:  230 DKEAGDRQIYHRYCLERAAARCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRIQEFIRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADLFLEALARLNYLLRVNHSETTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPEVSKMLDKEDFTMMKRAIFATQRQCLPPICTHNMLEDSSDPILTCIRRIGLFNSSQDRVK 474          

HSP 2 Score: 216.083 bits (549), Expect = 5.643e-139
Identity = 102/207 (49.28%), Postives = 139/207 (67.15%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFEIAWEV NKVGGIYTVI+TKA+ TC E  + Y L+GP  E+ +R++V++ +     +  +I  M S G ++  GRWL+EG+P+V+L DV      L  WK+ELW +  IG+P  D+E ND+V+FG L AW +G +  +          I++HFHEWL G GL+  R RQ+  AT+F+THATLLGRYL A +VD YNNL +F +DK
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTCEEWGENYFLVGPYMESNVRTQVELIEPTNPVLRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVGFTAWSLDRWKSELWENCAIGVPWFDREANDAVLFGFLTAWLLGEYAAQCEDPPH----ILAHFHEWLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDK 231          

HSP 3 Score: 206.453 bits (524), Expect = 5.129e-56
Identity = 101/128 (78.91%), Postives = 115/128 (89.84%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL 2152
            KVIFHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFMEEH+ DP SYGIY++DRR++S +ES  QLT +LF+FC  SRRQRII RNRTERLS+LLDW  L
Sbjct:  474 KVIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSSYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYL 601          
BLAST of Glycogen [starch] synthase vs. Ensembl Cavefish
Match: gys2 (glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-030826-31])

HSP 1 Score: 310.071 bits (793), Expect = 2.484e-114
Identity = 145/245 (59.18%), Postives = 191/245 (77.96%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +R+AG+RQIYHRYC+ERAA HCSH FT VS++T +EA  +LHRKPDV+TPNGLN+++F+A+HEFQNLH + KLKI +F++ HFYG+LDF+LEKT++ F AGRYEF NKGAD+F+ESL+RLNY L++  SDVTVV F I P +TNNFN+E+ + QA+ KQ+ DT + ++   G RL ++ L+G IP    + D DD   +KR +FA QR SLPP+ THN+  D  DPIL N+RR  LFN+R DRVK
Sbjct:  179 DREAGERQIYHRYCLERAAVHCSHVFTTVSQITAVEADHMLHRKPDVVTPNGLNVKKFSAMHEFQNLHSMNKLKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADIFLESLSRLNYLLRVHKSDVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQTVKEKFGKRLYEALLRGEIPDMNKILDRDDFTIMKRAIFATQRHSLPPVTTHNMLDDSTDPILSNVRRIGLFNSRNDRVK 423          

HSP 2 Score: 123.635 bits (309), Expect = 2.484e-114
Identity = 75/208 (36.06%), Postives = 103/208 (49.52%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
             LFEIAWEV NKVGGIYTVI+TKAK T  E  + + ++GP  E   +++V+ CD    P + +I A                                               I NN  + + S         +IG  R+ +N+       +++HFHEW  G GL+  R+R++  ATVF+THATLLGRYL A + D YNNL KF+ID+
Sbjct:   29 LLFEIAWEVTNKVGGIYTVIQTKAKITVDEWGENFFMIGPYYEHNFKTQVEQCD----PPNAAIKAAMD-------------------------------------------SIKNNGCQVSQSA--------YIGKLRKDLNKLQD-KPNVVAHFHEWQAGVGLVLSRSRKVPMATVFTTHATLLGRYLCAGNADFYNNLDKFDIDR 180          

HSP 3 Score: 236.498 bits (602), Expect = 7.237e-67
Identity = 106/154 (68.83%), Postives = 125/154 (81.17%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLA 2218
            KV+FHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFMEEH+ DP +YGIY++DRRF+S +ES  QLT ++F FC  SRRQRI+ RNRTERLS+LLDW  L      AR L+++R  P  F+   LA
Sbjct:  423 KVVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHISDPSAYGIYIVDRRFRSADESCNQLTQFMFSFCQQSRRQRIVQRNRTERLSDLLDWRYLGRFYMHARHLALSRAFPERFKIDTLA 576          
BLAST of Glycogen [starch] synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008981.1 (pep scaffold:Pmarinus_7.0:GL476544:387127:395235:1 gene:ENSPMAG00000008122.1 transcript:ENSPMAT00000008981.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.787 bits (569), Expect = 1.183e-67
Identity = 116/200 (58.00%), Postives = 148/200 (74.00%), Query Frame = 1
Query:  964 DVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            D ITPNGL+L++F+A HEFQN H ++KL+I +FI+ HFYG++DFD EKT++LFTAGRYEF NKG D+F+ +  RLNYRL+  N DVTVVAFLI P QTNNFN+ET + QA+ KQ+ DT   I+     +L +S L   IP  G   D +DV  LKR +F+AQR  LPP+CTHN+  D+ DPIL  +RR  LFNNR+DRVK
Sbjct:    2 DFITPNGLSLKKFSATHEFQN-HVLSKLRIQEFIRGHFYGHIDFDFEKTLFLFTAGRYEFTNKGTDLFLXT--RLNYRLQTKNKDVTVVAFLIMPAQTNNFNVETLKGQAVRKQLWDTANTIKEKFAKKLYESLLMSEIPDIGHCLDGEDVTHLKRAIFSAQRHLLPPVCTHNMQDDNSDPILNTVRRIGLFNNRSDRVK 198          

HSP 2 Score: 76.6406 bits (187), Expect = 7.938e-16
Identity = 34/49 (69.39%), Postives = 42/49 (85.71%), Query Frame = 2
Query: 1739 MGKRSNGSGK-KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEP 1882
            +G  +N S + KVIFHPEF++ST+PL+ MDY+EF RGCHLGVFPSYYEP
Sbjct:  187 IGLFNNRSDRVKVIFHPEFLSSTSPLLPMDYDEFVRGCHLGVFPSYYEP 235          
BLAST of Glycogen [starch] synthase vs. Ensembl Yeast
Match: GSY1 (Glycogen synthase; expression induced by glucose limitation, nitrogen starvation, environmental stress, and entry into stationary phase; GSY1 has a paralog, GSY2, that arose from the whole genome duplication; relocalizes from nucleus to cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000001911])

HSP 1 Score: 256.914 bits (655), Expect = 9.003e-121
Identity = 134/255 (52.55%), Postives = 178/255 (69.80%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVD-------SCLKGSIPM-AGSVFDNDDVMKLKRCVFAAQR--FSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG R IYHRYCIERAA H +  FT VS++T LEA+ LL RKPD I PNGLN+ +F A+HEFQNLH + K KIN F++ HF+G  DFDL+ TVY F AGRYE++NKGADMFIESLARLNYRLK++ S  TVVAFLI P +TN+F +E  ++QAIVK + +TV E+  +IG R+ +       + L+  +P     +  + + + LK+ V A +R    LPP+ THN+  D  DPIL  +R   LFN+ +DRVK
Sbjct:  219 DQEAGKRGIYHRYCIERAAAHTADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKDKINDFVRGHFHGCFDFDLDNTVYFFIAGRYEYKNKGADMFIESLARLNYRLKVSGSKKTVVAFLIMPAKTNSFTVEALKSQAIVKSLENTVNEVTASIGKRIFEHTMRYPHNGLESELPTNLDELLKSSEKVLLKKRVLALRRPYGELPPVVTHNMCDDANDPILNQIRHVRLFNDSSDRVK 473          

HSP 2 Score: 195.282 bits (495), Expect = 9.003e-121
Identity = 98/222 (44.14%), Postives = 140/222 (63.06%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDME--------PVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYL-SASSVDLYNNLTKFEIDKLETGK 853
             LFE+A EV N+VGGIY+V+++KA  T  +  D Y LLGP+N+    SEV+  D + E        P+  ++ +MR  G+  V G WL+EG P VILF+++S   FL +WK +LW+   I  P +D ETND+++ G ++ WF+G   +  + ++     II HFHEWL G  L   R ++ID  T+F+THATLLGRYL +A  VD YNNL  F++D+ E GK
Sbjct:    9 LLFEVATEVTNRVGGIYSVLKSKAPVTVAQYGDNYTLLGPLNKATYESEVEKLDWEDESIFPEELLPIQKTLMSMREKGVNFVYGNWLIEGAPRVILFELDSVRHFLNEWKADLWSLVGIPSPEHDHETNDAILLGYVVVWFLGEVSKLDSSHA-----IIGHFHEWLAGVALPLCRKKRIDVVTIFTTHATLLGRYLCAAGDVDFYNNLQYFDVDQ-EAGK 224          

HSP 3 Score: 199.134 bits (505), Expect = 2.901e-54
Identity = 108/198 (54.55%), Postives = 136/198 (68.69%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLE--DPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEG---SFHLERPYSAPNSPSISEAS 2335
            KVIFHPEF+ + NP++G+DY+EF RGCHLGVFPSYYEPWGYTPAECTVMG+PS+TTN+SGFG +ME+ +E    K YGIY++DRRFKS +ES+ QL DY+ EF + +RRQRI  RNRTERLS+LLDW  +      AR L + R  P  F  K L        + ISD ++ +      F + RP S P SP +   S
Sbjct:  473 KVIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDLIETDQAKDYGIYIVDRRFKSPDESVEQLADYMEEFVNKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLGLRRAYPEQF--KQLV------GETISDANMNTLAGGKKFKIARPLSVPGSPKVRSNS 662          
BLAST of Glycogen [starch] synthase vs. Ensembl Yeast
Match: GSY2 (Glycogen synthase; expression induced by glucose limitation, nitrogen starvation, heat shock, and stationary phase; activity regulated by cAMP-dependent, Snf1p and Pho85p kinases as well as by the Gac1p-Glc7p phosphatase; GSY2 has a paralog, GSY1, that arose from the whole genome duplication; relocalizes from cytoplasm to plasma membrane upon DNA replication stress [Source:SGD;Acc:S000004248])

HSP 1 Score: 242.276 bits (617), Expect = 2.207e-69
Identity = 127/255 (49.80%), Postives = 171/255 (67.06%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLK-------GSIPM-AGSVFDNDDVMKLKRCVFAAQR--FSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            + +AG   IYHRYCIERAA H +  FT VS++T  EA+ LL RKPD I PNGLN+ +F A HEFQNLH + K KIN F++ HF+G  DFDL+ T+Y F AGRYE++NKGADMFIE+LARLNYRLK++ S  TVVAF++ P + N+F +E  + QA V+ + +TV E+  +IG R+ D  ++         +P   G +  + D + LKR + A +R    LPPI THN+  D  D IL  +R+  LFN+ +DRVK
Sbjct:  219 DHEAGRFGIYHRYCIERAAAHSADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVIKFQAFHEFQNLHALKKEKINDFVRGHFHGCFDFDLDNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIVMPAKNNSFTVEALKGQAEVRALENTVHEVTTSIGKRIFDHAIRYPHNGLTTELPTDLGELLKSSDKVMLKRRILALRRPEGQLPPIVTHNMVDDANDLILNKIRQVQLFNSPSDRVK 473          

HSP 2 Score: 201.445 bits (511), Expect = 4.082e-55
Identity = 102/225 (45.33%), Postives = 142/225 (63.11%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCD--------SDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSAS-SVDLYNNLTKFEIDKLETGKFII 862
             LFE A EV N+VGGIY+V+++KA  T  +  D Y L+GP+N+   ++EVD+ D         +M PV +++  M S G+  V GRWL+EG P VILFD++S  G+  +WK +LW+   I  P ND ETND+++ G  +AWF+G      +Q++     I++HFHEWL G  L   R R+ID  T+F+THATLLGRYL AS S D YN L   ++D  E G+F I
Sbjct:    9 LLFETATEVANRVGGIYSVLKSKAPITVAQYKDHYHLIGPLNKATYQNEVDILDWKKPEAFSDEMRPVQHALQTMESRGVHFVYGRWLIEGAPKVILFDLDSVRGYSNEWKGDLWSLVGIPSPENDFETNDAILLGYTVAWFLGEVAHLDSQHA-----IVAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRYLCASGSFDFYNCLESVDVDH-EAGRFGI 227          

HSP 3 Score: 193.356 bits (490), Expect = 2.752e-52
Identity = 108/218 (49.54%), Postives = 145/218 (66.51%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLE--DPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEG-SFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDD 2401
            K+IFHPEF+ + NP++G+DY+EF RGCHLGVFPSYYEPWGYTPAECTVMG+PS+TTN+SGFG +ME+ +E    K YGIY++DRRFK+ +ES+ QL DY+ EF   +RRQRI  RNRTERLS+LLDW  +      AR L++ R  P  F++    +   E +   S+ D  + G    + RP S P SP    ++   +  P +   +  EV+  DD
Sbjct:  473 KMIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDLIETNQAKDYGIYIVDRRFKAPDESVEQLVDYMEEFVKKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRGYPDQFRE----LVGEELND--SNMDALAGGKKLKVARPLSVPGSPRDLRSNSTVYMTPGDLGTLQ-EVNNADD 683          
BLAST of Glycogen [starch] synthase vs. Ensembl Nematostella
Match: EDO43220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZD4])

HSP 1 Score: 310.457 bits (794), Expect = 1.296e-143
Identity = 147/245 (60.00%), Postives = 194/245 (79.18%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDR IYHRYC+ERAA H +H FT VS++T  EA+ LL RKPD++ PNGLN+ ++ A+HEFQNLH  +K KIN F++ HFYG+ DFDL+KT+Y F AGRYE+ NKGAD+F+ESLARLNY+LK  NS+ TVVAFLIFPT+TNNFN+++ R QA+ KQ+++TV EIQ  IG R+ +SC+KG++P   S+ + DD+++LKRCV  AQ   +PP+ THNV  D  DPILC++RR  LFN R DRVK
Sbjct:  220 DKEAGDRGIYHRYCLERAAAHAAHVFTTVSRITADEAEHLLKRKPDLVVPNGLNVVKYTALHEFQNLHAKSKEKINDFVRGHFYGHFDFDLDKTLYFFAAGRYEYFNKGADVFLESLARLNYQLKTNNSETTVVAFLIFPTKTNNFNVDSLRGQAVTKQLKETVNEIQDKIGKRIYESCVKGNLPSGESLLEPDDIVRLKRCVLGAQHPEMPPVVTHNVLNDATDPILCHIRRIQLFNTRHDRVK 464          

HSP 2 Score: 219.55 bits (558), Expect = 1.296e-143
Identity = 98/208 (47.12%), Postives = 144/208 (69.23%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            F FE++WEV NKVGGIYTVIR+KA ++     D Y ++G  N+     EV++ + DM+ +  ++  MR+ G+++  GRWL+EG P V+LFD+ S Y  L  WK +LW +  IG+P+ D E NDS+V G L+A FI  FR + +      +P+++HFHEW  G G I +RT++++ +TVF+THATLLGRYL A++VD YNNL +F++DK
Sbjct:   18 FTFEVSWEVANKVGGIYTVIRSKAATSVDIHGDNYCMMGIYNKAQCNMEVEMTEPDMKAMKGALKCMRNKGVQVHFGRWLIEGYPKVVLFDIGSVYHKLNKWKADLWENCHIGLPDGDTEANDSLVLGCLVAQFISEFRSRFDP----EIPVVAHFHEWQAGVGEIMLRTKKVNVSTVFTTHATLLGRYLCAANVDFYNNLERFDVDK 221          

HSP 3 Score: 201.445 bits (511), Expect = 6.991e-55
Identity = 103/154 (66.88%), Postives = 121/154 (78.57%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNL----TFARLLSMARHLPHLFQDKNLA 2218
            K++FHPEF+++ NPL+ M+Y EF RGCHLGVFPSYYEPWGYT AECTVMGIPSVTTNLSGFG FM EH+ DP SYGIY++DRRFK  EESI +L+ Y+F FC  +RRQRII RNRTERLSELLDW +L      ARLL + R  P  ++  NL 
Sbjct:  464 KIVFHPEFLSNINPLLAMEYSEFVRGCHLGVFPSYYEPWGYTRAECTVMGIPSVTTNLSGFGRFMAEHVCDPTSYGIYIVDRRFKCAEESIQELSGYMFSFCTMTRRQRIIQRNRTERLSELLDWKSLYRFYARARLLGLHRLEPAKYEHPNLT 617          
BLAST of Glycogen [starch] synthase vs. Ensembl Medaka
Match: gys2 (glycogen synthase 2 [Source:NCBI gene;Acc:101163866])

HSP 1 Score: 301.597 bits (771), Expect = 1.581e-141
Identity = 140/245 (57.14%), Postives = 190/245 (77.55%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AG+RQIYHRYC+ERAA HCSH FT VS++T +EA  +LHRKPD++TPNGLN+++F+A+HEFQNLH + K +I +F++ HFYG+LDF+L+KT++ F AGRYEF NKGAD+F+ESL+RLNY L++  +D+TVV F I P +TNNFN+E+ + QAI KQ+ DT   ++   G +L D+ LKG IP   ++ D DD   +KR +FA QR SLPP+ THN+  D  DPIL N+RR  LFN+R DRVK
Sbjct:  232 DKEAGERQIYHRYCLERAAVHCSHVFTTVSQITAVEANHILHRKPDIVTPNGLNVKKFSAMHEFQNLHSINKARIQEFVRGHFYGHLDFNLDKTLFFFIAGRYEFTNKGADIFLESLSRLNYLLRVHRNDMTVVVFFIMPAKTNNFNVESLKGQAIRKQLWDTAHTVKEKFGKKLYDALLKGHIPDMNNILDRDDFTIMKRAIFATQRHSLPPVTTHNMEDDSTDPILSNVRRIGLFNSRNDRVK 476          

HSP 2 Score: 223.016 bits (567), Expect = 1.581e-141
Identity = 108/208 (51.92%), Postives = 142/208 (68.27%), Query Frame = 2
Query:  215 FLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
             LFE+AWEV NKVGGIYTVI++KAK T  E  + Y ++GP  E   +++V+ C+     + N++ A+   G ++  GRWL+EGNPFV+LFD+ SA   L  WK +LW+   IG+P +D+E NDS++ G LIAWF+   RE  N        II HFHEW  GPGLI  R+R+I  AT+F+THATLLGRYL A +VD YNNL KF+IDK
Sbjct:   30 LLFEVAWEVANKVGGIYTVIQSKAKVTVDEWGENYFMMGPYFEHNFKTQVEGCEPPNAAIRNAMDALIHNGCQVHFGRWLIEGNPFVVLFDIGSAAWNLDRWKGDLWDTCHIGLPFHDREANDSLILGSLIAWFL---RELTNHLEG-KKNIICHFHEWQAGPGLILSRSRKIPMATIFTTHATLLGRYLCAGNVDFYNNLDKFDIDK 233          

HSP 3 Score: 218.779 bits (556), Expect = 3.054e-60
Identity = 119/186 (63.98%), Postives = 138/186 (74.19%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSIS 2326
            K+IFHPEF++ST+PL+ MDY++F RGC+LGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFMEEH+ DP +YGIY++DRRFKS EES  QLT ++F FC  SRRQRII RNRTERLS+LLDW  L   R    AR          LA++ A   K   DT + +EG F   RPYS P SPS S
Sbjct:  476 KIIFHPEFLSSTSPLLPMDYDDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHISDPTAYGIYIVDRRFKSPEESCNQLTQFMFSFCQQSRRQRIIQRNRTERLSDLLDWRYL--GRFYVHARQ---------LALSRAFPDKFKMDTILKTEG-FRYPRPYSVPPSPSAS 649          
BLAST of Glycogen [starch] synthase vs. Ensembl Medaka
Match: gys1 (glycogen synthase 1 [Source:NCBI gene;Acc:101155437])

HSP 1 Score: 300.827 bits (769), Expect = 1.497e-139
Identity = 138/245 (56.33%), Postives = 189/245 (77.14%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA HC+H FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+K ++LF AGRYEF NKGAD+F+E+LARLNY L++ +SDVTV+AF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L G +P    + D +D   +KR +FA QR S PPICTHN+  D  DPIL ++RR  LFN+  DRVK
Sbjct:  230 DKEAGDRQIYHRYCLERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAHTVKERFGKKLYESLLVGQLPDVAKMLDKEDFTIMKRAIFATQRQSQPPICTHNMLDDSSDPILNSVRRIGLFNSSADRVK 474          

HSP 2 Score: 217.238 bits (552), Expect = 1.497e-139
Identity = 104/207 (50.24%), Postives = 140/207 (67.63%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            LFEIAWEV NKVGGIYTVI+TKA+ T  E  + Y L+GP  E+ +R++V++ +     +  +I  M S G ++  GRWL+EG+P+V+L DV      L  WK+ELW+   IG+P  D+E ND+V+FG L AW +G F  +  +       I++HFHEWL G GL+  R RQ+  AT+F+THATLLGRYL A SVD YNNL+KF +DK
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTAEEWGENYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNSSGCKVYFGRWLIEGSPYVVLIDVGFTAWSLDRWKSELWDLGAIGVPWFDREANDAVLFGFLTAWLLGEFAAQSEEPPH----IVAHFHEWLAGLGLVLCRKRQLPVATIFTTHATLLGRYLCAGSVDFYNNLSKFNVDK 231          

HSP 3 Score: 216.083 bits (549), Expect = 2.687e-59
Identity = 120/201 (59.70%), Postives = 141/201 (70.15%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIF------SEGSFHLERPYSAPNSPSISEAS 2335
            S+    K+IFHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRR+K  +ES  QLT +LF+FC  SRRQRII RNRTERLS+LLDW  L   R    ARH         +A+A     K   DT I+      S   F   RP S P SPS+S  S
Sbjct:  468 SSADRVKIIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRYL--GRYYIAARH---------MALA-----KAFPDTFIYEPHEPSSATGFRYPRPASVPPSPSLSRHS 652          
BLAST of Glycogen [starch] synthase vs. Ensembl Medaka
Match: gys1 (glycogen synthase 1 [Source:NCBI gene;Acc:101155437])

HSP 1 Score: 300.827 bits (769), Expect = 1.451e-101
Identity = 138/245 (56.33%), Postives = 189/245 (77.14%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYC+ERAA HC+H FT VS++T +EA+ LL RKPD++TPNGLN+++F+A+HEFQNLH  +K +I +F++ HFYG+LDF+L+K ++LF AGRYEF NKGAD+F+E+LARLNY L++ +SDVTV+AF I P +TNNFN+ET + QA+ KQ+ DT   ++   G +L +S L G +P    + D +D   +KR +FA QR S PPICTHN+  D  DPIL ++RR  LFN+  DRVK
Sbjct:  166 DKEAGDRQIYHRYCLERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAHTVKERFGKKLYESLLVGQLPDVAKMLDKEDFTIMKRAIFATQRQSQPPICTHNMLDDSSDPILNSVRRIGLFNSSADRVK 410          

HSP 2 Score: 90.8929 bits (224), Expect = 1.451e-101
Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 2
Query:  668 IISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            I++HFHEWL G GL+  R RQ+  AT+F+THATLLGRYL A SVD YNNL+KF +DK
Sbjct:  111 IVAHFHEWLAGLGLVLCRKRQLPVATIFTTHATLLGRYLCAGSVDFYNNLSKFNVDK 167          

HSP 3 Score: 216.853 bits (551), Expect = 6.768e-60
Identity = 120/201 (59.70%), Postives = 141/201 (70.15%), Query Frame = 2
Query: 1751 SNGSGKKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIF------SEGSFHLERPYSAPNSPSISEAS 2335
            S+    K+IFHPEF++ST+PL+ MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFMEEH+ DP +YGIY++DRR+K  +ES  QLT +LF+FC  SRRQRII RNRTERLS+LLDW  L   R    ARH         +A+A     K   DT I+      S   F   RP S P SPS+S  S
Sbjct:  404 SSADRVKIIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRYL--GRYYIAARH---------MALA-----KAFPDTFIYEPHEPSSATGFRYPRPASVPPSPSLSRHS 588          

HSP 4 Score: 70.0922 bits (170), Expect = 5.662e-12
Identity = 34/75 (45.33%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  218 LFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVS 442
            LFEIAWEV NKVGGIYTVI+TKA+ T  E  + Y L+GP  E+ +R++V++ +     +  +I  M S G +  +
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTAEEWGENYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNSSGCKFAA 103          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000028231.1 (SMESG000028231.1)

HSP 1 Score: 513.072 bits (1320), Expect = 1.198e-177
Identity = 261/261 (100.00%), Postives = 261/261 (100.00%), Query Frame = 2
Query:   56 MYKVYKGGIIKATPGXXXXXXXXXXXXFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK
Sbjct:    1 MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 261          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000042473.1 (SMESG000042473.1)

HSP 1 Score: 338.191 bits (866), Expect = 3.543e-174
Identity = 166/245 (67.76%), Postives = 208/245 (84.90%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDR IYHRYC+ERAA HC+H+FT VS++T LE+Q+LL RK DVITPNGLN+ +FAA+HEFQN H  AK KI++FIQ HFYG+L+FDL+KT+Y F AGRYEF+NKGAD+FIESLARLN+RLK   SDVTVVAFLIFP +TNNFN+E+FR+QAI KQ+R+TV +IQ N+G R+ + CLKG++P  G V   DD++KLKRC+++AQR SLPPI THNV  D  DPILCNLRRC +FN+R+DRVK
Sbjct:  242 DKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVK 486          

HSP 2 Score: 294.664 bits (753), Expect = 3.543e-174
Identity = 135/234 (57.69%), Postives = 175/234 (74.79%), Query Frame = 2
Query:  137 FVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 838
            F+++   N E  +    +DPEIY  R++FEIAWEVVNKVGGIYTVI+TKA +T  EL D YIL+GP+NE C+R+EVD+ +    P+ N+I+ MRS GI+I+ GRWL++G P V+LFD+ S+   +  WK ELW  + IGIP  D E NDSV+ GGL+ WF+G+FR  +++    Y PII+HFHEWL   GLIF RTR +D ATVF+THATLLGRYLSASS DLYNNL+KF++DK
Sbjct:   10 FLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDK 243          

HSP 3 Score: 283.493 bits (724), Expect = 1.124e-83
Identity = 141/225 (62.67%), Postives = 173/225 (76.89%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGLA 2431
            KVIFHPEF++S NPLI MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DPKSYGIY++DRR +SGEES+ QLT+Y+ +F  YSRRQRI+LRNRTERLSELLDW NL F    +R++++++  PHLF D +  ++       + ++D FSE S+H+ RPYSAP SP+ S  S    +       +  E D VD+N ER+ELGLA
Sbjct:  486 KVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLF-DYHTPIS-------LDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSPSLELEEDEVDENAERIELGLA 702          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000028231.1 (SMESG000028231.1)

HSP 1 Score: 520.005 bits (1338), Expect = 5.172e-173
Identity = 280/339 (82.60%), Postives = 288/339 (84.96%), Query Frame = 2
Query:   56 MYKVYKGGIIKATPGXXXXXXXXXXXXFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKLETGKFIIDIVLKELQRIVHIRLLVSVKSLGLRLNFCCI------ENQ-MLSRRMD-*TFKG--LQRFMSFKIFMGLQ 1042
            MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK E G            R ++ R  +   +      F C+      E Q +L R+ D  T  G  LQRF +   F  L 
Sbjct:    1 MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK-EAG-----------DRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLH 327          

HSP 2 Score: 497.278 bits (1279), Expect = 3.379e-164
Identity = 248/253 (98.02%), Postives = 248/253 (98.02%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGLAPSPXXXXXXXXXXXXKRYTNTKMFPLNK 2515
            KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF    ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGLAPSPENLLD NELNYLKRYTNTKMFPLNK
Sbjct:  504 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFYYKKARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGLAPSPENLLDTNELNYLKRYTNTKMFPLNK 756          

HSP 3 Score: 474.167 bits (1219), Expect = 2.220e-155
Identity = 241/245 (98.37%), Postives = 245/245 (100.00%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKIN+FIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPILCNLRRCNLFNNRTDRVK
Sbjct:  260 DKEAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINRFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPILCNLRRCNLFNNRTDRVK 504          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000028231.1 (SMESG000028231.1)

HSP 1 Score: 519.235 bits (1336), Expect = 6.837e-173
Identity = 280/339 (82.60%), Postives = 288/339 (84.96%), Query Frame = 2
Query:   56 MYKVYKGGIIKATPGXXXXXXXXXXXXFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKLETGKFIIDIVLKELQRIVHIRLLVSVKSLGLRLNFCCI------ENQ-MLSRRMD-*TFKG--LQRFMSFKIFMGLQ 1042
            MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK E G            R ++ R  +   +      F C+      E Q +L R+ D  T  G  LQRF +   F  L 
Sbjct:    1 MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK-EAG-----------DRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLH 327          

HSP 2 Score: 474.167 bits (1219), Expect = 2.003e-155
Identity = 241/245 (98.37%), Postives = 245/245 (100.00%), Query Frame = 1
Query:  829 NRQAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINKFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPIXXXXXXXXXXXXXTDRVK 1563
            +++AGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKIN+FIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPILCNLRRCNLFNNRTDRVK
Sbjct:  260 DKEAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINRFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPILCNLRRCNLFNNRTDRVK 504          

HSP 3 Score: 452.595 bits (1163), Expect = 3.172e-147
Identity = 230/253 (90.91%), Postives = 232/253 (91.70%), Query Frame = 2
Query: 1769 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF----ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGLAPSPXXXXXXXXXXXXKRYTNTKMFPLNK 2515
            KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIY+  +              YLFEFCHYSRRQRIILRNRTERLSELLDWNNLTF    ARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGLAPSPENLLD NELNYLKRYTNTKMFPLNK
Sbjct:  504 KVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYIFYK--------------YLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFYYKKARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQINFEVDIVDDNKERVELGLAPSPENLLDTNELNYLKRYTNTKMFPLNK 742          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000028231.1 (SMESG000028231.1)

HSP 1 Score: 365.155 bits (936), Expect = 2.793e-121
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 2
Query:   56 MYKVYKGGIIKATPGXXXXXXXXXXXXFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGV 625
            MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGV
Sbjct:    1 MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGV 190          
The following BLAST results are available for this feature:
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GYS11.035e-13956.33glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
GYS21.881e-13556.33glycogen synthase 2 [Source:HGNC Symbol;Acc:HGNC:4... [more]
GYS17.311e-10056.33glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
GYS14.964e-965.38glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gsy-17.661e-13055.87Glycogen [starch] synthase [Source:UniProtKB/Swis... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GlyS6.428e-14462.04gene:FBgn0266064 transcript:FBtr0083037[more]
GlyS1.123e-14362.04gene:FBgn0266064 transcript:FBtr0333276[more]
GlyS1.123e-14362.04gene:FBgn0266064 transcript:FBtr0083035[more]
GlyS1.123e-14362.04gene:FBgn0266064 transcript:FBtr0083036[more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gys11.211e-13855.51glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-... [more]
gys11.211e-13855.51glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-... [more]
gys21.316e-13857.55glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-0308... [more]
gys21.395e-13857.55glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-0308... [more]
gys22.063e-13857.55glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-0308... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr901.287e-13756.33WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
wdr901.458e-13756.33WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
wdr901.598e-13756.33WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
wdr902.632e-13756.33WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
wdr905.749e-13255.65WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gys12.744e-13956.33glycogen synthase 1, muscle [Source:MGI Symbol;Acc... [more]
Gys25.727e-13757.55glycogen synthase 2 [Source:MGI Symbol;Acc:MGI:238... [more]
Gys17.958e-10056.33glycogen synthase 1, muscle [Source:MGI Symbol;Acc... [more]
Gys11.265e-5863.35glycogen synthase 1, muscle [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VFC8|GYS_DROME4.924e-14362.04Glycogen [starch] synthase OS=Drosophila melanogas... [more]
sp|P13807|GYS1_HUMAN4.565e-13956.33Glycogen [starch] synthase, muscle OS=Homo sapiens... [more]
sp|Q5R9H0|GYS1_PONAB4.641e-13956.33Glycogen [starch] synthase, muscle OS=Pongo abelii... [more]
sp|A7MB78|GYS1_BOVIN1.324e-13856.33Glycogen [starch] synthase, muscle OS=Bos taurus O... [more]
sp|P13834|GYS1_RABIT1.577e-13856.33Glycogen [starch] synthase, muscle OS=Oryctolagus ... [more]
back to top
BLAST of Glycogen [starch] synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3S9584.638e-16565.71Glycogen [starch] synthase OS=Hymenolepis diminuta... [more]
A0A4S2LHS01.178e-16467.35Glycogen [starch] synthase OS=Opisthorchis felineu... [more]
G7Y9P61.178e-16466.94Glycogen [starch] synthase OS=Clonorchis sinensis ... [more]
A0A3R7CCK21.302e-16466.94Glycogen [starch] synthase OS=Clonorchis sinensis ... [more]
A0A3Q0KCW22.731e-16466.53Glycogen [starch] synthase OS=Schistosoma mansoni ... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gys12.168e-13956.33glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-... [more]
gys15.643e-13956.33glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-... [more]
gys22.484e-11459.18glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-0308... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008981.11.183e-6758.00pep scaffold:Pmarinus_7.0:GL476544:387127:395235:1... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GSY19.003e-12152.55Glycogen synthase; expression induced by glucose l... [more]
GSY22.207e-6949.80Glycogen synthase; expression induced by glucose l... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO432201.296e-14360.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gys21.581e-14157.14glycogen synthase 2 [Source:NCBI gene;Acc:10116386... [more]
gys11.497e-13956.33glycogen synthase 1 [Source:NCBI gene;Acc:10115543... [more]
gys11.451e-10156.33glycogen synthase 1 [Source:NCBI gene;Acc:10115543... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028231.11.198e-177100.00SMESG000028231.1[more]
SMESG000042473.13.543e-17467.76SMESG000042473.1[more]
SMESG000028231.15.172e-17382.60SMESG000028231.1[more]
SMESG000028231.16.837e-17382.60SMESG000028231.1[more]
SMESG000028231.12.793e-121100.00SMESG000028231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022423 ID=SMED30022423|Name=Glycogen [starch] synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=2627bp
CTAGATTTAATAAAAATCAATTTTATAAATTAAACTAACAAAATATATAC
TTTATATGTATAAAGTATATAAAGGAGGCATAATTAAAGCAACGCCTGGC
TCTAAAAGTTTATTAAAAAAGCCTTCGAAAGCTAAATTCGTTGAAGAAGA
TACCATAAATTATGAGGGAACAAATATTATTAATTTCGTTGATCCGGAAA
TTTACAATAGACGGTTTTTATTTGAGATCGCCTGGGAGGTCGTGAATAAA
GTTGGTGGTATTTATACAGTAATTCGAACGAAAGCCAAATCAACTTGTAT
TGAACTTGTTGATAGGTATATCCTCCTGGGACCCATTAATGAAACCTGCC
TAAGAAGTGAAGTTGACGTTTGCGATTCAGACATGGAACCTGTTCATAAT
TCTATTTCAGCAATGAGATCATGTGGAATACGAATTGTTAGTGGCAGGTG
GTTAGTTGAAGGGAATCCATTTGTAATTCTCTTTGACGTCAATTCTGCCT
ATGGATTTTTGGGAGATTGGAAAAATGAGTTGTGGAATGATACTAGAATT
GGTATTCCAAATAATGATCAAGAAACAAATGATTCCGTTGTATTCGGTGG
TCTCATAGCATGGTTTATTGGAGTATTTAGAGAGAAAATGAATCAATATT
CAACTTTTTATGTCCCAATAATTTCTCATTTCCATGAATGGTTAACCGGG
CCCGGTCTCATCTTCATTCGGACACGTCAAATTGATGCAGCAACAGTATT
TTCCACTCACGCTACTCTCCTGGGACGCTATTTATCAGCAAGTTCAGTCG
ACCTATACAATAATTTAACAAAGTTTGAAATAGACAAGCTGGAGACAGGC
AAATTTATCATAGATATTGTATTGAAAGAGCTGCAACGCATTGTTCACAT
ACGTTTACTTGTGTCAGTAAAGTCACTGGGCTTGAGGCTCAATTTTTGCT
GCATAGAAAACCAGATGTTATCACGCCGAATGGATTGAACCTTCAAAGGT
TTGCAGCGATTCATGAGTTTCAAAATCTTCATGGGGTTGCAAAGTTAAAA
ATTAATAAATTTATTCAAAATCATTTTTATGGATATTTGGATTTTGATTT
AGAGAAAACTGTTTATTTGTTTACAGCTGGAAGATATGAATTTCAGAATA
AAGGAGCGGATATGTTCATTGAATCTTTGGCCAGGCTTAACTATCGTCTT
AAAATCGCAAATAGTGATGTTACAGTTGTAGCTTTTTTAATATTCCCCAC
ACAAACAAACAATTTTAATATTGAAACTTTTCGAGCGCAAGCGATTGTTA
AACAAATAAGAGACACTGTTGAAGAGATTCAGCATAATATTGGACTGAGG
CTCGTGGACAGCTGTCTCAAAGGTTCCATTCCAATGGCAGGCTCAGTTTT
TGATAATGATGATGTTATGAAGCTTAAACGCTGCGTTTTTGCTGCACAAA
GGTTTTCTCTCCCTCCTATTTGTACTCACAATGTCACACAAGATCACGTC
GATCCTATACTCTGCAACTTGAGGCGGTGTAATTTGTTTAACAACAGAAC
TGACAGAGTAAAGAAATGACAGTCTGAGGAAAGCACCCTTCGTCCCCCAT
CAATCTGAGACTCCTGCTACCGGGATGAGAGCCAAGAACTTCGTAAATGT
CCAGTATGCTGCTGCTCAGGATACTCTGCTGCCAAGGACACCGGCTGTGC
TGTTTGGATTCGAAACGAATGGAGGAGCTGGAGACCTGATGGGGAAGAGA
TCCAATGGATCTGGAAAGAAAGTAATTTTTCATCCGGAGTTTATAACATC
TACCAACCCTTTAATTGGAATGGACTATGAAGAATTTGCTAGAGGGTGTC
ATTTAGGAGTTTTTCCTTCGTATTATGAACCTTGGGGGTATACTCCAGCG
GAATGCACAGTAATGGGCATTCCATCAGTTACTACTAATCTTTCTGGATT
TGGATGCTTTATGGAAGAACATCTTGAAGATCCAAAATCTTATGGAATTT
ATGTCATAGATAGACGTTTCAAGAGTGGTGAAGAGTCGATACTTCAGCTT
ACTGATTATCTATTTGAATTCTGTCATTATTCAAGAAGACAGCGCATTAT
ATTAAGGAACAGAACAGAGCGACTAAGTGAATTATTAGACTGGAACAATT
TAACATTTGCGAGATTACTGTCCATGGCGAGGCATCTTCCACACTTGTTT
CAAGATAAGAATCTTGCAATGGCAGCTGCAGAAAATTCGAAAATAATTTC
AGATACCGATATTTTTTCAGAAGGCAGTTTTCATCTCGAAAGACCTTATT
CGGCTCCAAATTCTCCGTCTATATCCGAAGCAAGTGAACACGATTTCCAA
GACCCTCCAAATGAAGAGCAAATAAATTTCGAGGTAGACATTGTTGATGA
CAACAAAGAGCGTGTTGAATTAGGATTAGCTCCAAGTCCGGAAAATCTTT
TAGACAATAACGAACTTAATTATTTAAAACGATACACGAATACAAAAATG
TTCCCATTGAATAAATAGTACTAAGTTAAAGAATAATAAGGGTGTGATAA
AGAAAAGTTTTATGCTTTATGATAAATTCTCTAAAGTTTTTATGTGAAAC
ATTACAATAAAATGTGTAGTAATCTCC
back to top

protein sequence of SMED30022423-orf-1

>SMED30022423-orf-1 ID=SMED30022423-orf-1|Name=SMED30022423-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=298bp
MRAKNFVNVQYAAAQDTLLPRTPAVLFGFETNGGAGDLMGKRSNGSGKKV
IFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIP
SVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFC
HYSRRQRIILRNRTERLSELLDWNNLTFARLLSMARHLPHLFQDKNLAMA
AAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEASEHDFQDPPNEEQI
NFEVDIVDDNKERVELGLAPSPENLLDNNELNYLKRYTNTKMFPLNK*
back to top

protein sequence of SMED30022423-orf-2

>SMED30022423-orf-2 ID=SMED30022423-orf-2|Name=SMED30022423-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=136bp
MFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIR
DTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSL
PPICTHNVTQDHVDPILCNLRRCNLFNNRTDRVKK*
back to top

protein sequence of SMED30022423-orf-3

>SMED30022423-orf-3 ID=SMED30022423-orf-3|Name=SMED30022423-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MYKVYKGGIIKATPGSKSLLKKPSKAKFVEEDTINYEGTNIINFVDPEIY
NRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLR
SEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYG
FLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYST
FYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDL
YNNLTKFEIDKLETGKFIIDIVLKELQRIVHIRLLVSVKSLGLRLNFCCI
ENQMLSRRMD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR008631Glycogen_synth
Vocabulary: molecular function
TermDefinition
GO:0004373glycogen (starch) synthase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0005978glycogen biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.2000coord: 14..271
e-value: 3.8E-80
score: 271.2
IPR008631Glycogen synthasePFAMPF05693Glycogen_syncoord: 57..266
e-value: 5.7E-78
score: 263.0
IPR008631Glycogen synthasePANTHERPTHR10176GLYCOGEN SYNTHASEcoord: 50..262
IPR008631Glycogen synthaseCDDcd03793GT3_GSY2-likecoord: 53..269
e-value: 3.91815E-100
score: 303.91