SMED30022414

Overview
NameSMED30022414
Smed IDSMED30022414
Length (bp)1154
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022414 (SMED30022414) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022414 (SMED30022414) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022414 (SMED30022414) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022414 (SMED30022414) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022414

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022414SMESG000076482.1 SMESG000076385.1 SMESG000076371.1 SMESG000076223.1 SMESG000040665.1 SMESG000064685.1 Contig5047newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022414SMESG000076482.1 SMESG000076385.1 SMESG000076371.1 SMESG000076223.1 SMESG000040665.1 SMESG000064685.1 Contig5047uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022414SMESG000077750.1 Contig5047newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022414SMESG000077750.1 Contig5047uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30022414SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022414SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022414SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022414SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022414SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022414SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v6_645_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v6_645_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v6_645_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v6_645_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022414SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022414SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30022414 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 69.707 bits (169), Expect = 3.553e-12
Identity = 30/86 (34.88%), Postives = 54/86 (62.79%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE + + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  239 GITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          

HSP 2 Score: 53.5286 bits (127), Expect = 5.893e-7
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE KTKD  TPL  A  N  +  +E+L
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEIL 291          

HSP 3 Score: 51.6026 bits (122), Expect = 2.047e-6
Identity = 22/74 (29.73%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+A   G   +V+ L++H  ++  + +    P+H ++  GH +I+ LL+ N       + DG TPL +A
Sbjct:  701 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          
BLAST of SMED30022414 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 69.707 bits (169), Expect = 3.553e-12
Identity = 30/86 (34.88%), Postives = 54/86 (62.79%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE + + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  239 GITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          

HSP 2 Score: 53.5286 bits (127), Expect = 5.893e-7
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE KTKD  TPL  A  N  +  +E+L
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEIL 291          

HSP 3 Score: 51.6026 bits (122), Expect = 2.047e-6
Identity = 22/74 (29.73%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+A   G   +V+ L++H  ++  + +    P+H ++  GH +I+ LL+ N       + DG TPL +A
Sbjct:  701 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          
BLAST of SMED30022414 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 69.707 bits (169), Expect = 3.557e-12
Identity = 30/86 (34.88%), Postives = 54/86 (62.79%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE + + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  272 GITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 357          

HSP 2 Score: 53.5286 bits (127), Expect = 5.898e-7
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE KTKD  TPL  A  N  +  +E+L
Sbjct:  239 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEIL 324          

HSP 3 Score: 51.6026 bits (122), Expect = 2.049e-6
Identity = 22/74 (29.73%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+A   G   +V+ L++H  ++  + +    P+H ++  GH +I+ LL+ N       + DG TPL +A
Sbjct:  734 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 807          
BLAST of SMED30022414 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 66.6254 bits (161), Expect = 2.350e-11
Identity = 25/83 (30.12%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A ++G  ++V+LL++    I+ +    + P+HC + +GH +++++L+     I  KTK+G +PL +A   + ++C +LL
Sbjct:  254 PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLL 336          

HSP 2 Score: 55.8398 bits (133), Expect = 5.993e-8
Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPL 540
             G  P+HIA   G  ++  LL+     ++      I P+H +S  G+A +++LL+    +I+ KT+DG TPL
Sbjct:  217 SGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPL 288          

HSP 3 Score: 51.9878 bits (123), Expect = 1.207e-6
Identity = 23/88 (26.14%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  340 IHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNGKT 600
            +H+A ++G   +V  L++   N++   +     +H +S  G AE++++L+ N   +  ++++G TPL +A   N ++  + LL NG +
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGAS 148          

HSP 4 Score: 51.6026 bits (122), Expect = 1.440e-6
Identity = 20/54 (37.04%), Postives = 34/54 (62.96%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLM 489
            G  P+HIAC+K    +++LL++H  +I+   E  + PIH +++ GH  I+  LM
Sbjct:  383 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          

HSP 5 Score: 48.9062 bits (115), Expect = 9.778e-6
Identity = 27/108 (25.00%), Postives = 49/108 (45.37%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL----SNGKTLIKFFDAIKRND 636
            +G   +HIA   G   +V++L+ +  N+  + +    P++ ++   H E+++ L+ N       T+DG TPL +AL         LL    + GK  +       R D
Sbjct:   89 KGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD 196          
BLAST of SMED30022414 vs. Ensembl Human
Match: RIPK4 (receptor interacting serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:496])

HSP 1 Score: 64.3142 bits (155), Expect = 1.685e-10
Identity = 29/90 (32.22%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNK-CQIECKTKDGKTPLDLALLNNKMDCAELL 585
            D EG+ P+H+AC+ G  +IV++L+    ++  + +    P+H ++W GH  I++LL       +  +T DG+TPL LA        A +L
Sbjct:  534 DFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARIL 623          

HSP 2 Score: 50.447 bits (119), Expect = 4.845e-6
Identity = 23/87 (26.44%), Postives = 44/87 (50.57%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +G+ P+H+A ++G + + ++L++   ++         P+H ++  GH    +LL+      E  T DG T L LA  N  +   +LL
Sbjct:  603 DGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLL 689          
BLAST of SMED30022414 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.9954 bits (136), Expect = 1.558e-8
Identity = 31/106 (29.25%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  271 EGVSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            E V   + E   NV   A   + P+H+A + G  ++  LL+     I+   +  + P+HC++ +GH +++ LL++    I  KTK+G  PL +A   + +D A  L
Sbjct:  240 ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 2 Score: 56.6102 bits (135), Expect = 2.477e-8
Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            G  P+HIAC+K    +V+LL+++   IE   E  + P+H +++ G   I+  L+      + +T  G+TPL LA   N+ D    L+ NG
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNG 481          

HSP 3 Score: 55.0694 bits (131), Expect = 7.318e-8
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +G  P+H+A + G   +V+LL+E    ++ E + Q+ P+H ++   + ++  LL+ N    +   K+G TPL +A   N+M+ A  L
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 4 Score: 50.8322 bits (120), Expect = 1.440e-6
Identity = 28/94 (29.79%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            A+ + NN +E  +N K++A G  P+H+AC  G  ++V+ L+E+  ++  +      P+H ++  GH   ++ L+ N      +T  G+TPL +A
Sbjct:  705 AQILYNNGAE--INSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          
BLAST of SMED30022414 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.9954 bits (136), Expect = 1.558e-8
Identity = 31/106 (29.25%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  271 EGVSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            E V   + E   NV   A   + P+H+A + G  ++  LL+     I+   +  + P+HC++ +GH +++ LL++    I  KTK+G  PL +A   + +D A  L
Sbjct:  240 ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 2 Score: 56.6102 bits (135), Expect = 2.477e-8
Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            G  P+HIAC+K    +V+LL+++   IE   E  + P+H +++ G   I+  L+      + +T  G+TPL LA   N+ D    L+ NG
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNG 481          

HSP 3 Score: 55.0694 bits (131), Expect = 7.318e-8
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +G  P+H+A + G   +V+LL+E    ++ E + Q+ P+H ++   + ++  LL+ N    +   K+G TPL +A   N+M+ A  L
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 4 Score: 50.8322 bits (120), Expect = 1.440e-6
Identity = 28/94 (29.79%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            A+ + NN +E  +N K++A G  P+H+AC  G  ++V+ L+E+  ++  +      P+H ++  GH   ++ L+ N      +T  G+TPL +A
Sbjct:  705 AQILYNNGAE--INSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          
BLAST of SMED30022414 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.9954 bits (136), Expect = 1.561e-8
Identity = 31/106 (29.25%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  271 EGVSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            E V   + E   NV   A   + P+H+A + G  ++  LL+     I+   +  + P+HC++ +GH +++ LL++    I  KTK+G  PL +A   + +D A  L
Sbjct:  240 ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 2 Score: 56.6102 bits (135), Expect = 2.481e-8
Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            G  P+HIAC+K    +V+LL+++   IE   E  + P+H +++ G   I+  L+      + +T  G+TPL LA   N+ D    L+ NG
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNG 481          

HSP 3 Score: 55.0694 bits (131), Expect = 7.330e-8
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +G  P+H+A + G   +V+LL+E    ++ E + Q+ P+H ++   + ++  LL+ N    +   K+G TPL +A   N+M+ A  L
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 4 Score: 50.8322 bits (120), Expect = 1.442e-6
Identity = 28/94 (29.79%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            A+ + NN +E  +N K++A G  P+H+AC  G  ++V+ L+E+  ++  +      P+H ++  GH   ++ L+ N      +T  G+TPL +A
Sbjct:  705 AQILYNNGAE--INSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          
BLAST of SMED30022414 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.9954 bits (136), Expect = 1.561e-8
Identity = 31/106 (29.25%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  271 EGVSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            E V   + E   NV   A   + P+H+A + G  ++  LL+     I+   +  + P+HC++ +GH +++ LL++    I  KTK+G  PL +A   + +D A  L
Sbjct:  240 ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 2 Score: 56.6102 bits (135), Expect = 2.481e-8
Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            G  P+HIAC+K    +V+LL+++   IE   E  + P+H +++ G   I+  L+      + +T  G+TPL LA   N+ D    L+ NG
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNG 481          

HSP 3 Score: 55.0694 bits (131), Expect = 7.330e-8
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +G  P+H+A + G   +V+LL+E    ++ E + Q+ P+H ++   + ++  LL+ N    +   K+G TPL +A   N+M+ A  L
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 4 Score: 50.8322 bits (120), Expect = 1.442e-6
Identity = 28/94 (29.79%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            A+ + NN +E  +N K++A G  P+H+AC  G  ++V+ L+E+  ++  +      P+H ++  GH   ++ L+ N      +T  G+TPL +A
Sbjct:  705 AQILYNNGAE--INSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          
BLAST of SMED30022414 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.9954 bits (136), Expect = 1.563e-8
Identity = 31/106 (29.25%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  271 EGVSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            E V   + E   NV   A   + P+H+A + G  ++  LL+     I+   +  + P+HC++ +GH +++ LL++    I  KTK+G  PL +A   + +D A  L
Sbjct:  240 ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 2 Score: 56.6102 bits (135), Expect = 2.485e-8
Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            G  P+HIAC+K    +V+LL+++   IE   E  + P+H +++ G   I+  L+      + +T  G+TPL LA   N+ D    L+ NG
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNG 481          

HSP 3 Score: 55.0694 bits (131), Expect = 7.342e-8
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +G  P+H+A + G   +V+LL+E    ++ E + Q+ P+H ++   + ++  LL+ N    +   K+G TPL +A   N+M+ A  L
Sbjct:  556 KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 4 Score: 50.8322 bits (120), Expect = 1.444e-6
Identity = 28/94 (29.79%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            A+ + NN +E  +N K++A G  P+H+AC  G  ++V+ L+E+  ++  +      P+H ++  GH   ++ L+ N      +T  G+TPL +A
Sbjct:  705 AQILYNNGAE--INSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          
BLAST of SMED30022414 vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0084890)

HSP 1 Score: 66.6254 bits (161), Expect = 1.777e-11
Identity = 35/108 (32.41%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKRNDF 639
            +D  G +P+H AC  G + + +LL++H  N+   D W+  P+H ++  G  +I +LL+ +      K +DG TP DL +  +  D AELL     L+   DA K+ + 
Sbjct:  549 ADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADL-VKESDHDVAELLRGPSALL---DAAKKGNL 652          

HSP 2 Score: 53.5286 bits (127), Expect = 2.638e-7
Identity = 23/77 (29.87%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            D  G +P+H A   G   I  LL++H   +   D+W   P+H ++  G  ++  LL+ +      K ++G+TP++LA
Sbjct:  703 DKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELA 779          

HSP 3 Score: 52.7582 bits (125), Expect = 4.493e-7
Identity = 34/115 (29.57%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  259 KGNAEGVSNNISETFVNVKSDAEGK--LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            KGN   V   ++   +N + DA+G+   P+H+A     F   + L+E+  ++  +D+  + P+H +S  GH +I  LL+ +K  +    K G TPL  A    +   C+ LL++G
Sbjct:  649 KGNLARVQRLVTPESINCR-DAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHG 762          
BLAST of SMED30022414 vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0330383)

HSP 1 Score: 66.6254 bits (161), Expect = 1.871e-11
Identity = 35/108 (32.41%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKRNDF 639
            +D  G +P+H AC  G + + +LL++H  N+   D W+  P+H ++  G  +I +LL+ +      K +DG TP DL +  +  D AELL     L+   DA K+ + 
Sbjct:  549 ADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADL-VKESDHDVAELLRGPSALL---DAAKKGNL 652          

HSP 2 Score: 53.5286 bits (127), Expect = 2.749e-7
Identity = 23/77 (29.87%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            D  G +P+H A   G   I  LL++H   +   D+W   P+H ++  G  ++  LL+ +      K ++G+TP++LA
Sbjct:  703 DKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELA 779          

HSP 3 Score: 52.7582 bits (125), Expect = 4.679e-7
Identity = 34/115 (29.57%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  259 KGNAEGVSNNISETFVNVKSDAEGK--LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            KGN   V   ++   +N + DA+G+   P+H+A     F   + L+E+  ++  +D+  + P+H +S  GH +I  LL+ +K  +    K G TPL  A    +   C+ LL++G
Sbjct:  649 KGNLARVQRLVTPESINCR-DAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHG 762          
BLAST of SMED30022414 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 65.4698 bits (158), Expect = 3.000e-11
Identity = 28/83 (33.73%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A + G  ++V LL+E   NIE +    + P+HC++ +GH +++ +L+     I  KTK+G  PL +A     +D A +L
Sbjct:  241 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 323          

HSP 2 Score: 60.4622 bits (145), Expect = 1.326e-9
Identity = 31/90 (34.44%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            G  P+HIAC+K    +V+LL+ H  +I    E  + P+H +++ G   I+  L+ +    +  T  G+TPL LA   N+ D    LL NG
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNG 459          

HSP 3 Score: 53.9138 bits (128), Expect = 1.654e-7
Identity = 23/76 (30.26%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLAL 552
            +G   +HIA   G   +V+LL+EHN ++  + +    P++ ++   H  +++LL+ N       T+DG TPL +A+
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAM 151          

HSP 4 Score: 51.6026 bits (122), Expect = 9.044e-7
Identity = 22/88 (25.00%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLS 588
             G+ P+H+A       I+++L+ +   ++     Q  P+H +S  G+ +I+ LL+ +  Q++  TKD  T L +A    + +  +L++
Sbjct:  435 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIA 522          

HSP 5 Score: 50.447 bits (119), Expect = 1.718e-6
Identity = 24/72 (33.33%), Postives = 38/72 (52.78%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPL 540
             G  P+HIA   G  +I  LL++   ++    +  I P+H ++  G   ++ LL+     IE KT+DG TPL
Sbjct:  204 SGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPL 275          

HSP 6 Score: 49.6766 bits (117), Expect = 2.885e-6
Identity = 23/87 (26.44%), Postives = 46/87 (52.87%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
             G  P+H+A   G  +IV  L++H+ + +        P+H ++     +II++L+ N  Q++ + ++ +TPL +A     +D   LL
Sbjct:  402 SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 488          
BLAST of SMED30022414 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 65.0846 bits (157), Expect = 5.100e-11
Identity = 28/83 (33.73%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A + G  ++V LL+E   NIE +    + P+HC++ +GH +++ +L+     I  KTK+G  PL +A     +D A +L
Sbjct:  391 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 473          

HSP 2 Score: 59.3066 bits (142), Expect = 3.185e-9
Identity = 31/90 (34.44%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            G  P+HIAC+K    +V+LL+ H  +I    E  + P+H +++ G   I+  L+ +    +  T  G+TPL LA   N+ D    LL NG
Sbjct:  520 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNG 609          

HSP 3 Score: 52.373 bits (124), Expect = 5.275e-7
Identity = 23/76 (30.26%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLAL 552
            +G   +HIA   G   +V+LL+EHN ++  + +    P++ ++   H  +++LL+ N       T+DG TPL +A+
Sbjct:  226 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAM 301          

HSP 4 Score: 50.447 bits (119), Expect = 2.257e-6
Identity = 24/100 (24.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAI 624
             G+ P+H+A       I+++L+ +   ++     Q  P+H +S  G+ +I+ LL+ +  Q++  TKD  T L +A    + +  +L++  K +    D +
Sbjct:  585 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIA--KKITDHIDTV 682          

HSP 5 Score: 49.2914 bits (116), Expect = 4.958e-6
Identity = 26/86 (30.23%), Postives = 43/86 (50.00%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA   G  +I  LL++   ++    +  I P+H ++  G   ++ LL+     IE KT+DG TPL  A  +      ++L
Sbjct:  355 GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML 440          

HSP 6 Score: 48.521 bits (114), Expect = 7.879e-6
Identity = 23/86 (26.74%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+H+A   G  +IV  L++H+ + +        P+H ++     +II++L+ N  Q++ + ++ +TPL +A     +D   LL
Sbjct:  553 GLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 638          
BLAST of SMED30022414 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 62.7734 bits (151), Expect = 2.745e-10
Identity = 33/109 (30.28%), Postives = 62/109 (56.88%), Query Frame = 1
Query:  262 GNAEGVSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            GN + ++N + +   +V   A+  + P+H+A + G  ++V LL+E   NIE +    + P+HC++ +GH +++ +L+     I  KTK+G  PL +A     +D A +L
Sbjct:  216 GN-QNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 323          

HSP 2 Score: 57.7658 bits (138), Expect = 1.013e-8
Identity = 32/93 (34.41%), Postives = 47/93 (50.54%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLS-NGKTL 603
            G  P+HIA  K    I   L+E+      E +    P+H SS  GHAEI  LL+ +K  +    K+G TP+ L    + ++ AE+L  NG  +
Sbjct:  601 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANI 693          

HSP 3 Score: 57.3806 bits (137), Expect = 1.655e-8
Identity = 31/90 (34.44%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            G  P+HIAC+K    +V+LL+ H  +I    E  + P+H +++ G   I+  L+ +    +  T  G+TPL LA   N+ D    LL NG
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNG 459          

HSP 4 Score: 52.7582 bits (125), Expect = 4.517e-7
Identity = 27/94 (28.72%), Postives = 51/94 (54.26%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIK 609
            G  P+H+A   G  ++V+ L+++  N++        P+H ++  GH  I+ LL+ +K     +T +G+TPL +A    K+    +L + KT+ K
Sbjct:  700 GYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA---RKLGYISVLDSLKTITK 790          

HSP 5 Score: 50.447 bits (119), Expect = 2.024e-6
Identity = 23/76 (30.26%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLAL 552
            +G   +HIA   G   +V+LL+EHN ++  + +    P++ ++   H  +++LL+ N       T+DG TPL +A+
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAM 151          

HSP 6 Score: 48.9062 bits (115), Expect = 6.906e-6
Identity = 29/105 (27.62%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNGKTLIKFFDAIKRNDF 639
            G+ P+H+A       I+++L+ +   ++     Q  P+H +S  G+ +I+ LL+ +  Q++  TKD  T L +A    + + A  L+ NG  L    DA  +  F
Sbjct:  436 GETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAAL----DAATKKGF 536          

HSP 7 Score: 48.9062 bits (115), Expect = 7.868e-6
Identity = 26/87 (29.89%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            E + P+HIA   G   IV LL++H   ++   +     +H ++  G  E+  +L+ N   ++  TK G TPL L      +  A+LL
Sbjct:  468 EQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 554          

HSP 8 Score: 48.521 bits (114), Expect = 8.965e-6
Identity = 25/78 (32.05%), Postives = 40/78 (51.28%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            +   G  P+HIA   G  +I  LL++   ++    +  I P+H ++  G   ++ LL+     IE KT+DG TPL  A
Sbjct:  201 TSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCA 278          
BLAST of SMED30022414 vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 70.0922 bits (170), Expect = 2.157e-12
Identity = 32/105 (30.48%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  286 NISETFVNVKSDAE-----GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            N+++  +N  +D       G  P+HIA  +G   +V+LL++    I+ + + ++ P+HC++ NGH  II++L+     I+ KTK+G +P+ +A   + +DC   L
Sbjct:  220 NVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQL 324          

HSP 2 Score: 57.7658 bits (138), Expect = 1.711e-8
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K    ++ LL++H+ ++E   E  + P+H SS+ GH  I+++LM             +TPL +A      + AE L
Sbjct:  371 GFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFL 456          

HSP 3 Score: 53.1434 bits (126), Expect = 4.256e-7
Identity = 22/74 (29.73%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+AC  G   +V+ L++   N+ C+      P+H ++  GH +I+ LL+ +  Q    T +G + L +A
Sbjct:  701 GYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSALAIA 774          

HSP 4 Score: 51.2174 bits (121), Expect = 1.699e-6
Identity = 30/105 (28.57%), Postives = 52/105 (49.52%), Query Frame = 1
Query:  271 EGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +G S N S    NVK +     P+H+A   G   + + L+++   ++ + +    P+HC+S  GH E+++LL+ +K      T  G TPL +A        A +L
Sbjct:  426 KGASPNAS----NVKVET----PLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASIL 522          

HSP 5 Score: 51.2174 bits (121), Expect = 2.021e-6
Identity = 33/106 (31.13%), Postives = 49/106 (46.23%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            AE +  N +      K D   + P+H A   G   +V+LL+EH  N          P+H ++  GH +   +L+    Q+   TK G TPL +A    K+D A LL
Sbjct:  453 AEFLLQNAAPVDAKAKDD---QTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLL 555          

HSP 6 Score: 49.2914 bits (116), Expect = 7.440e-6
Identity = 27/86 (31.40%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    +I+ KTKD  TPL  A  N  +   E+L
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEIL 291          
BLAST of SMED30022414 vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 68.5514 bits (166), Expect = 4.230e-12
Identity = 26/83 (31.33%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A ++G  ++V+LL+E    I+   +  + P+HC + +GH +++++L+     I  KTK+G +PL +A   + ++C +LL
Sbjct:  242 PLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 324          

HSP 2 Score: 58.151 bits (139), Expect = 8.936e-9
Identity = 24/72 (33.33%), Postives = 41/72 (56.94%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPL 540
             G  P+HIA   G  ++  LL+     ++ +    I P+H +S  G+A +++LL+    +I+ +TKDG TPL
Sbjct:  205 SGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPL 276          

HSP 3 Score: 53.9138 bits (128), Expect = 2.039e-7
Identity = 38/161 (23.60%), Postives = 67/161 (41.61%), Query Frame = 1
Query:  217 DVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDA-EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGH---------------------------------AEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            DV  DY   +          V+  + +   N  + A  G  P+HIAC+K    +++LL++H  +I+   E  + PIH +++ GH                                 A +++ L+ N   ++ K KD +TPL ++    K D   +LL +G
Sbjct:  333 DVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHG 493          

HSP 4 Score: 53.1434 bits (126), Expect = 3.778e-7
Identity = 28/94 (29.79%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNGKTL 603
             G+  +H+A   G  ++V+ L+ +  +++ + +    P+H SS  G  +I+Q L+ +    +  T  G TPL LA  +   D A  LL NG +L
Sbjct:  436 RGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILLDNGASL 529          
BLAST of SMED30022414 vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 68.1662 bits (165), Expect = 4.804e-12
Identity = 26/83 (31.33%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A ++G  ++V+LL+E    I+   +  + P+HC + +GH +++++L+     I  KTK+G +PL +A   + ++C +LL
Sbjct:  270 PLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 352          

HSP 2 Score: 58.151 bits (139), Expect = 9.291e-9
Identity = 24/72 (33.33%), Postives = 41/72 (56.94%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPL 540
             G  P+HIA   G  ++  LL+     ++ +    I P+H +S  G+A +++LL+    +I+ +TKDG TPL
Sbjct:  233 SGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPL 304          

HSP 3 Score: 53.9138 bits (128), Expect = 1.935e-7
Identity = 38/161 (23.60%), Postives = 67/161 (41.61%), Query Frame = 1
Query:  217 DVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDA-EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGH---------------------------------AEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            DV  DY   +          V+  + +   N  + A  G  P+HIAC+K    +++LL++H  +I+   E  + PIH +++ GH                                 A +++ L+ N   ++ K KD +TPL ++    K D   +LL +G
Sbjct:  361 DVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHG 521          

HSP 4 Score: 53.1434 bits (126), Expect = 3.947e-7
Identity = 28/94 (29.79%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNGKTL 603
             G+  +H+A   G  ++V+ L+ +  +++ + +    P+H SS  G  +I+Q L+ +    +  T  G TPL LA  +   D A  LL NG +L
Sbjct:  464 RGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILLDNGASL 557          
BLAST of SMED30022414 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 67.781 bits (164), Expect = 1.022e-11
Identity = 27/86 (31.40%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    I+ + + ++ P+HC++ NGH  ++++L+     ++ KTK+G +P+ +A   + MDC   L
Sbjct:  180 GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQL 265          

HSP 2 Score: 58.151 bits (139), Expect = 1.091e-8
Identity = 34/96 (35.42%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  307 NVKSDAEGK---LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            N + DA+ K    P+H A   G   +V+LLMEH  N +        P+H ++  GHA+  ++L+    Q    TK G TPL +A    K+D  ELL
Sbjct:  401 NAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 496          

HSP 3 Score: 56.9954 bits (136), Expect = 2.554e-8
Identity = 24/78 (30.77%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            S+ + + P+H+A   G   + Q L+++N  ++ + +    P+HC++  GH E+++LLM +K   +  T  G TPL +A
Sbjct:  374 SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIA 451          

HSP 4 Score: 55.0694 bits (131), Expect = 1.225e-7
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      S+ QLL+    N+    +  I P+H +S  G+  +++LL+    QI+ KTKD  TPL  A  N  +   E+L
Sbjct:  147 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEIL 232          

HSP 5 Score: 51.9878 bits (123), Expect = 9.536e-7
Identity = 27/90 (30.00%), Postives = 45/90 (50.00%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGK 597
            G  P+H+A   G  +IV+ L++   +    +     P+H ++  GH E+ Q L+ N  Q++ K KD +TPL  A      +  +LL   K
Sbjct:  345 GLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK 434          
BLAST of SMED30022414 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 67.781 bits (164), Expect = 1.046e-11
Identity = 27/86 (31.40%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    I+ + + ++ P+HC++ NGH  ++++L+     ++ KTK+G +P+ +A   + MDC   L
Sbjct:  272 GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQL 357          

HSP 2 Score: 58.151 bits (139), Expect = 1.113e-8
Identity = 34/96 (35.42%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  307 NVKSDAEGK---LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            N + DA+ K    P+H A   G   +V+LLMEH  N +        P+H ++  GHA+  ++L+    Q    TK G TPL +A    K+D  ELL
Sbjct:  493 NAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 588          

HSP 3 Score: 56.9954 bits (136), Expect = 2.606e-8
Identity = 24/78 (30.77%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            S+ + + P+H+A   G   + Q L+++N  ++ + +    P+HC++  GH E+++LLM +K   +  T  G TPL +A
Sbjct:  466 SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIA 543          

HSP 4 Score: 55.0694 bits (131), Expect = 1.248e-7
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      S+ QLL+    N+    +  I P+H +S  G+  +++LL+    QI+ KTKD  TPL  A  N  +   E+L
Sbjct:  239 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEIL 324          

HSP 5 Score: 51.9878 bits (123), Expect = 9.710e-7
Identity = 27/90 (30.00%), Postives = 45/90 (50.00%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGK 597
            G  P+H+A   G  +IV+ L++   +    +     P+H ++  GH E+ Q L+ N  Q++ K KD +TPL  A      +  +LL   K
Sbjct:  437 GLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK 526          
BLAST of SMED30022414 vs. Ensembl Xenopus
Match: ENSXETT00000035644.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460474.1:168627:170734:1 gene:ENSXETG00000010822.1 transcript:ENSXETT00000035644.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.335e-11
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 1
Query:  262 GNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKRN 633
            GN E V   +S       +D +G+ P+ +A  +G  +IVQLL+ H    +  D     P+  ++W GH EI++ L+    Q +   ++G TPL LA        AELL N    I   DA  R 
Sbjct:  174 GNLEAVKLMLSMGADLETTDEDGQTPLGLAAHQGHLAIVQLLLSHGAQPDHPDNRGWTPLRSAAWGGHTEIVEALLSAGAQPDVD-REGCTPLHLAAQEGHTSSAELLINRGAPIDQRDADGRT 296          
BLAST of SMED30022414 vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 65.0846 bits (157), Expect = 9.147e-11
Identity = 34/104 (32.69%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKR 630
            D  G +P+H AC  G + + +LL+ H  ++   D W+  P+H ++  G  EI +LL+ +      K +DG TPLDL + +   D  +LL     L+   DA K+
Sbjct:  535 DKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL-VKDGDTDIQDLLRGDAALL---DAAKK 634          

HSP 2 Score: 55.0694 bits (131), Expect = 1.470e-7
Identity = 38/129 (29.46%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  220 VMGDYKC--FMECLIKGNAEGVSNNISETFVNVK-SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            + G+YK    +E    GN E +   ++   VN   SD     P+H+A       IVQLL++H  ++  +D+  + P+H +   GH E+ +LL+ +   +        TPL  A   N+++ C+ LLS+G
Sbjct:  151 LTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHFEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHG 279          

HSP 3 Score: 54.299 bits (129), Expect = 2.712e-7
Identity = 24/81 (29.63%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNN 561
            D  G +P+H A   G   I  LL+++N  +   D+W   P+H ++  G  ++  LL+ +      K ++ +TPLDLA  ++
Sbjct:  688 DKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQESQTPLDLATADD 768          

HSP 4 Score: 50.8322 bits (120), Expect = 2.990e-6
Identity = 28/92 (30.43%), Postives = 46/92 (50.00%), Query Frame = 1
Query:  277 VSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            V  ++ +T  NV +  +G L P+H AC  G   +V LL+    +    D W   P+H +S  G  ++  +L+ +      +  DGK+ LDLA
Sbjct:   52 VVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVTLLLCQGADPNARDNWNYTPLHEASIKGKIDVCIVLLQHGADPSIRNTDGKSALDLA 143          

HSP 5 Score: 50.447 bits (119), Expect = 4.021e-6
Identity = 35/125 (28.00%), Postives = 56/125 (44.80%), Query Frame = 1
Query:  226 GDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGK-LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            G ++   E    G+   V   +    VN K  A  K  P+H A   G   +V+ L++   N+   D+  + P+H +   GHAE++ LL+        +     TPL  A +  K+D C  LL +G
Sbjct:    2 GAFRELFEACRNGDVSRVRRLLEPGNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVTLLLCQGADPNARDNWNYTPLHEASIKGKIDVCIVLLQHG 126          

HSP 6 Score: 50.447 bits (119), Expect = 4.956e-6
Identity = 23/77 (29.87%), Postives = 39/77 (50.65%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            D  G +P+H AC  G F + +LL++H   +   D WQ  P+H ++     E+  LL+ +          GK+ +D+A
Sbjct:  220 DKGGLVPLHNACSYGHFEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 296          

HSP 7 Score: 49.6766 bits (117), Expect = 8.001e-6
Identity = 39/136 (28.68%), Postives = 64/136 (47.06%), Query Frame = 1
Query:  211 TTDVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGK--LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNGKTLIK 609
            T+DV  DY+  +E    G+ + V    S   VN + D EG+   P+H A      S+V+ L+ H  ++  +D+  + P+H +   GH E+ +LL+ +   +        TPL  A    K + C  LL +G    K
Sbjct:  468 TSDV--DYR-LLEASKAGDLDTVKQLCSSQNVNCR-DLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTK 599          
BLAST of SMED30022414 vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 65.0846 bits (157), Expect = 9.230e-11
Identity = 34/104 (32.69%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKR 630
            D  G +P+H AC  G + + +LL+ H  ++   D W+  P+H ++  G  EI +LL+ +      K +DG TPLDL + +   D  +LL     L+   DA K+
Sbjct:  536 DKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL-VKDGDTDIQDLLRGDAALL---DAAKK 635          

HSP 2 Score: 55.0694 bits (131), Expect = 1.523e-7
Identity = 38/129 (29.46%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  220 VMGDYKC--FMECLIKGNAEGVSNNISETFVNVK-SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            + G+YK    +E    GN E +   ++   VN   SD     P+H+A       IVQLL++H  ++  +D+  + P+H +   GH E+ +LL+ +   +        TPL  A   N+++ C+ LLS+G
Sbjct:  152 LTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHFEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHG 280          

HSP 3 Score: 54.299 bits (129), Expect = 2.834e-7
Identity = 24/81 (29.63%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNN 561
            D  G +P+H A   G   I  LL+++N  +   D+W   P+H ++  G  ++  LL+ +      K ++ +TPLDLA  ++
Sbjct:  689 DKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQESQTPLDLATADD 769          

HSP 4 Score: 50.8322 bits (120), Expect = 3.070e-6
Identity = 28/92 (30.43%), Postives = 46/92 (50.00%), Query Frame = 1
Query:  277 VSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            V  ++ +T  NV +  +G L P+H AC  G   +V LL+    +    D W   P+H +S  G  ++  +L+ +      +  DGK+ LDLA
Sbjct:   53 VVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVTLLLCQGADPNARDNWNYTPLHEASIKGKIDVCIVLLQHGADPSIRNTDGKSALDLA 144          

HSP 5 Score: 50.447 bits (119), Expect = 4.022e-6
Identity = 35/125 (28.00%), Postives = 56/125 (44.80%), Query Frame = 1
Query:  226 GDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGK-LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            G ++   E    G+   V   +    VN K  A  K  P+H A   G   +V+ L++   N+   D+  + P+H +   GHAE++ LL+        +     TPL  A +  K+D C  LL +G
Sbjct:    3 GAFRELFEACRNGDVSRVRRLLEPGNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVTLLLCQGADPNARDNWNYTPLHEASIKGKIDVCIVLLQHG 127          

HSP 6 Score: 50.447 bits (119), Expect = 4.957e-6
Identity = 23/77 (29.87%), Postives = 39/77 (50.65%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            D  G +P+H AC  G F + +LL++H   +   D WQ  P+H ++     E+  LL+ +          GK+ +D+A
Sbjct:  221 DKGGLVPLHNACSYGHFEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 297          

HSP 7 Score: 49.6766 bits (117), Expect = 8.358e-6
Identity = 39/136 (28.68%), Postives = 64/136 (47.06%), Query Frame = 1
Query:  211 TTDVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGK--LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNGKTLIK 609
            T+DV  DY+  +E    G+ + V    S   VN + D EG+   P+H A      S+V+ L+ H  ++  +D+  + P+H +   GH E+ +LL+ +   +        TPL  A    K + C  LL +G    K
Sbjct:  469 TSDV--DYR-LLEASKAGDLDTVKQLCSSQNVNCR-DLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTK 600          
BLAST of SMED30022414 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 64.6994 bits (156), Expect = 1.425e-10
Identity = 35/104 (33.65%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKR 630
            D  G +P+H AC  G + + +LL++H   I   D W+  P+H ++  G  EI +LL+ +      K +DG TPLDL + +   D  +LL     L+   DA K+
Sbjct:  557 DKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQHGADSTKKNRDGNTPLDL-VKDGDTDIQDLLRGDAALL---DAAKK 656          

HSP 2 Score: 55.4546 bits (132), Expect = 1.020e-7
Identity = 38/129 (29.46%), Postives = 63/129 (48.84%), Query Frame = 1
Query:  220 VMGDYKC--FMECLIKGNAEGVSNNISETFVNVK-SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            + G+YK    +E    GN E +   ++   VN   SD     P+H+A       IVQLL++H  ++  +D+  + P+H +   GH E+ +LL+     +        TPL  A   N+++ C+ LLS G
Sbjct:  173 LTGEYKKDELLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYG 301          

HSP 3 Score: 51.9878 bits (123), Expect = 1.492e-6
Identity = 34/120 (28.33%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  241 FMECLIKGNAEGVSNNISETFVNVKSDAEGK-LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
              E    G+ E V   ++   VN +  A  K  P+H A   G   +V+ L++   N+   D+  + P+H +   GHAE++ LL+ +      +     TPL  A +  K+D C  LL +G
Sbjct:   29 LFEACRNGDVERVRKLVNADNVNSRDTAGRKSTPLHFAAGFGRKDVVEHLLQSGANVHARDDGGLIPLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHG 148          

HSP 4 Score: 51.6026 bits (122), Expect = 1.761e-6
Identity = 30/115 (26.09%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  277 VSNNISETFVNVKSDAEGKL-PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDL------ALLNNKMDCAELLSNGKT 600
            V  ++ ++  NV +  +G L P+H AC  G   +V LL+ H  +    D W   P+H ++  G  ++  +L+ +      +  D +T LDL      A+L  +    ELL + ++
Sbjct:   74 VVEHLLQSGANVHARDDGGLIPLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPTIRNTDSRTALDLSDPSAKAVLTGEYKKDELLESARS 188          
BLAST of SMED30022414 vs. Ensembl Xenopus
Match: pan3 (poly(A) specific ribonuclease subunit PAN3 [Source:Xenbase;Acc:XB-GENE-5731378])

HSP 1 Score: 64.3142 bits (155), Expect = 1.445e-10
Identity = 27/88 (30.68%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKT 600
            P+HIA ++G   + Q L+ H  N+  +D+    P+H ++  G  E++QLL+ NK       KD KTPL +A     ++   ++  G+ 
Sbjct:  333 PLHIASQRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRA 420          

HSP 2 Score: 58.5362 bits (140), Expect = 1.101e-8
Identity = 31/116 (26.72%), Postives = 58/116 (50.00%), Query Frame = 1
Query:  238 CFMECLIKGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
               + + KG+   + N + +T +N   +  G+  +HIA   G  ++++ L+     I+C+D     P+H ++ NGH E +++L+     I     D  TPL LA  NN  +  ++L
Sbjct:   22 TVFDAVTKGDLSILRNILRDTDINA-VNPSGETLLHIAAASGHVAVIEYLINKGAKIDCKDIKHRTPLHRAAENGHGEAVKVLLRAGAFIYSLDDDSLTPLHLAAENNHQNVVKIL 136          

HSP 3 Score: 57.3806 bits (137), Expect = 2.502e-8
Identity = 30/99 (30.30%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  304 VNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNGK 597
            VN K D + + P+H+A E G + +VQLL+ +  +    ++ +  P+H ++  GH EI+ +++  + +   K  DG TP+  A      + A+ LL  GK
Sbjct:  356 VNAK-DKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKDMDGCTPMHYAAATGSSEIAKALLKAGK 453          
BLAST of SMED30022414 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 72.7886 bits (177), Expect = 2.434e-13
Identity = 30/86 (34.88%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE   + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  243 GITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 328          

HSP 2 Score: 56.225 bits (134), Expect = 5.161e-8
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE +TKD  TPL  A  N  +  +E+L
Sbjct:  210 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEIL 295          

HSP 3 Score: 53.9138 bits (128), Expect = 2.495e-7
Identity = 21/74 (28.38%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+A   G   +V+ L++H  ++  + +    P+H ++  GH +I+ LL+ N       + +G TPL +A
Sbjct:  705 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 778          

HSP 4 Score: 53.1434 bits (126), Expect = 4.289e-7
Identity = 26/102 (25.49%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA-----------LLNNKMDCAELLSNGKT 600
            G  P+H+  ++G   +  +L++H   ++        P+H +S  G+ ++++ L+ ++  +  KTK G +PL  A           LL N     E+ SNG T
Sbjct:  672 GLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTT 773          

HSP 5 Score: 50.447 bits (119), Expect = 3.543e-6
Identity = 24/86 (27.91%), Postives = 44/86 (51.16%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K    +++LL++   +I+   E  + P+H +S+ GH  I++ L+             +TPL +A      + A+ L
Sbjct:  375 GFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 460          

HSP 6 Score: 49.6766 bits (117), Expect = 6.352e-6
Identity = 28/108 (25.93%), Postives = 49/108 (45.37%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSN----GKTLIKFFDAIKRND 636
            +G   +HIA   G   +V+ L+ +  N+  + +    P++ ++   H E+++ L+ N       T+DG TPL +AL     +    L N    GK  +       RND
Sbjct:   81 KGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARND 188          

HSP 7 Score: 48.9062 bits (115), Expect = 8.920e-6
Identity = 22/86 (25.58%), Postives = 42/86 (48.84%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA ++    + + L+++  +   E    + P+H ++  GH E++ LL+  +       K G TPL L      +  A++L
Sbjct:  606 GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVL 691          
BLAST of SMED30022414 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 72.0182 bits (175), Expect = 3.206e-13
Identity = 30/86 (34.88%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE   + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  243 GITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 328          

HSP 2 Score: 55.8398 bits (133), Expect = 5.869e-8
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE +TKD  TPL  A  N  +  +E+L
Sbjct:  210 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEIL 295          

HSP 3 Score: 50.0618 bits (118), Expect = 4.073e-6
Identity = 24/86 (27.91%), Postives = 44/86 (51.16%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K    +++LL++   +I+   E  + P+H +S+ GH  I++ L+             +TPL +A      + A+ L
Sbjct:  375 GFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 460          

HSP 4 Score: 49.2914 bits (116), Expect = 6.893e-6
Identity = 28/108 (25.93%), Postives = 49/108 (45.37%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSN----GKTLIKFFDAIKRND 636
            +G   +HIA   G   +V+ L+ +  N+  + +    P++ ++   H E+++ L+ N       T+DG TPL +AL     +    L N    GK  +       RND
Sbjct:   81 KGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARND 188          
BLAST of SMED30022414 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 69.3218 bits (168), Expect = 3.177e-12
Identity = 30/86 (34.88%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE   + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  272 GITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 357          

HSP 2 Score: 52.373 bits (124), Expect = 8.266e-7
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE +TKD  TPL  A  N  +  +E+L
Sbjct:  239 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEIL 324          

HSP 3 Score: 49.6766 bits (117), Expect = 5.506e-6
Identity = 21/74 (28.38%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+A   G   +V+ L++H  ++  + +    P+H ++  GH +I+ LL+ N       + +G TPL +A
Sbjct:  734 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 807          

HSP 4 Score: 49.2914 bits (116), Expect = 8.649e-6
Identity = 30/125 (24.00%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  259 KGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA-----------LLNNKMDCAELLSNGKT 600
            +G+ E V+  +S+       +  G  P+H+  ++G   +  +L++H   ++        P+H +S  G+ ++++ L+ ++  +  KTK G +PL  A           LL N     E+ SNG T
Sbjct:  678 EGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTT 802          
BLAST of SMED30022414 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 69.3218 bits (168), Expect = 3.205e-12
Identity = 30/86 (34.88%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE   + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  243 GITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 328          

HSP 2 Score: 52.373 bits (124), Expect = 8.321e-7
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE +TKD  TPL  A  N  +  +E+L
Sbjct:  210 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEIL 295          

HSP 3 Score: 49.6766 bits (117), Expect = 5.540e-6
Identity = 21/74 (28.38%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+A   G   +V+ L++H  ++  + +    P+H ++  GH +I+ LL+ N       + +G TPL +A
Sbjct:  705 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 778          

HSP 4 Score: 49.2914 bits (116), Expect = 8.702e-6
Identity = 30/125 (24.00%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  259 KGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA-----------LLNNKMDCAELLSNGKT 600
            +G+ E V+  +S+       +  G  P+H+  ++G   +  +L++H   ++        P+H +S  G+ ++++ L+ ++  +  KTK G +PL  A           LL N     E+ SNG T
Sbjct:  649 EGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTT 773          
BLAST of SMED30022414 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 69.3218 bits (168), Expect = 3.206e-12
Identity = 30/86 (34.88%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE   + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  243 GITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 328          

HSP 2 Score: 52.373 bits (124), Expect = 8.323e-7
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE +TKD  TPL  A  N  +  +E+L
Sbjct:  210 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEIL 295          

HSP 3 Score: 49.6766 bits (117), Expect = 5.541e-6
Identity = 21/74 (28.38%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+A   G   +V+ L++H  ++  + +    P+H ++  GH +I+ LL+ N       + +G TPL +A
Sbjct:  705 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 778          

HSP 4 Score: 49.2914 bits (116), Expect = 8.704e-6
Identity = 30/125 (24.00%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  259 KGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA-----------LLNNKMDCAELLSNGKT 600
            +G+ E V+  +S+       +  G  P+H+  ++G   +  +L++H   ++        P+H +S  G+ ++++ L+ ++  +  KTK G +PL  A           LL N     E+ SNG T
Sbjct:  649 EGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTT 773          
BLAST of SMED30022414 vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 69.707 bits (169), Expect = 1.706e-11
Identity = 30/86 (34.88%), Postives = 54/86 (62.79%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE + + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  239 GITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          

HSP 2 Score: 53.5286 bits (127), Expect = 2.830e-6
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE KTKD  TPL  A  N  +  +E+L
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEIL 291          

HSP 3 Score: 51.6026 bits (122), Expect = 9.831e-6
Identity = 22/74 (29.73%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G  P+H+A   G   +V+ L++H  ++  + +    P+H ++  GH +I+ LL+ N       + DG TPL +A
Sbjct:  701 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          
BLAST of SMED30022414 vs. UniProt/SwissProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.244e-11
Identity = 30/86 (34.88%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    IE   + ++ P+HC++ NGH  I ++L+ +   I+ KTK+G +P+ +A   + +DC  LL
Sbjct:  235 GITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 320          

HSP 2 Score: 52.373 bits (124), Expect = 5.825e-6
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    ++    +  I P+H +S  G+  +++LL+    QIE +TKD  TPL  A  N  +  +E+L
Sbjct:  202 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEIL 287          
BLAST of SMED30022414 vs. UniProt/SwissProt
Match: sp|Q9VBP3|TNKS_DROME (Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.781e-10
Identity = 35/108 (32.41%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKRNDF 639
            +D  G +P+H AC  G + + +LL++H  N+   D W+  P+H ++  G  +I +LL+ +      K +DG TP DL +  +  D AELL     L+   DA K+ + 
Sbjct:  549 ADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADL-VKESDHDVAELLRGPSALL---DAAKKGNL 652          

HSP 2 Score: 53.5286 bits (127), Expect = 2.644e-6
Identity = 23/77 (29.87%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            D  G +P+H A   G   I  LL++H   +   D+W   P+H ++  G  ++  LL+ +      K ++G+TP++LA
Sbjct:  703 DKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELA 779          

HSP 3 Score: 52.7582 bits (125), Expect = 4.504e-6
Identity = 34/115 (29.57%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  259 KGNAEGVSNNISETFVNVKSDAEGK--LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            KGN   V   ++   +N + DA+G+   P+H+A     F   + L+E+  ++  +D+  + P+H +S  GH +I  LL+ +K  +    K G TPL  A    +   C+ LL++G
Sbjct:  649 KGNLARVQRLVTPESINCR-DAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHG 762          
BLAST of SMED30022414 vs. UniProt/SwissProt
Match: sp|Q502K3|ANR52_DANRE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio OX=7955 GN=ankrd52 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.899e-10
Identity = 32/94 (34.04%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            +D  G+ P+H A + G+  +V+LL+    N+   D+   +PIH +++ GH E+++LL+       CK K G TPL  A  +  +D  + LL NG
Sbjct:  136 ADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNG 229          

HSP 2 Score: 62.7734 bits (151), Expect = 3.192e-9
Identity = 36/99 (36.36%), Postives = 56/99 (56.57%), Query Frame = 1
Query:  304 VNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNGK 597
            VN++S  EGK P+H+A   G F+  Q+L+++   I+C D +   P+H ++  GH  +I  LM N      +   G  PL LA+L    D C +LLS+G+
Sbjct:  299 VNMQSK-EGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLLSSGQ 396          

HSP 3 Score: 52.373 bits (124), Expect = 6.157e-6
Identity = 27/97 (27.84%), Postives = 51/97 (52.58%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCA-ELLSNGKTL 603
            SD + + PIH A   G   +V+LL+    +  C+D+    P+H ++ +GH ++++ L+ N  +I+     G T L +A    +   A EL++ G  +
Sbjct:  169 SDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANV 265          
BLAST of SMED30022414 vs. UniProt/SwissProt
Match: sp|P57078|RIPK4_HUMAN (Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 8.128e-10
Identity = 29/90 (32.22%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNK-CQIECKTKDGKTPLDLALLNNKMDCAELL 585
            D EG+ P+H+AC+ G  +IV++L+    ++  + +    P+H ++W GH  I++LL       +  +T DG+TPL LA        A +L
Sbjct:  582 DFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARIL 671          
BLAST of SMED30022414 vs. TrEMBL
Match: A0A0L6X012 (Ankyrin-3 OS=Termitomyces sp. J132 OX=1306850 GN=J132_02369 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.450e-13
Identity = 41/144 (28.47%), Postives = 78/144 (54.17%), Query Frame = 1
Query:  202 WKGTTDVMGDYKCFMECLIKGNAEGVSNNISE-TFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKR 630
            ++ T+ V           ++G+++ V + + + T VN   D  G+ P+H+A  +G  +  QLL+ HN +++  DEW+  P+H ++ +GH +II+LL+ +   +  K +   TPL  A+ +  ++ A+LL N    +   D  KR
Sbjct:  221 FRVTSHVYHVLPTLHSTALEGSSDAVGHLLEDNTIVNTTKDYHGRSPLHLAALRGHLNTAQLLLNHNTHVDATDEWEETPLHTATIHGHLDIIKLLLNHNADVNAKNRWRSTPLHKAIAHGHLNAAKLLLNYDADVHCKDNHKR 364          

HSP 2 Score: 63.929 bits (154), Expect = 2.505e-7
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFD 618
            P+H A   G   I++LL+ HN ++  ++ W+  P+H +  +GH    +LL+     + CK    +TPL LA     ++ AELL N K  +   D
Sbjct:  300 PLHTATIHGHLDIIKLLLNHNADVNAKNRWRSTPLHKAIAHGHLNAAKLLLNYDADVHCKDNHKRTPLHLAAKRPNLNFAELLLNYKADVHARD 393          
BLAST of SMED30022414 vs. TrEMBL
Match: A0A3S0ZH77 (ANK_REP_REGION domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_014656 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.205e-12
Identity = 34/85 (40.00%), Postives = 56/85 (65.88%), Query Frame = 1
Query:  331 KLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            + P+H+A ++G  SIVQLL++ N +I+ +D  ++ P+H S+  GH  II +L+ N   I  + K  +TP+D+AL N + D A+LL
Sbjct:  146 RTPLHVASQEGHLSIVQLLLQSNADIDAKDMLKMTPLHWSTEKGHVAIIGMLIRNGADITLEDKFNRTPVDIALNNGRTDIAQLL 230          
BLAST of SMED30022414 vs. TrEMBL
Match: A0A5F1B8H1 (ANK_REP_REGION domain-containing protein OS=Wolbachia endosymbiont of Drosophila mauritiana OX=109663 GN=E5C28_00525 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.590e-12
Identity = 31/84 (36.90%), Postives = 57/84 (67.86%), Query Frame = 1
Query:  316 SDAEGKL-----PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLAL 552
            +D E K+     P+H+A + G++ +V+LL+E+  ++E +DE  + P+H ++ NGH +I++LL+ N+  +  KT++G TPL  AL
Sbjct:  756 ADVEAKVKEDVTPLHVAAKNGYYEVVKLLLENGADVEAKDEEDVTPLHVAAQNGHTDIVKLLLENEADVNAKTEEGSTPLLFAL 839          

HSP 2 Score: 65.4698 bits (158), Expect = 1.123e-7
Identity = 28/82 (34.15%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  340 IHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +HIA   G+  IV+LL+E+  ++E + +  + P+H ++ NG+ E+++LL+ N   +E K ++  TPL +A  N   D  +LL
Sbjct:  736 LHIAAGNGYVDIVKLLLENGADVEAKVKEDVTPLHVAAKNGYYEVVKLLLENGADVEAKDEEDVTPLHVAAQNGHTDIVKLL 817          
BLAST of SMED30022414 vs. TrEMBL
Match: M9WQG3 (Ankyrin repeat domain protein OS=Wolbachia endosymbiont of Drosophila simulans wNo OX=1236908 GN=wNo_10390 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.056e-12
Identity = 31/84 (36.90%), Postives = 57/84 (67.86%), Query Frame = 1
Query:  316 SDAEGKL-----PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLAL 552
            +D E K+     P+H+A + G++ +V+LL+E+  ++E +DE  + P+H ++ NGH +I++LL+ N+  +  KT++G TPL  AL
Sbjct:  756 ADVEAKVKEDVTPLHVAAKNGYYEVVKLLLENGADVEAKDEEDVTPLHVAAENGHTDIVKLLLENEADVNAKTEEGSTPLLFAL 839          

HSP 2 Score: 65.0846 bits (157), Expect = 1.464e-7
Identity = 28/82 (34.15%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  340 IHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +HIA   G+  IV+LL+E+  ++E + +  + P+H ++ NG+ E+++LL+ N   +E K ++  TPL +A  N   D  +LL
Sbjct:  736 LHIAAGNGYVDIVKLLLENGADVEAKVKEDVTPLHVAAKNGYYEVVKLLLENGADVEAKDEEDVTPLHVAAENGHTDIVKLL 817          
BLAST of SMED30022414 vs. TrEMBL
Match: A0A1X7T0E5 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 6.045e-12
Identity = 39/98 (39.80%), Postives = 60/98 (61.22%), Query Frame = 1
Query:  304 VNVKSDAEGKLPIHIACEKGFFSIVQLLMEH-NCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNK-CQIECKTKDGKTPLDLALLNNKMDCAELLSN 591
            VN K+      P+H AC+ G F IV+LL  H  CNIE ED+W  RP+H +  +G+ EI++ L+++K C +  + ++G TPL  A LN   +  + L+N
Sbjct:  286 VNAKAGWSNYTPLHFACDNGHFEIVKLLTNHPQCNIEAEDDWNNRPLHKACESGNVEILRHLVIDKHCDVNAEGRNGYTPLHAACLNGNFETVQFLTN 383          
BLAST of SMED30022414 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 70.0922 bits (170), Expect = 1.672e-12
Identity = 32/105 (30.48%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  286 NISETFVNVKSDAE-----GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            N+++  +N  ++       G  P+HIA  +G   +V+LL++    I+ + + ++ P+HC++ NGH  II++L+     I+ KTK+G +P+ +A   + MDC   L
Sbjct:  192 NVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQL 296          

HSP 2 Score: 55.4546 bits (132), Expect = 7.997e-8
Identity = 26/86 (30.23%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K    ++ LL++H+ ++E   E  + P+H +S+ GH  I+++L+             +TPL +A      + AE L
Sbjct:  343 GFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFL 428          

HSP 3 Score: 52.373 bits (124), Expect = 6.672e-7
Identity = 36/106 (33.96%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  277 VSNNISE-TFVNVKS--DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +S N S  T  NV S   A G  P+HIA      ++ QLL+    N+    +  I P+H +S  G+  +++LL+     I+ KTKD  TPL  A  N  +   E+L
Sbjct:  158 LSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEIL 263          
BLAST of SMED30022414 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 69.3218 bits (168), Expect = 2.974e-12
Identity = 29/86 (33.72%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    I+   + ++ P+HC++ NGH  +I++L+     I+ KTK+G +P+ +A   + MDC   L
Sbjct:  214 GITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQL 299          

HSP 2 Score: 56.9954 bits (136), Expect = 2.605e-8
Identity = 34/106 (32.08%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            A+ +  N+++     K D   + P+H A   G   +V+LL+EH  N +        P+H ++  GHA   ++L+    Q    TK G TPL +A    K+D AELL
Sbjct:  428 AQFLLQNLAQVDAKAKDD---QTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELL 530          

HSP 3 Score: 52.373 bits (124), Expect = 5.947e-7
Identity = 24/93 (25.81%), Postives = 49/93 (52.69%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNG 594
            S+ + + P+H+A   G   + Q L+++   ++ + +    P+HC++  GH E+++LL+ +K   +  T  G TPL +A          +L +G
Sbjct:  408 SNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDG 500          

HSP 4 Score: 52.373 bits (124), Expect = 7.205e-7
Identity = 28/86 (32.56%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      S+ QLL+    N+    +  I P+H ++  G+  +++LL+    QI+ +TKD  TPL  A  N  +   E+L
Sbjct:  181 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEIL 266          

HSP 5 Score: 50.8322 bits (120), Expect = 2.049e-6
Identity = 26/86 (30.23%), Postives = 44/86 (51.16%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+H+A   G  +IV+ L++   +    +     P+H ++  GH E+ Q L+ N  Q++ K KD +TPL  A      +  +LL
Sbjct:  379 GLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLL 464          

HSP 6 Score: 49.2914 bits (116), Expect = 6.295e-6
Identity = 24/86 (27.91%), Postives = 44/86 (51.16%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K     + LL++H+ ++E   E  + P+H +++ GH  I++ L+             +TPL +A      + A+ L
Sbjct:  346 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFL 431          

HSP 7 Score: 48.9062 bits (115), Expect = 9.227e-6
Identity = 27/111 (24.32%), Postives = 53/111 (47.75%), Query Frame = 1
Query:  253 LIKGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            L+ GNA+             K   +G  P+H+AC+ G   + +LL+E   N     +  + P+H +  + + ++++LL+          ++G TPL +A   N+++ A  L
Sbjct:  497 LLDGNAQ-----------QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSL 596          
BLAST of SMED30022414 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 65.0846 bits (157), Expect = 6.678e-11
Identity = 26/83 (31.33%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A ++G  ++V+LL+E    I+ + +  + P+HC + +GH +++++L+     I  KTK+G +PL +A   + ++C +LL
Sbjct:  218 PLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 300          

HSP 2 Score: 55.4546 bits (132), Expect = 8.141e-8
Identity = 29/88 (32.95%), Postives = 45/88 (51.14%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSN 591
            G  P+HIA +K    I   L+E+  +        I P+H +S  G+ +++ LLM     I    K G TPL LA   ++++ AE+L N
Sbjct:  578 GYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVN 665          

HSP 3 Score: 54.299 bits (129), Expect = 1.623e-7
Identity = 38/142 (26.76%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  217 DVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDA-EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNGKTLIKFFDAIKRND 636
            DV  DY   +          V+  I +   N  + A  G  P+HIAC+K    +++LL++H  +I+   E  + PIH +++ GH  I+  LM +          G+T L +A    + +  + L+ NG     + DA  ++D
Sbjct:  309 DVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNG----AYVDAKSKDD 446          

HSP 4 Score: 52.373 bits (124), Expect = 6.778e-7
Identity = 28/93 (30.11%), Postives = 48/93 (51.61%), Query Frame = 1
Query:  316 SDAEGK---LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +D E K    P+HIA   G  ++  LL+     ++ +    I P+H +S  G++ +++LL+    +I+ KTKDG TPL     +      E+L
Sbjct:  175 ADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEML 267          
BLAST of SMED30022414 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 63.5438 bits (153), Expect = 1.891e-10
Identity = 25/83 (30.12%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A ++G  ++V+LL++    I+ + +  + P+HC + +GH +++++L+     I  KTK+G +PL +A   + ++C +LL
Sbjct:  273 PLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 355          

HSP 2 Score: 52.7582 bits (125), Expect = 5.740e-7
Identity = 35/128 (27.34%), Postives = 59/128 (46.09%), Query Frame = 1
Query:  217 DVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDA-EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            DV  DY   +          V+  I +   N  + A  G  P+HIAC+K    +++LL++H  +++   E  + PIH +++ GH  I++ L  +          G+T L +A    + D    LL NG
Sbjct:  364 DVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNG 491          

HSP 3 Score: 51.2174 bits (121), Expect = 1.617e-6
Identity = 27/107 (25.23%), Postives = 51/107 (47.66%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA-----------LLNNKMDCAELLSNGKTLI 606
            +  G  P+H+A ++    + ++L+ H   ++   +    P+H +   G+ +++  L+ N+ +I  KTK G TPL  A           LL ++    EL  NG T +
Sbjct:  696 NKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTAL 802          

HSP 4 Score: 50.0618 bits (118), Expect = 3.328e-6
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSN 591
            G  P+HIA +K    I   L+E            I P+H ++  G  +++ LL+     +    K+G TPL LA   +++  AE+L N
Sbjct:  633 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLN 720          

HSP 5 Score: 50.0618 bits (118), Expect = 3.537e-6
Identity = 28/96 (29.17%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  262 GNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G AE + N+ +E   + K+   G  P+H+AC  G   +V  L+E+   I  + +    P+H ++  GH  II +L+ ++      T +G T L +A
Sbjct:  713 GVAEVLLNHGAEVDAHTKT---GYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIA 805          

HSP 6 Score: 49.2914 bits (116), Expect = 5.654e-6
Identity = 27/93 (29.03%), Postives = 46/93 (49.46%), Query Frame = 1
Query:  316 SDAEGK---LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +D E K    P+HIA   G  ++  LL+     ++      I P+H ++  G+  +++LL+    +I+ KTKDG TPL     +      E+L
Sbjct:  230 ADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEML 322          
BLAST of SMED30022414 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 63.5438 bits (153), Expect = 1.910e-10
Identity = 25/83 (30.12%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A ++G  ++V+LL++    I+ + +  + P+HC + +GH +++++L+     I  KTK+G +PL +A   + ++C +LL
Sbjct:  245 PLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 327          

HSP 2 Score: 52.7582 bits (125), Expect = 5.788e-7
Identity = 35/128 (27.34%), Postives = 59/128 (46.09%), Query Frame = 1
Query:  217 DVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDA-EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNG 594
            DV  DY   +          V+  I +   N  + A  G  P+HIAC+K    +++LL++H  +++   E  + PIH +++ GH  I++ L  +          G+T L +A    + D    LL NG
Sbjct:  336 DVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNG 463          

HSP 3 Score: 51.2174 bits (121), Expect = 1.630e-6
Identity = 27/107 (25.23%), Postives = 51/107 (47.66%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA-----------LLNNKMDCAELLSNGKTLI 606
            +  G  P+H+A ++    + ++L+ H   ++   +    P+H +   G+ +++  L+ N+ +I  KTK G TPL  A           LL ++    EL  NG T +
Sbjct:  668 NKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTAL 774          

HSP 4 Score: 50.0618 bits (118), Expect = 3.355e-6
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSN 591
            G  P+HIA +K    I   L+E            I P+H ++  G  +++ LL+     +    K+G TPL LA   +++  AE+L N
Sbjct:  605 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLN 692          

HSP 5 Score: 50.0618 bits (118), Expect = 3.565e-6
Identity = 28/96 (29.17%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  262 GNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            G AE + N+ +E   + K+   G  P+H+AC  G   +V  L+E+   I  + +    P+H ++  GH  II +L+ ++      T +G T L +A
Sbjct:  685 GVAEVLLNHGAEVDAHTKT---GYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIA 777          

HSP 6 Score: 49.2914 bits (116), Expect = 6.663e-6
Identity = 25/86 (29.07%), Postives = 43/86 (50.00%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA   G  ++  LL+     ++      I P+H ++  G+  +++LL+    +I+ KTKDG TPL     +      E+L
Sbjct:  209 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEML 294          
BLAST of SMED30022414 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 5.761e-12
Identity = 27/86 (31.40%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+H+A ++G  ++V+LL++    I+ +    + P+HC++ +GH ++I++L+     I  KTK+G +PL +A     + C +LL
Sbjct:  245 GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL 330          

HSP 2 Score: 64.6994 bits (156), Expect = 1.303e-11
Identity = 28/86 (32.56%), Postives = 48/86 (55.81%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K    +++LL++H  +I    E  + PIH +S+ GH  ++QLL+ N          G+TPL +A    +++  + L
Sbjct:  377 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTL 462          

HSP 3 Score: 57.3806 bits (137), Expect = 3.379e-9
Identity = 31/103 (30.10%), Postives = 46/103 (44.66%), Query Frame = 1
Query:  277 VSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            + N  S    NV+    G+ P+H+A   G   +V+ L++    +  +      P+H +S  G AEI+QLL+         T  G TPL  A      D A LL
Sbjct:  430 LQNGASSNATNVR----GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLL 528          

HSP 4 Score: 57.3806 bits (137), Expect = 3.531e-9
Identity = 33/98 (33.67%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  292 SETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            S   V VK+  E + P+HIA   G   IVQLL++   +          P++ +S  GH ++  LL+ N   I   TK G TPL +A    +++ A LL
Sbjct:  465 SGARVGVKAR-EDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLL 561          

HSP 5 Score: 56.9954 bits (136), Expect = 3.755e-9
Identity = 27/90 (30.00%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGK 597
            G  P+HIA +K    + ++L+E         +  + P+H ++  GHA+++ LL+     I   TK G T + LA   +K++ AE+L+  K
Sbjct:  608 GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHK 697          

HSP 6 Score: 53.1434 bits (126), Expect = 7.268e-8
Identity = 24/86 (27.91%), Postives = 47/86 (54.65%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  PIH+A   G  ++VQLL+++  +    +     P+H +S  G  E+++ L+ +  ++  K ++ +TPL +A    K +  +LL
Sbjct:  410 GLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 495          

HSP 7 Score: 52.7582 bits (125), Expect = 9.785e-8
Identity = 31/107 (28.97%), Postives = 48/107 (44.86%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL----SNGKTLIKFFDAIKRND 636
            G   +HIA   G   IV++L+E   NI  + +    P++ ++   H EI++ L+ N       T+DG TPL +AL         LL    + GK  +       R D
Sbjct:   76 GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKD 182          

HSP 8 Score: 50.8322 bits (120), Expect = 3.629e-7
Identity = 22/71 (30.99%), Postives = 39/71 (54.93%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPL 540
            G  P+HIA   G  ++  LL+     ++      I P+H ++  G+  +++LL+    +I+ KT+DG TPL
Sbjct:  212 GFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPL 282          

HSP 9 Score: 49.2914 bits (116), Expect = 1.128e-6
Identity = 25/104 (24.04%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDL-----------ALLNNKMDCAELLSNGKTLI 606
            G   +H+A ++   ++ ++L +H  ++    +    P+H +S  G+ +++  L+ N+  +  KT++G TPL             ALL ++    EL +NG T +
Sbjct:  674 GLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTAL 777          

HSP 10 Score: 48.521 bits (114), Expect = 1.807e-6
Identity = 26/88 (29.55%), Postives = 42/88 (47.73%), Query Frame = 1
Query:  322 AEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            A G  P++ A  +G   +  LL+E+  +I    +    P+H +S  G  E+  LL+      + K K+G TPL +A   +    A LL
Sbjct:  507 ASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLL 594          
BLAST of SMED30022414 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 6.150e-12
Identity = 27/86 (31.40%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+H+A ++G  ++V+LL++    I+ +    + P+HC++ +GH ++I++L+     I  KTK+G +PL +A     + C +LL
Sbjct:  238 GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL 323          

HSP 2 Score: 65.0846 bits (157), Expect = 1.262e-11
Identity = 28/86 (32.56%), Postives = 48/86 (55.81%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K    +++LL++H  +I    E  + PIH +S+ GH  ++QLL+ N          G+TPL +A    +++  + L
Sbjct:  370 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTL 455          

HSP 3 Score: 56.9954 bits (136), Expect = 3.812e-9
Identity = 27/90 (30.00%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGK 597
            G  P+HIA +K    + ++L+E         +  + P+H ++  GHA+++ LL+     I   TK G T + LA   +K++ AE+L+  K
Sbjct:  603 GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHK 692          

HSP 4 Score: 56.9954 bits (136), Expect = 4.054e-9
Identity = 40/125 (32.00%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  214 TDVMGDYKCFMECLIKGNAEGVSNNI-SETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            T+V G+    M     G  E V   + S   V VK+  E + P+HIA   G   IVQLL++   +          P++ +S  GH ++  LL+ N   I   TK G TPL +A    +++ A LL
Sbjct:  432 TNVRGETPLHMASR-AGQLEVVKTLLQSGARVGVKAR-EDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLL 554          

HSP 5 Score: 56.9954 bits (136), Expect = 4.427e-9
Identity = 31/103 (30.10%), Postives = 46/103 (44.66%), Query Frame = 1
Query:  277 VSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            + N  S    NV+    G+ P+H+A   G   +V+ L++    +  +      P+H +S  G AEI+QLL+         T  G TPL  A      D A LL
Sbjct:  423 LQNGASSNATNVR----GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLL 521          

HSP 6 Score: 53.1434 bits (126), Expect = 7.391e-8
Identity = 24/87 (27.59%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
             G  PIH+A   G  ++VQLL+++  +    +     P+H +S  G  E+++ L+ +  ++  K ++ +TPL +A    K +  +LL
Sbjct:  402 SGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 488          

HSP 7 Score: 52.7582 bits (125), Expect = 9.695e-8
Identity = 31/107 (28.97%), Postives = 48/107 (44.86%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL----SNGKTLIKFFDAIKRND 636
            G   +HIA   G   IV++L+E   NI  + +    P++ ++   H EI++ L+ N       T+DG TPL +AL         LL    + GK  +       R D
Sbjct:   77 GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKD 183          

HSP 8 Score: 50.8322 bits (120), Expect = 4.031e-7
Identity = 22/72 (30.56%), Postives = 39/72 (54.17%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPL 540
             G  P+HIA   G  ++  LL+     ++      I P+H ++  G+  +++LL+    +I+ KT+DG TPL
Sbjct:  204 SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPL 275          

HSP 9 Score: 49.2914 bits (116), Expect = 1.091e-6
Identity = 25/104 (24.04%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDL-----------ALLNNKMDCAELLSNGKTLI 606
            G   +H+A ++   ++ ++L +H  ++    +    P+H +S  G+ +++  L+ N+  +  KT++G TPL             ALL ++    EL +NG T +
Sbjct:  669 GLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTAL 772          
BLAST of SMED30022414 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 3.340e-10
Identity = 31/94 (32.98%), Postives = 50/94 (53.19%), Query Frame = 1
Query:  304 VNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            V+ K+  E + P+HIA   G   IVQLL++H  + +        P+H ++  GH ++  +L+ +   +   TK G TPL +A    KM+ A LL
Sbjct:  107 VDAKAREE-QTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLL 199          

HSP 2 Score: 58.151 bits (139), Expect = 1.656e-9
Identity = 27/86 (31.40%), Postives = 43/86 (50.00%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA +K    I   L+E+           + P+H  +  GHA++  LL+     +   TK G +PL LA   +K++ AE+L
Sbjct:  246 GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEIL 331          

HSP 3 Score: 51.9878 bits (123), Expect = 1.671e-7
Identity = 28/119 (23.53%), Postives = 54/119 (45.38%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSW---------------------------------NGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K    +++LL+++  +IE   E  + P+H S++                                  G  E+++ L+ N  Q++ K ++ +TPL +A    K++  +LL
Sbjct:   15 GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLL 133          

HSP 4 Score: 50.447 bits (119), Expect = 5.617e-7
Identity = 26/97 (26.80%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNGKTL 603
            ++  G+  +H+A   G   +V+ L+ +   ++ +   +  P+H ++  G  EI+QLL+ +    +  T +G TPL +A      D  A LL +G +L
Sbjct:   77 TNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL 173          

HSP 5 Score: 50.0618 bits (118), Expect = 7.170e-7
Identity = 24/90 (26.67%), Postives = 43/90 (47.78%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            + + G  P+H+A  +G   +  +L+EH  ++    +    P+H +S  G  E+  LL+      +   K+G TPL +A   +    A LL
Sbjct:  143 ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLL 232          
BLAST of SMED30022414 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 9.017e-10
Identity = 33/104 (31.73%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKR 630
            D  G +P+H AC  G + + +LL++    +   D W+  P+H ++  G  EI +LL+ +      K +DG TPLDL +     D  +LL     L+   DA K+
Sbjct:  680 DKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL-VKEGDTDIQDLLRGDAALL---DAAKK 779          

HSP 2 Score: 54.299 bits (129), Expect = 3.158e-8
Identity = 24/77 (31.17%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            D  G +P+H A   G   I  LL++++  +   D+W   P+H ++  G  ++  LL+ +      K ++G+TPLDLA
Sbjct:  833 DKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLA 909          

HSP 3 Score: 54.299 bits (129), Expect = 3.186e-8
Identity = 38/129 (29.46%), Postives = 64/129 (49.61%), Query Frame = 1
Query:  220 VMGDYKC--FMECLIKGNAEGVSNNISETFVNVK-SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            + G+YK    +E    GN E +   ++   VN   SD     P+H+A       IVQLL++H  ++  +D+  + P+H +   GH E+ +LL+ +   +        TPL  A   N+++ C+ LLS G
Sbjct:  295 LTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYG 423          

HSP 4 Score: 50.447 bits (119), Expect = 5.760e-7
Identity = 24/77 (31.17%), Postives = 38/77 (49.35%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            D  G +P+H AC  G   +V LL+    +    D W   P+H ++  G  ++  +L+ +      +  DGKT LDLA
Sbjct:  211 DDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLA 287          

HSP 5 Score: 48.9062 bits (115), Expect = 1.461e-6
Identity = 35/123 (28.46%), Postives = 57/123 (46.34%), Query Frame = 1
Query:  235 KCFMECLIKGNAEGVSNNISETFVNVKSDAEGK--LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            K   E    G+   V   +S   VN + D  G+   P+H A   G   +V+ L+++  N+   D+  + P+H +   GHAE++ LL+        +     TPL  A +  K+D C  LL +G
Sbjct:  149 KELFEACRNGDVGRVKRLVSPLNVNAR-DTTGRKSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHG 270          
BLAST of SMED30022414 vs. Ensembl Sea Lamprey
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 58.5362 bits (140), Expect = 1.706e-9
Identity = 29/95 (30.53%), Postives = 45/95 (47.37%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTL 603
            D   + P+H+A   GF  +VQ L +   N    D+      HC++W+GH  + Q L    C +  + +DG+TPL  A      D   L+ +G  L
Sbjct:  423 DKSEETPLHVAARYGFVDVVQQLCKAGANPNPTDKSSPSAKHCAAWHGHTPVAQALCRAGCALNMQNRDGETPLLSAAARGHRDIVCLVEHGSQL 517          
BLAST of SMED30022414 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 50.447 bits (119), Expect = 2.961e-7
Identity = 31/96 (32.29%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEH-NCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKD--GKTPLDLALLNNKMDCAE-LLSNG 594
            D+ G+  + IAC+KG + +V+ ++E    +I  +D      +H ++  GH EI++LL+ N   +  K+ +  G TPL  A  N  +D  + LL NG
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNG 422          
BLAST of SMED30022414 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 46.9802 bits (110), Expect = 1.481e-6
Identity = 27/83 (32.53%), Postives = 46/83 (55.42%), Query Frame = 1
Query:  340 IHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLL-MLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            +H+A  K +F + Q L+E+  ++  +D++   P+H ++  G  ++I+LL  L K  +  + K G TPL  AL     D A LL
Sbjct:  111 LHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLL 193          
BLAST of SMED30022414 vs. Ensembl Nematostella
Match: EDO34688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNN7])

HSP 1 Score: 53.1434 bits (126), Expect = 3.121e-9
Identity = 31/91 (34.07%), Postives = 47/91 (51.65%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSN 591
            D  G  P+H A   G    ++LL+EH  +I   D     P+H SS NGH   ++ L+ N    + K+K G T L++A  + +   AE L+N
Sbjct:    3 DDTGSSPVHKAAANGHLEALKLLLEHGGDINQCDITGSSPLHVSSRNGHLTCVKYLIENGADHKLKSKKGNTALNVAKSSAQQKVAEYLAN 93          
BLAST of SMED30022414 vs. Ensembl Nematostella
Match: EDO35896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK81])

HSP 1 Score: 49.2914 bits (116), Expect = 7.233e-8
Identity = 25/82 (30.49%), Postives = 42/82 (51.22%), Query Frame = 1
Query:  304 VNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            VN ++ AEG   +H AC +G  S  + L+EH  ++E  D     P+H ++  G  + +QLL+        ++ DG T   +A
Sbjct:   12 VNARNPAEGATALHAACFEGNVSCARYLLEHGASVEARDNDGWSPLHAATCGGKRKCVQLLLAADADPFAESFDGYTAFQMA 93          
BLAST of SMED30022414 vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 50.0618 bits (118), Expect = 3.400e-7
Identity = 27/80 (33.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  361 GFFSIVQLLMEHNCNIECE-DEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            G   +  +L++H   I  E D  +  P+  + W GH ++++LL+     IE +TK+G TPL  A L    D  A+LL  G
Sbjct:   64 GHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQG 143          
BLAST of SMED30022414 vs. Ensembl Nematostella
Match: EDO36063 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJL9])

HSP 1 Score: 50.0618 bits (118), Expect = 4.544e-7
Identity = 31/124 (25.00%), Postives = 56/124 (45.16%), Query Frame = 1
Query:  232 YKCFMECLIKGNAEGVSNNISETF-----VNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEII-QLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            Y   M   + G  +    N++        VN + D  G+ P+ +A  +G   +V LL+E + ++  +D      I C+S +GH  I  +LL    C    +  +G + + +A+  N  D A L+
Sbjct:  116 YSSVMLAAVTGCQKDQYRNVARRLFQMGDVNKRYDETGQTPLMLAVSRGRLDMVDLLLETDADVNAQDNEGSTAIMCASEHGHTNIARRLLAQPHCDSSIEDNEGSSAMSIAMERNFKDIAVLI 239          
BLAST of SMED30022414 vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 46.595 bits (109), Expect = 7.181e-7
Identity = 18/57 (31.58%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLM 489
            D  G  P+H AC +G   +V++L+++  ++       IRP+H ++  GH E+++LL+
Sbjct:   17 DNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLL 73          
BLAST of SMED30022414 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 71.2478 bits (173), Expect = 6.253e-13
Identity = 30/86 (34.88%), Postives = 54/86 (62.79%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA  +G   +V+LL++    I+ + + ++ P+HC++ NGH  II++L+ +   I+ KTK+G +P+ +A   + MDC   L
Sbjct:  237 GITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQL 322          

HSP 2 Score: 53.1434 bits (126), Expect = 3.698e-7
Identity = 29/86 (33.72%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      S+ QLL+    N+    +  I P+H +S  G+  +++LL+    QI+ +TKD  TPL  A  N  +   E+L
Sbjct:  204 GFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEIL 289          

HSP 3 Score: 51.9878 bits (123), Expect = 1.007e-6
Identity = 27/90 (30.00%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGK 597
            G  P+H+A   G  +IV+ L++   +    +     P+H +S  GH E+ Q L+ N  Q++ + KD +TPL  A      +  +LL + K
Sbjct:  402 GLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHK 491          

HSP 4 Score: 51.6026 bits (122), Expect = 1.089e-6
Identity = 33/106 (31.13%), Postives = 52/106 (49.06%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            A+ +  N ++     K D   + P+H A   G   +V+LL++H  N +        P+H ++  GH   I++L+    Q    TK G TPL +A    K+D AELL
Sbjct:  451 AQFLLQNAAQVDARAKDD---QTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELL 553          

HSP 5 Score: 51.6026 bits (122), Expect = 1.099e-6
Identity = 22/78 (28.21%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            S+ + + P+H+A   G   + Q L+++   ++   +    P+HC++  GH E+++LL+ +K   +  T  G TPL +A
Sbjct:  431 SNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIA 508          

HSP 6 Score: 48.9062 bits (115), Expect = 8.324e-6
Identity = 26/98 (26.53%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  310 VKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAE-LLSNGKT 600
            VK   +G  P+H+A + G   + +LL+E   N     +  + P+H +  + + ++++LL+          ++G TPL +A   N+++ A  LL NG +
Sbjct:  528 VKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGAS 625          
BLAST of SMED30022414 vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 4.433e-12
Identity = 26/83 (31.33%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A ++G  ++V+LL+E    I+   +  + P+HC++ +GH +++++L+     I  KTK+G +PL +A   + ++C +LL
Sbjct:  247 PLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 329          

HSP 2 Score: 57.3806 bits (137), Expect = 1.090e-8
Identity = 27/89 (30.34%), Postives = 47/89 (52.81%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSN 591
             G  P+HIA   G  ++  LL+     ++ +    I P+H +S  G++ +++LL+    +I+ +TKDG TPL  A  +      E+L N
Sbjct:  210 SGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLN 298          

HSP 3 Score: 50.0618 bits (118), Expect = 2.124e-6
Identity = 27/92 (29.35%), Postives = 46/92 (50.00%), Query Frame = 1
Query:  217 DVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDA-EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLM 489
            DV  DY   +          V+  I +   N  + A  G  P+HIAC+K    +++LL++H  +I+   E  + PIH +++ GH  I+  L+
Sbjct:  338 DVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLI 429          

HSP 4 Score: 49.6766 bits (117), Expect = 3.217e-6
Identity = 28/108 (25.93%), Postives = 49/108 (45.37%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL----SNGKTLIKFFDAIKRND 636
            +G   +HIA   G   +V+ L+ +  N+  + +    P++ ++   H +++QLL+ N       T+DG TPL +AL         LL    + GK  +       R D
Sbjct:   82 KGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKD 189          
BLAST of SMED30022414 vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 6.511e-12
Identity = 26/83 (31.33%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  337 PIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            P+H+A ++G  ++V+LL++    IE + +  + P+HC + +GH +++++L+     I  KTK+G +PL +A   + ++C +LL
Sbjct:  247 PLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 329          

HSP 2 Score: 55.0694 bits (131), Expect = 5.522e-8
Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 1
Query:  325 EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPL 540
             G  P+HIA   G  ++  LL+     ++      I P+H ++  G++ +++LL+    +IE KTKDG TPL
Sbjct:  210 SGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPL 281          

HSP 3 Score: 50.0618 bits (118), Expect = 2.167e-6
Identity = 27/92 (29.35%), Postives = 46/92 (50.00%), Query Frame = 1
Query:  217 DVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDA-EGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLM 489
            DV  DY   +          V+  I +   N  + A  G  P+HIAC+K    +++LL++H  +I+   E  + PIH +++ GH  I+  L+
Sbjct:  338 DVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALI 429          
BLAST of SMED30022414 vs. Ensembl Medaka
Match: ENSORLT00000038944.1 (tankyrase-1 [Source:NCBI gene;Acc:101158122])

HSP 1 Score: 64.3142 bits (155), Expect = 1.147e-10
Identity = 34/104 (32.69%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKR 630
            D  G +P+H AC  G + + +LL+ H  ++   D W+  P+H ++  G  EI +LL+ +      K +DG TPLDL + +   D  +LL     L+   DA K+
Sbjct:  661 DKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL-VKDGDTDIQDLLRGDAALL---DAAKK 760          

HSP 2 Score: 55.8398 bits (133), Expect = 4.736e-8
Identity = 25/77 (32.47%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  319 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLA 549
            D  G +P+H A   G   I  LL+++N  +   D+W   P+H ++  G  ++  LL+ +      K ++G+TPLDLA
Sbjct:  814 DKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA 890          

HSP 3 Score: 54.6842 bits (130), Expect = 1.078e-7
Identity = 38/129 (29.46%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  220 VMGDYKC--FMECLIKGNAEGVSNNISETFVNVK-SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            + G+YK    +E    GN E +   ++   VN   SD     P+H+A       IVQLL++H  ++  +D+  + P+H +   GH E+ +LL+ +   +        TPL  A   N+++ C+ LLS+G
Sbjct:  277 LTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHG 405          

HSP 4 Score: 49.6766 bits (117), Expect = 4.501e-6
Identity = 34/125 (27.20%), Postives = 56/125 (44.80%), Query Frame = 1
Query:  226 GDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGK-LPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMD-CAELLSNG 594
            G ++   E    G+   V   +    VN K  A  K  P+H A   G   +V  L++   N+   D+  + P+H +   GH+E++ LL+    +   +     TPL  A +  K+D C  LL +G
Sbjct:  128 GAFRELFEACRNGDVSRVKKLVDAMNVNAKDMAGRKSTPLHFAAGFGRKDVVDHLLQMGANVHARDDGGLIPLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQHG 252          
BLAST of SMED30022414 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 63.929 bits (154), Expect = 1.432e-10
Identity = 31/86 (36.05%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIA      ++ QLL+    N E      + P+HC++ NGH  II++L+ N   I+ KTK+G +P+ +A   + MDC + L
Sbjct:  183 GFTPLHIAAHYENLNVAQLLLNRGANDE------LTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQL 262          

HSP 2 Score: 57.7658 bits (138), Expect = 1.257e-8
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 1
Query:  328 GKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            G  P+HIAC+K    ++ LL++H+ +IE   E  + P+H +S+ GH  I+++L+             +TPL +A  +   + AE L
Sbjct:  309 GFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFL 394          

HSP 3 Score: 55.8398 bits (133), Expect = 6.123e-8
Identity = 35/106 (33.02%), Postives = 52/106 (49.06%), Query Frame = 1
Query:  268 AEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            AE +  N +      K D   + P+H A   G   +V+LL+EH  N          P+H ++  GH + ++LL+  + Q    TK G TPL +A    K+D AELL
Sbjct:  391 AEFLLQNAAPVDAKAKDD---QTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELL 493          

HSP 4 Score: 52.7582 bits (125), Expect = 5.664e-7
Identity = 23/90 (25.56%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  316 SDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELL 585
            S+ + + P+H+A   G F + + L+++   ++ + +    P+HC++  GH E+++LL+ +K      T  G +PL +A     +    LL
Sbjct:  371 SNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLL 460          
BLAST of SMED30022414 vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 253.062 bits (645), Expect = 1.990e-81
Identity = 126/170 (74.12%), Postives = 130/170 (76.47%), Query Frame = 1
Query:  199 IWKGTTDVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQI---------------------------------RPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIK 609
            IWKG TDVMGDYKCFMECLIKGNAEGVSNNISE FVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECED+WQ                                  RPIH +SWNGHAEIIQLLMLNKCQIECKTKDG+TPLDLA  +NKMDCAE LSNGKTLIK
Sbjct:  169 IWKGPTDVMGDYKCFMECLIKGNAEGVSNNISERFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDKWQTRPIHYASVNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLARFSNKMDCAEFLSNGKTLIK 338          
BLAST of SMED30022414 vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 251.521 bits (641), Expect = 1.072e-80
Identity = 126/170 (74.12%), Postives = 130/170 (76.47%), Query Frame = 1
Query:  199 IWKGTTDVMGDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEW---------------------------------QIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIK 609
            IWKG TDVMGDYKCFMECLIKGNAEGVSNNISE FVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECED+W                                 Q RPIH +SWNGHAEIIQLLMLNKCQIECKTKDG+TPLDLA  +NKMDCAE LSNGKTLIK
Sbjct:  169 IWKGPTDVMGDYKCFMECLIKGNAEGVSNNISERFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDKWQNRPIHWASWNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLARFSNKMDCAEFLSNGKTLIK 338          
BLAST of SMED30022414 vs. Planmine SMEST
Match: SMESG000076482.1 (SMESG000076482.1)

HSP 1 Score: 234.958 bits (598), Expect = 2.293e-75
Identity = 122/164 (74.39%), Postives = 126/164 (76.83%), Query Frame = 1
Query:  244 MECLIKGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQIRPIHCSSWN---------------------------------GHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKRND 636
            MECLIKGNAEGVS+NISE FVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQ+RPIH +S N                                 GHAEIIQLLMLNKCQIECKTKDGKTPLD A +NNKMDCAELLSNGKTLIKFFDAIKRND
Sbjct:    1 MECLIKGNAEGVSSNISERFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQMRPIHYASENGHADVVRLLIDRNCNIECENKGQRRPIHYASEKGHAEIIQLLMLNKCQIECKTKDGKTPLDFARINNKMDCAELLSNGKTLIKFFDAIKRND 164          
BLAST of SMED30022414 vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 231.106 bits (588), Expect = 2.683e-75
Identity = 119/162 (73.46%), Postives = 123/162 (75.93%), Query Frame = 1
Query:  223 MGDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEWQI---------------------------------RPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIK 609
            MGDYKCFMECLIKGNAEGVSNNISE FVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECED+WQ                                  RPIH +SWNGHAEIIQLLMLNKCQIECKTKDG+TPLDLA  +NKMDCAE LSNGKTLIK
Sbjct:    1 MGDYKCFMECLIKGNAEGVSNNISERFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDKWQTRPIHYASVNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLARFSNKMDCAEFLSNGKTLIK 162          
BLAST of SMED30022414 vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 228.794 bits (582), Expect = 2.198e-74
Identity = 119/162 (73.46%), Postives = 123/162 (75.93%), Query Frame = 1
Query:  223 MGDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDEW---------------------------------QIRPIHCSSWNGHAEIIQLLMLNKCQIECKTKDGKTPLDLALLNNKMDCAELLSNGKTLIK 609
            MGDYKCFMECLIKGNAEGVSNNISE FVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECED+W                                 Q RPIH +SWNGHAEIIQLLMLNKCQIECKTKDG+TPLDLA  +NKMDCAE LSNGKTLIK
Sbjct:    1 MGDYKCFMECLIKGNAEGVSNNISERFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDKWQNRPIHWASWNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLARFSNKMDCAEFLSNGKTLIK 162          
The following BLAST results are available for this feature:
BLAST of SMED30022414 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK13.553e-1234.88ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK13.553e-1234.88ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK13.557e-1234.88ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK32.350e-1130.12ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
RIPK41.685e-1032.22receptor interacting serine/threonine kinase 4 [So... [more]
back to top
BLAST of SMED30022414 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.558e-829.25AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.558e-829.25AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.561e-829.25AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.561e-829.25AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.563e-829.25AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30022414 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnks1.777e-1132.41gene:FBgn0027508 transcript:FBtr0084890[more]
Tnks1.871e-1132.41gene:FBgn0027508 transcript:FBtr0330383[more]
Ank23.000e-1133.73gene:FBgn0261788 transcript:FBtr0334062[more]
Ank25.100e-1133.73gene:FBgn0261788 transcript:FBtr0303120[more]
Ank22.745e-1030.28gene:FBgn0261788 transcript:FBtr0303119[more]
back to top
BLAST of SMED30022414 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a2.157e-1230.48ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3b4.230e-1231.33ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3b4.804e-1231.33ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank1b1.022e-1131.40ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.046e-1131.40ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30022414 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000035644.11.335e-1132.26pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
foxj39.147e-1132.69forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
foxj39.230e-1132.69forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
tnks21.425e-1033.65tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
pan31.445e-1030.68poly(A) specific ribonuclease subunit PAN3 [Source... [more]
back to top
BLAST of SMED30022414 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank12.434e-1334.88ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank13.206e-1334.88ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank13.177e-1234.88ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank13.205e-1234.88ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank13.206e-1234.88ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of SMED30022414 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16157|ANK1_HUMAN1.706e-1134.88Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|Q02357|ANK1_MOUSE2.244e-1134.88Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
sp|Q9VBP3|TNKS_DROME1.781e-1032.41Poly [ADP-ribose] polymerase tankyrase OS=Drosophi... [more]
sp|Q502K3|ANR52_DANRE1.899e-1034.04Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|P57078|RIPK4_HUMAN8.128e-1032.22Receptor-interacting serine/threonine-protein kina... [more]
back to top
BLAST of SMED30022414 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L6X0121.450e-1328.47Ankyrin-3 OS=Termitomyces sp. J132 OX=1306850 GN=J... [more]
A0A3S0ZH773.205e-1240.00ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A5F1B8H13.590e-1236.90ANK_REP_REGION domain-containing protein OS=Wolbac... [more]
M9WQG35.056e-1236.90Ankyrin repeat domain protein OS=Wolbachia endosym... [more]
A0A1X7T0E56.045e-1239.80ANK_REP_REGION domain-containing protein OS=Amphim... [more]
back to top
BLAST of SMED30022414 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a1.672e-1230.48ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b2.974e-1233.72ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3b6.678e-1131.33ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a1.891e-1030.12ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.910e-1030.12ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of SMED30022414 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.15.761e-1231.40pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.16.150e-1231.40pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007449.13.340e-1032.98pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000009608.19.017e-1031.73pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
dapk11.706e-930.53death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30022414 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HOS42.961e-732.29Subunit of the Set3 complex; complex is a meiotic-... [more]
NAS61.481e-632.53Evolutionarily conserved 19S regulatory particle a... [more]
back to top
BLAST of SMED30022414 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346883.121e-934.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358967.233e-830.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281783.400e-733.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360634.544e-725.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341617.181e-731.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30022414 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b6.253e-1334.88ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000040233.14.433e-1231.33pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
ENSORLT00000039903.16.511e-1231.33pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
ENSORLT00000038944.11.147e-1032.69tankyrase-1 [Source:NCBI gene;Acc:101158122][more]
ank1a1.432e-1036.05ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
back to top
BLAST of SMED30022414 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076390.11.990e-8174.12SMESG000076390.1[more]
SMESG000076390.11.072e-8074.12SMESG000076390.1[more]
SMESG000076482.12.293e-7574.39SMESG000076482.1[more]
SMESG000076390.12.683e-7573.46SMESG000076390.1[more]
SMESG000076390.12.198e-7473.46SMESG000076390.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022414 ID=SMED30022414|Name=SMED30022414|organism=Schmidtea mediterranea sexual|type=transcript|length=1154bp
CAACTTTTAAATAAAATGTAATATTTTGGCAATTATTAACCAATTTAAAT
TTATATTTATTTAATGTTTTGATATAAATTATAATTTATTTAATTATATA
TTATTAATTATCATTTTAGTGGAATAGAATTACATTATAAATCATTATTA
TTAGAAAATAATTAGTAATTACAATATTATTATTATAGTGCTTTATATAT
TTGGAAGGGGACAACTGATGTGATGGGAGATTATAAATGTTTCATGGAAT
GCCTGATCAAGGGAAACGCGGAGGGAGTCAGCAATAATATTAGCGAGACA
TTTGTGAATGTGAAATCAGATGCAGAAGGGAAATTGCCAATTCACATCGC
ATGCGAGAAAGGATTTTTCAGCATTGTCCAGTTGCTGATGGAGCACAATT
GCAATATCGAATGCGAGGATGAATGGCAAATTAGACCAATTCATTGTTCA
AGCTGGAATGGCCATGCGGAAATCATTCAATTATTAATGCTGAATAAATG
CCAAATCGAATGCAAAACAAAAGATGGAAAAACCCCCTTGGATTTGGCAC
TGCTCAATAACAAAATGGATTGTGCTGAATTATTATCCAACGGCAAAACC
TTGATAAAATTTTTCGATGCTATCAAACGGAATGATTTTTAATTAACTCG
ATTTTTTGTTTTAATAAGTTAACGGAAATATTAAAACAAAACAAAACTTA
TAATAAAATGGAATTATTCAGTTGTCAAGGTTCAATGCAAACCGTCCTTG
TGGAGTAACAGAGAGTCAGGGAATTACATACAAGGAGCGAGAGGGCGAGA
GGGGGAGAAGGGGAGAACGGTGGGGCAGAGAGTGAAGTCCAGGAACACAA
AAAATCCCATTGTTAATACGTGTTAATAACGTGCTAGACTTTATCGATTT
GTATTCCACTTGGGCACATTTACCTTATTGCAAATCATTAATTAATCACT
CTCAGAAATTCTCTACGACTGAGAACTGATATTATTCAATAGCGATCAGA
AAATTTATATCAAACCCAATTTTTTACGGGGAAAAATTTGCATAGGAATA
ATTTTGTTGGGCAGCAACAGGCGAGGGGAAACAATGAGTTGCTGGAGAAT
GTTTGCTTTCTTCTTTTATTTGCCAATAACAACCATTCCAACCTCCTCCC
ATCC
back to top

protein sequence of SMED30022414-orf-1

>SMED30022414-orf-1 ID=SMED30022414-orf-1|Name=SMED30022414-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MGDYKCFMECLIKGNAEGVSNNISETFVNVKSDAEGKLPIHIACEKGFFS
IVQLLMEHNCNIECEDEWQIRPIHCSSWNGHAEIIQLLMLNKCQIECKTK
DGKTPLDLALLNNKMDCAELLSNGKTLIKFFDAIKRNDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005198structural molecule activity
GO:0005200structural constituent of cytoskeleton
GO:0008093cytoskeletal adaptor activity
GO:0019899enzyme binding
GO:0030507spectrin binding
GO:0051117ATPase binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016529sarcoplasmic reticulum
GO:0030018Z disc
GO:0030673axolemma
GO:0031430M band
GO:0031672A band
GO:0042383sarcolemma
GO:0043005neuron projection
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0006888ER to Golgi vesicle-mediated transport
GO:0007010cytoskeleton organization
GO:0007165signal transduction
GO:0010638positive regulation of organelle organization
GO:0045199maintenance of epithelial cell apical/basal polarity
GO:0072661protein targeting to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 35..64
e-value: 0.0026
score: 27.0
coord: 101..130
e-value: 270.0
score: 9.2
coord: 68..97
e-value: 6.0
score: 15.8
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 35..67
score: 11.247
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 2..124
e-value: 1.7E-27
score: 98.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 4..123
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 40..124
e-value: 1.1E-13
score: 51.5
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 35..121
score: 22.516
NoneNo IPR availablePANTHERPTHR24193:SF116ADA2A-CONTAINING COMPLEX COMPONENT 3, ISOFORM Dcoord: 33..122
NoneNo IPR availablePANTHERPTHR24193ANKYRIN REPEAT PROTEINcoord: 33..122