Transient receptor potential cation channel subfamily A member 1

Overview
NameTransient receptor potential cation channel subfamily A member 1
Smed IDSMED30022407
Length (bp)3197
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily A member 1 (SMED30022407) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily A member 1 (SMED30022407) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily A member 1 (SMED30022407) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily A member 1 (SMED30022407) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022407

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022407SMESG000070631.1 SmedASXL_000462SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022407SMESG000070631.1 SmedASXL_003370SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022407SMESG000070631.1 SmedASXL_019885SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022407SMESG000070631.1 SmedASXL_019692SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022407SMESG000070631.1 SmedASXL_060736SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022407SMESG000070631.1 SmedASXL_006160SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022407SMESG000070631.1 dd_Smed_v4_33748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022407SMESG000070631.1 dd_Smed_v4_41539_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022407SMESG000070631.1 dd_Smed_v6_41539_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30022407SMESG000070631.1 dd_Smed_v6_33748_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 187.963 bits (476), Expect = 6.794e-48
Identity = 226/962 (23.49%), Postives = 413/962 (42.93%), Query Frame = 2
Query:  329 NINK----KSCKGSTALLL--AVKSGNAECVRLICKQKGMEI-DGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLL-HAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNS---------KINIASVINSTDC----------EGYSC-----FLN---------AIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEF---RFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSAS-------VNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIM-----SMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAK--VKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFK---IFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            N NK    K C       L  A   G  E +  I +   +E+    D  G TP+  A   N I+ VK LL  GANP    ++ M  LH  ++  + E++K+LL H      ++  NG + + +A +    EA  + ++               I+ A+   S +C           GYS      F+N         A++     +I  CL  GA I+  +     A+H A+  G +EI+  +  +      + N  D      +H  SL     +A+ L+   A +N  +    +PL+ +           S   + LLL+  A V +KD   +  LHL +   +     L  + ++ ++ + L+   D++G  PLH AC        N L+    ++   + ++  P+H A   G +   + L+  +I    + NE + + +    LA ++GH  + + L  K   +   D  G   L +A   G    +K+IL  +     R +   +T LH AA+ G  K V  LLS  A++  N    + L LAL N+        +    W   ++         K  +  +I    +    LL+  +   ++  S      +Y+F  L   P +          +    T    + +  + +L+ HP+    LL KW  +G    M +L ++   L   T ++ +  P +A    +++ G   + S  +++   T+S +    ++     S+FG+ +   E+ +   QK  YF   SN +  ++Y++ I F     V+ P   +QW  G IA+   W N + YLQ   N GI I+M + ++ ++++  ++F+ L++ + ++FYI+   Q PF +   S  + + M++G+++Y   FL+P  +       +    +  F+I + I L+NL++G+AVGDI  +   A +    +Q+   +  E  LP
Sbjct:   49 NFNKQKKLKRCDDMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILAT-------ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPY-GLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQ-DISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLL-LKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQC-PLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMA----FNSTGIINETSDHSEILDTTNSYLIKTCMILVFLSSIFGYCK---EAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIP-AHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLP 991          

HSP 2 Score: 105.531 bits (262), Expect = 2.750e-22
Identity = 115/475 (24.21%), Postives = 194/475 (40.84%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDG-----------------------------------------MCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHL------GIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGH 1549
            LH A      E ++F+LS+  N N ++      L +AV+  N E ++++ + + ++++ +   G T + +AC  N  + ++ILL  GA P KS   G                                            LH  +++  LEMIK+ L      +  +    + I  AA+ G  E   L I S   S      ++N+TD    +    A  +    +    +  GADIN   +EG++ L +A+      I+  L   G  ++  DN   + LHL      G+ N      +   +    ++  N    TPL  +        V   L F       N  +  K K K++ LH   + G I T + L Q I +     LLN  D +G  PLH+A  N   K+   L+ +GA L L ++N    +H A+  G+ + +K ++D N++     +ED    +  A + GH
Sbjct:  102 LHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGS----VDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDG-CTPLHYACRQGGPGSVNNLLGF-------NVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTR---LLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGH 560          

HSP 3 Score: 69.3218 bits (168), Expect = 3.656e-11
Identity = 66/277 (23.83%), Postives = 124/277 (44.77%), Query Frame = 2
Query:  263 LLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACR------------LNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN-INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHV 1054
            +LH A++  + EL ++++S   +INK   +G + L+LA  S +   V L+   KG ++D +D  G+  + L  +            + M  I +++       M  + DG   LH+  R      +  LL    S   K  +  SP+  AAS G +      +Q + ++++     +N  D  G +    A +     ++   LK GA + L+ + G  ALH AS  G+++ +  + D  +   + +D + ++ALH     G       LL ++A +
Sbjct:  312 MLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLL-SKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELV-------MDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRL-----LNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADI 574          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 169.859 bits (429), Expect = 1.883e-42
Identity = 202/903 (22.37%), Postives = 383/903 (42.41%), Query Frame = 2
Query:  407 LICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLH--------AKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEF---RFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSAS-------VNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIM-----SMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAK--VKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFK---IFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            ++ + + ++++ +   G T + +AC  N  + ++ILL  GA P KS   G   +H    S   E ++++L          +      +N   +P+ LA   G LE                                         +I  CL  GA I+  +     A+H A+  G +EI+  +  +      + N  D      +H  SL     +A+ L+   A +N  +    +PL+ +           S   + LLL+  A V +KD   +  LHL +   +     L  + ++ ++ + L+   D++G  PLH AC        N L+    ++   + ++  P+H A   G +   + L+  +I    + NE + + +    LA ++GH  + + L  K   +   D  G   L +A   G    +K+IL  +     R +   +T LH AA+ G  K V  LLS  A++  N    + L LAL N+        +    W   ++         K  +  +I    +    LL+  +   ++  S      +Y+F  L   P +          +    T    + +  + +L+ HP+    LL KW  +G    M +L ++   L   T ++ +  P +A    +++ G   + S  +++   T+S +    ++     S+FG+ +   E+ +   QK  YF   SN +  ++Y++ I F     V+ P   +QW  G IA+   W N + YLQ   N GI I+M + ++ ++++  ++F+ L++ + ++FYI+   Q PF +   S  + + M++G+++Y   FL+P  +       +    +  F+I + I L+NL++G+AVGDI  +   A +    +Q+   +  E  LP
Sbjct:    1 VLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLE-----------------------------------------MIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILAT-------ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPY-GLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQ-DISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLL-LKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQC-PLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMA----FNSTGIINETSDHSEILDTTNSYLIKTCMILVFLSSIFGYCK---EAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIP-AHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLP 843          

HSP 2 Score: 96.2857 bits (238), Expect = 1.927e-19
Identity = 106/421 (25.18%), Postives = 183/421 (43.47%), Query Frame = 2
Query:  329 NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEY-------DGMCC-LHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHL------GIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGH 1549
            ++N +   G+TA+++A  + N+E ++++ K KG +    ++ G  PI  A      + ++I+L +G     S         +G    LH  +++  LEMIK+ L      +  +    + I  AA+ G  E   L I S   S      ++N+TD    +    A  +    +    +  GADIN   +EG++ L +A+      I+  L   G  ++  DN   + LHL      G+ N      +   +    ++  N    TPL  +        V   L F       N  +  K K K++ LH   + G I T + L Q I +     LLN  D +G  PLH+A  N   K+   L+ +GA L L ++N    +H A+  G+ + +K ++D N++     +ED    +  A + GH
Sbjct:    9 DVNLEGENGNTAVIIACTTNNSEALQILLK-KGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGS----VDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDG-CTPLHYACRQGGPGSVNNLLGF-------NVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTR---LLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGH 412          

HSP 3 Score: 68.1662 bits (165), Expect = 7.651e-11
Identity = 66/278 (23.74%), Postives = 124/278 (44.60%), Query Frame = 2
Query:  260 NLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACR------------LNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN-INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHV 1054
             +LH A++  + EL ++++S   +INK   +G + L+LA  S +   V L+   KG ++D +D  G+  + L  +            + M  I +++       M  + DG   LH+  R      +  LL    S   K  +  SP+  AAS G +      +Q + ++++     +N  D  G +    A +     ++   LK GA + L+ + G  ALH AS  G+++ +  + D  +   + +D + ++ALH     G       LL ++A +
Sbjct:  163 TMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLL-SKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELV-------MDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRL-----LNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADI 426          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 169.474 bits (428), Expect = 4.686e-42
Identity = 139/510 (27.25%), Postives = 232/510 (45.49%), Query Frame = 2
Query:  257 FNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE 1786
            F  LH AA   N  +   +L++   ++  +  G T L +A K GN   V+L+   +G +ID + R G TP+  A R     +V++LL  GA  +    +G+  LH   + +H+E +K LL  K   +    + ++ + +AA  G+     L +    N      S +       +   LN        I+L  L+ GA  ++    G+ ALH+A+  G  E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  SA        E  +    +LL   A   L  KK  T LH+    G ++  +LL Q      ++   +S   NG  PLH+A   N  +I + L++ GA   +       P+H A+++GH ++V  L+D     I +  +     + LA Q    N+ + L     +  +  + G   L+ AC  G++ MV  +LK+  N+  +  +  TPLHQAAQ G T ++  LL  GA+
Sbjct:  189 FTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLL-DRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLN--------IVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAR-------EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ------RRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGAN-IHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAK 675          

HSP 2 Score: 132.109 bits (331), Expect = 1.561e-30
Identity = 150/600 (25.00%), Postives = 255/600 (42.50%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGA---EMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRGLEVISDTNSVNKSLTKYHF 2038
            N  N LH AA   +  L++ +L +  +++  + KG+TAL +A  +G AE V+++ K+ G  I+ Q + G TP+ +A + N ID+VK LL  GAN   +  DG   L   ++  H + + +LL      +V+    +  + +AA     ++  L +Q+  N+ +   S        G++    A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G   V E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   +G  P+HVA       I   L+  GA+  + N      +H A R G +E+V+ L+  N   +  R  +E   + +A + G   I + L        +    G   L  + + G + +  ++L+      +      TPLH AA+ G   + + LL   A      +N +  TPL +A        A   LN     N +    K G T +     +   D+   LL++G  +   T S    LT  H 
Sbjct:   26 NGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKE-GANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKS--------GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPL----HMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR-NGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGY--TPLHIAAKKNQMQIASTLLNYGAETNIVT---KQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKS---GLTSLHL 590          

HSP 3 Score: 112.464 bits (280), Expect = 1.933e-24
Identity = 127/530 (23.96%), Postives = 217/530 (40.94%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL----------CDNG---ININSVDNNLDSA--------------------LHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLF-----------------QLIKEEEK---QFLLNSYDDNGDY-------PLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMV 1660
            N    LH A+   N  +++ +L +   I+ K+  G T L  A +SG+ + V L+  ++G  +  + + G +P+ +A + + ++ VK LL + A       D +  LH      H  + KLLL  + +P  +  +G++PI +AA +G+L    L +Q+  +  +        T+  G +    A R  Q  ++   L+ GA ++    E +  LHIAS +G +EI+  L            NG   ++I++ +  +D A                    LH+    GSL VA+ LL   A  +   +N  TPL  +A   +Q+ +  +L      LN  A+  +  K+  T LHL    GH + + LL                   L  +E+K     +L  +  + D        PL VAC     K+ N+L+ +GAN+     N   P+H+A                                   Q GH +I   L     + ++    GN  L  A ++G I +V
Sbjct:  220 NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL-ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDV--------TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKK-NQMQIASTL------LNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQA----------------------------------AQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVV 699          

HSP 4 Score: 97.8265 bits (242), Expect = 7.311e-20
Identity = 122/501 (24.35%), Postives = 218/501 (43.51%), Query Frame = 2
Query:  374 AVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIR--YKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFL 1867
            A ++GN + V    K  G++I+  ++ G   + LA +   + +V+ LL  G++   +   G   LH    +   E++K+L+    +   +  NG +P+ +AA   +++     ++ L+ +  N ++       +G++    A++  + Q   IL        + L       ALHIA+    ++    L  N  N +    +  + LH+  H G+++VA  LL   A V+   RN +TPL    ++ S+ G   +   +KLLL+    +  K +   T LH    SGH + +ELL       E+   L +   NG  PLH+A   +  +   +L+   A +     +    +H A   GH  + K L+D        R       I +A   GH NI   L          +  G   L  A + G + +V+ +L+    +  R   + TPLH A++ G+T++V+ LL   A     T +  TPL ++      + A V L
Sbjct:    1 AARAGNLDKVVEYLK-GGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHID----VVKYLLENGANQSTATE----DGFTPLAVALQQGHNQAVAILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPL----HVASKRG---NTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL------ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANP-NARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL 472          

HSP 5 Score: 91.6633 bits (226), Expect = 5.298e-18
Identity = 99/396 (25.00%), Postives = 167/396 (42.17%), Query Frame = 2
Query:  797 AIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ---------------LIKEEEKQ-FLLNSYDDNGDY-------PLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKT 1912
            A R      ++E LK G DIN     G NALH+A++ G   ++ +L   G +++S     ++ALH+    G   V + L+   A++N  ++N  TPL  +A        E  +  +K LL N A+     +   T L + +  GH + + +L +                 K++ K   LL   D N D        PLH+A       +   L++ GA +     N   P+H A+++G+  +VK L+D    QI  +  D    +  A +SGH  + E L  +   + ++ + G + L  A Q   +  VK +L+    +        T LH AA  G  ++ + LL   A          TP+ +A    H N   + L +    +    R +T
Sbjct:    1 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQ-------ENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRG-GQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGET 388          

HSP 6 Score: 67.0106 bits (162), Expect = 1.890e-10
Identity = 61/260 (23.46%), Postives = 106/260 (40.77%), Query Frame = 2
Query:  242 HPN----NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAAS----------------------LGYLEAFYLCIQS---LMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL 934
            HP+    N +  LH +A     ++   +L      +  + KG T L +A K G+ +  +L+ +++    D   + G TP+ +A + N + I   LL YGA        G+  LH   +  H +M+ LLL    +  +   +G++ + LAA                       LGY      C      ++N  +   + +N+    GY+    A +     II   L++GA  N     G  AL IA  +G+  ++  L
Sbjct:  444 HPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 702          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 169.859 bits (429), Expect = 7.639e-42
Identity = 135/512 (26.37%), Postives = 234/512 (45.70%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE 1786
            N    LH A+   N  +++ +L +   I+ K+  G T L  A +SG+ + V L+  ++G  +  + + G +P+ +A + + ++ VK LL + A       D +  LH      H  + KLLL  + +P  +  NG +P+ +A     ++   L ++   + +    S +       +   LN        I+L  L+ GA  ++    G+ ALH+A+  G  E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  SA    Q+ V   L      L   A   L  KK  T LH+    G ++  +LL Q      ++   +S   NG  PLH+A   N  +I + L++ GA   +       P+H A+++GH ++V  L+D     I +  +     + LA Q    N+ + L     +  +  + G   L+ AC  G++ MV  +LK+  N+  +  +  TPLHQAAQ G T ++  LL  GA+
Sbjct:  236 NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL-ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLN--------IVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE-GQVDVASVL------LEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ------RRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKG-ANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAK 724          

HSP 2 Score: 155.221 bits (391), Expect = 2.513e-37
Identity = 165/607 (27.18%), Postives = 268/607 (44.15%), Query Frame = 2
Query:  230 IDENHPN-NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRGLEVISDTNSVNKS-LTKYHF 2038
            ID N  N N  N LH AA   +  L++ +L +  +++  + KG+TAL +A  +G AE V+++ K+ G  I+ Q + G TP+ +A + N ID+VK LL  GAN   +  DG   L   ++  H + + +LL      +V+    +  + +AA     ++  L +Q+  N+ +   S        G++    A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G   V E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   NG  PLH+AC  N  K+   L+  GA++     +   PIH A   GHL IV  L+  N     + N      + +A ++G   +   L      + ++       L  A ++G   +V+L+L+   +      +  TPLH +A+ GQ  +   LL  GA     T    TPL +A      + AK+ L      ++     K G T +     KN+  IA+ LLN G E    TN V K  +T  H 
Sbjct:   34 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKE-GANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKS--------GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPL----HMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAG---KNGYTPLHIAAKKNQMQIASTLLNYGAE----TNIVTKQGVTPLHL 606          

HSP 3 Score: 114.39 bits (285), Expect = 7.843e-25
Identity = 112/465 (24.09%), Postives = 192/465 (41.29%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMV 1660
            LH AA   +  + + +L K+ N N ++  G T L +A K    + + L+ K  G  I      G TPI +A  +  ++IV +LL  GA+P  +   G   LH   R+  +E+++ LL      + +     +P+ +A+ LG  E   L +Q + +         ++    GY+    + R  Q  +    L+ GA  +LA  +G   LH+A++ G  ++   L       +S   N  + LH+      + +A  LL   A  N+  +  +TPL    +L SQ G    +  L   L+  A++ +  K   T LHL      +   ++L +   +++    L      G  PL VAC     K+ N+L+ +GAN+     N   P+H+A                                   Q GH +I   L     + ++    GN  L  A ++G I +V
Sbjct:  340 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY-GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHP--------DAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPL----HLASQEGHTDMVTLL---LDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKL------GYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAA----------------------------------QQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVV 748          

HSP 4 Score: 99.7525 bits (247), Expect = 2.663e-20
Identity = 108/440 (24.55%), Postives = 182/440 (41.36%), Query Frame = 2
Query:  782 SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ---------------LIKEEEKQ-FLLNSYDDNGDY-------PLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG----------------NNILMYACQVGDIGM-----------------VKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMG 1930
            + FL A R      ++E LK G DIN     G NALH+A++ G   ++ +L   G +++S     ++ALH+    G   V + L+   A++N  ++N  TPL  +A        E  +  +K LL N A+     +   T L + +  GH + + +L +                 K++ K   LL   D N D        PLH+A       +   L++ GA +     N   P+H A+++G+  +VK L+D    QI  +  D    +  A +SGH  + E L  +   + ++ + G                 ++L +   V D+ +                  KL+L K  N   R  +  TPLH A +  + K++E L+  GA +   T    TP+ +A    H N   + L +    +    R +T   HM 
Sbjct:   12 ASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQ-------ENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRG-GQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA-LHMA 442          

HSP 5 Score: 99.3673 bits (246), Expect = 3.318e-20
Identity = 120/494 (24.29%), Postives = 219/494 (44.33%), Query Frame = 2
Query:  356 STALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIR--YKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTF-HQTPLTLA 1828
            + + L A ++GN + V    K  G++I+  ++ G   + LA +   + +V+ LL  G++   +   G   LH    +   E++K+L+    +   +  NG +P+ +AA   +++     ++ L+ +  N ++       +G++    A++  + Q   IL        + L       ALHIA+    ++    L  N  N +    +  + LH+  H G+++VA  LL   A V+   RN +TPL    ++ S+ G   +   +KLLL+    +  K +   T LH    SGH + +ELL       E+   L +   NG  PLH+A   +  +   +L+   A +     +    +H A   GH  + K L+D        R  +    + +A +     + E L      + +  E+G   +  A  +G + +V L+L+   +  + N    T LH AA+AGQ ++V  LL  GA +       QTPL +A
Sbjct:   11 NASFLRAARAGNLDKVVEYLK-GGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDV----VKYLLENGANQSTATE----DGFTPLAVALQQGHNQAVAILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPL----HVASKRG---NTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL------ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANP-NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIA 475          

HSP 6 Score: 68.5514 bits (166), Expect = 7.661e-11
Identity = 61/260 (23.46%), Postives = 106/260 (40.77%), Query Frame = 2
Query:  242 HPN----NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAAS----------------------LGYLEAFYLCIQ---SLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL 934
            HP+    N +  LH +A     ++   +L      +  + KG T L +A K G+ +  +L+ +++    D   + G TP+ +A + N + I   LL YGA        G+  LH   +  H +M+ LLL    +  +   +G++ + LAA                       LGY      C      ++N  +   + +N+    GY+    A +     II   L++GA  N     G  AL IA  +G+  ++  L
Sbjct:  493 HPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAA-DSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 751          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 169.859 bits (429), Expect = 7.643e-42
Identity = 135/512 (26.37%), Postives = 234/512 (45.70%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE 1786
            N    LH A+   N  +++ +L +   I+ K+  G T L  A +SG+ + V L+  ++G  +  + + G +P+ +A + + ++ VK LL + A       D +  LH      H  + KLLL  + +P  +  NG +P+ +A     ++   L ++   + +    S +       +   LN        I+L  L+ GA  ++    G+ ALH+A+  G  E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  SA    Q+ V   L      L   A   L  KK  T LH+    G ++  +LL Q      ++   +S   NG  PLH+A   N  +I + L++ GA   +       P+H A+++GH ++V  L+D     I +  +     + LA Q    N+ + L     +  +  + G   L+ AC  G++ MV  +LK+  N+  +  +  TPLHQAAQ G T ++  LL  GA+
Sbjct:  244 NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL-ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLN--------IVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE-GQVDVASVL------LEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ------RRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKG-ANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAK 732          

HSP 2 Score: 163.696 bits (413), Expect = 6.714e-40
Identity = 166/607 (27.35%), Postives = 271/607 (44.65%), Query Frame = 2
Query:  230 IDENHPN-NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRGLEVISDTNSVNKS-LTKYHF 2038
            ID N  N N  N LH AA   +  L++ +L +  +++  + KG+TAL +A  +G AE V+++ K+ G  I+ Q + G TP+ +A + N ID+VK LL  GAN   +  DG   L   ++  H + + +LL      +V+    +  + +AA     ++  L +Q+  N+ +    ++N T   G++    A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G   V E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   NG  PLH+AC  N  K+   L+  GA++     +   PIH A   GHL IV  L+  N     + N      + +A ++G   +   L      + ++       L  A ++G   +V+L+L+   +      +  TPLH +A+ GQ  +   LL  GA     T    TPL +A      + AK+ L      ++     K G T +     KN+  IA+ LLN G E    TN V K  +T  H 
Sbjct:   34 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKE-GANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPL----HMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAG---KNGYTPLHIAAKKNQMQIASTLLNYGAE----TNIVTKQGVTPLHL 614          

HSP 3 Score: 114.39 bits (285), Expect = 7.846e-25
Identity = 112/465 (24.09%), Postives = 192/465 (41.29%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMV 1660
            LH AA   +  + + +L K+ N N ++  G T L +A K    + + L+ K  G  I      G TPI +A  +  ++IV +LL  GA+P  +   G   LH   R+  +E+++ LL      + +     +P+ +A+ LG  E   L +Q + +         ++    GY+    + R  Q  +    L+ GA  +LA  +G   LH+A++ G  ++   L       +S   N  + LH+      + +A  LL   A  N+  +  +TPL    +L SQ G    +  L   L+  A++ +  K   T LHL      +   ++L +   +++    L      G  PL VAC     K+ N+L+ +GAN+     N   P+H+A                                   Q GH +I   L     + ++    GN  L  A ++G I +V
Sbjct:  348 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY-GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHP--------DAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPL----HLASQEGHTDMVTLL---LDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKL------GYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAA----------------------------------QQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVV 756          

HSP 4 Score: 99.3673 bits (246), Expect = 3.024e-20
Identity = 104/448 (23.21%), Postives = 185/448 (41.29%), Query Frame = 2
Query:  782 SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ--------------------------LIKEE-----EKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG----------------NNILMYACQVGDIGM-----------------VKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMG 1930
            + FL A R      ++E LK G DIN     G NALH+A++ G   ++ +L   G +++S     ++ALH+    G   V + L+   A++N  ++N  TPL  +A        E  +  +K LL N A+     +   T L + +  GH + + +L +                          L++ +     + + ++N   ++G  PLH+A       +   L++ GA +     N   P+H A+++G+  +VK L+D    QI  +  D    +  A +SGH  + E L  +   + ++ + G                 ++L +   V D+ +                  KL+L K  N   R  +  TPLH A +  + K++E L+  GA +   T    TP+ +A    H N   + L +    +    R +T   HM 
Sbjct:   12 ASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQ-------ENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRG-GQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA-LHMA 450          

HSP 5 Score: 96.2857 bits (238), Expect = 2.656e-19
Identity = 121/502 (24.10%), Postives = 220/502 (43.82%), Query Frame = 2
Query:  356 STALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIR--YKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN--------INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTF-HQTPLTLA 1828
            + + L A ++GN + V    K  G++I+  ++ G   + LA +   + +V+ LL  G++   +   G   LH    +   E++K+L+    +   +  NG +P+ +AA   +++     ++ L+ +  N ++       +G++    A++  + Q   IL        + L       ALHIA+    ++    L  N  N        +N    +  + LH+  H G+++VA  LL   A V+   RN +TPL    ++ S+ G   +   +KLLL+    +  K +   T LH    SGH + +ELL       E+   L +   NG  PLH+A   +  +   +L+   A +     +    +H A   GH  + K L+D        R  +    + +A +     + E L      + +  E+G   +  A  +G + +V L+L+   +  + N    T LH AA+AGQ ++V  LL  GA +       QTPL +A
Sbjct:   11 NASFLRAARAGNLDKVVEYLK-GGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDV----VKYLLENGANQSTATE----DGFTPLAVALQQGHNQAVAILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPL----HVASKRG---NTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL------ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANP-NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIA 483          

HSP 6 Score: 68.5514 bits (166), Expect = 7.662e-11
Identity = 61/260 (23.46%), Postives = 106/260 (40.77%), Query Frame = 2
Query:  242 HPN----NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAAS----------------------LGYLEAFYLCIQ---SLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL 934
            HP+    N +  LH +A     ++   +L      +  + KG T L +A K G+ +  +L+ +++    D   + G TP+ +A + N + I   LL YGA        G+  LH   +  H +M+ LLL    +  +   +G++ + LAA                       LGY      C      ++N  +   + +N+    GY+    A +     II   L++GA  N     G  AL IA  +G+  ++  L
Sbjct:  501 HPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAA-DSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 759          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Celegans
Match: trpa-1 (Transient receptor potential cation channel subfamily A member 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18297])

HSP 1 Score: 182.185 bits (461), Expect = 1.820e-46
Identity = 232/1106 (20.98%), Postives = 454/1106 (41.05%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKP-NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRL--NMIDIVKILLYYGANPMK-----------------SEYD-----GMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIA-------SVINSTDCEGYSCFL---------------NAIRYKQRTIILECLKYGADINLA---QNEGKNA----------LHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHA-HVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLF-----------------------QLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTM---------EFRFKTG---KTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLD--------------------AGPYD-----SASVNSRYTEFMTIAKYRKEKLIL---------HPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIA--------DSPDYD-NQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCT------IQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYF----LDPGFKIF----TAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQ-----AKFYEPVFVYKQMRRSVFQRFFS 3088
            +N  +++H++A   N   L+  L K P  +N +     T L  A + GN + V+L+  +  +  + ++R+G TP+ +A +      DI  I+    A+  +                 +E D      +  LH+    ++   +  L+  K   + +D+N ++P+ LA   G  E     IQ L+ +  N+        +V +     G   +L               N    +++T +   ++      L    Q E KN+          +H A+E G+ E++  L + G N N ++      LH+      L V   L+     +++V +   LTPL+ +    S+  VE  +A         A++ + DK ++T + +      + ++E +                        +++ E+ ++ ++N  D + + P+H+  SN   ++   L   GA++   N +E   +H A   G    V+ L++ +I+ + +++E   + + LA +SGH    + L     +  +K+      L  A   G +   + ++ K   ++  +    T LH AA  G   +V Y ++ G  +   +   +T   +A +N H + A+ FL  + WKN M         + R       +T    ++ K  ++A+ +++  +E   +     +S+  Y+F  LD                       YD          S  + +  + KY   KL+          HPLS  LL  KW R G   +   L  +L ++   T  + H   P          DS  +D N+ CP  N+        T  ++    I+      +++ E  +   +K  Y     N++   +YS+A+       +   T       QW    + I   W N++F ++ +P FGI ++MF ++V +  +   +F+  +I ++ +FY++ +N+  F   + S  K   M+IGE ++   F         K+F    TA+   L   F I+++I L+NL+VG+AV DI  +   A++    +Q+  + + E+ L   +Q     A      F Y ++ ++ F  ++S
Sbjct:   48 DNLRSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALP-NTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLACVHGSQE----IIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIA-------KKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIE-SSSDTKTVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCIEKSKEETDSTQSVA-YNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLTQYVRHTKAPYNVWNEESYYDSEYFDENETCPQINT--------TKPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQRTKKYATCRYATFPYGKLHKTGFAGWWS 1131          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Celegans
Match: trpa-1 (Transient receptor potential cation channel subfamily A member 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18297])

HSP 1 Score: 182.185 bits (461), Expect = 2.052e-46
Identity = 232/1106 (20.98%), Postives = 454/1106 (41.05%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKP-NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRL--NMIDIVKILLYYGANPMK-----------------SEYD-----GMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIA-------SVINSTDCEGYSCFL---------------NAIRYKQRTIILECLKYGADINLA---QNEGKNA----------LHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHA-HVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLF-----------------------QLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTM---------EFRFKTG---KTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLD--------------------AGPYD-----SASVNSRYTEFMTIAKYRKEKLIL---------HPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIA--------DSPDYD-NQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCT------IQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYF----LDPGFKIF----TAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQ-----AKFYEPVFVYKQMRRSVFQRFFS 3088
            +N  +++H++A   N   L+  L K P  +N +     T L  A + GN + V+L+  +  +  + ++R+G TP+ +A +      DI  I+    A+  +                 +E D      +  LH+    ++   +  L+  K   + +D+N ++P+ LA   G  E     IQ L+ +  N+        +V +     G   +L               N    +++T +   ++      L    Q E KN+          +H A+E G+ E++  L + G N N ++      LH+      L V   L+     +++V +   LTPL+ +    S+  VE  +A         A++ + DK ++T + +      + ++E +                        +++ E+ ++ ++N  D + + P+H+  SN   ++   L   GA++   N +E   +H A   G    V+ L++ +I+ + +++E   + + LA +SGH    + L     +  +K+      L  A   G +   + ++ K   ++  +    T LH AA  G   +V Y ++ G  +   +   +T   +A +N H + A+ FL  + WKN M         + R       +T    ++ K  ++A+ +++  +E   +     +S+  Y+F  LD                       YD          S  + +  + KY   KL+          HPLS  LL  KW R G   +   L  +L ++   T  + H   P          DS  +D N+ CP  N+        T  ++    I+      +++ E  +   +K  Y     N++   +YS+A+       +   T       QW    + I   W N++F ++ +P FGI ++MF ++V +  +   +F+  +I ++ +FY++ +N+  F   + S  K   M+IGE ++   F         K+F    TA+   L   F I+++I L+NL+VG+AV DI  +   A++    +Q+  + + E+ L   +Q     A      F Y ++ ++ F  ++S
Sbjct:   47 DNLRSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALP-NTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLACVHGSQE----IIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIA-------KKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIE-SSSDTKTVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCIEKSKEETDSTQSVA-YNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLTQYVRHTKAPYNVWNEESYYDSEYFDENETCPQINT--------TKPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQRTKKYATCRYATFPYGKLHKTGFAGWWS 1130          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 162.925 bits (411), Expect = 4.270e-40
Identity = 137/522 (26.25%), Postives = 239/522 (45.79%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFH-QTPLTLA 1828
            LH AA S + ++++ ++ +   I+ K+  G   L +A +  + +  R +   +   +D       TP+ +A     + + K+LL   A+P     +G   LH   + N +++++LLL  + + E    +G++P+ +AA +G +      +Q   N  +            G +    A R  Q  ++   ++ GA ++    E +  LHIAS +G ++I+  L   G N N+   +  S LH+    G   VA  LL ++A   +  +   TPL    +L S+ G   +L  ++LLL     V ++ K + T LH+   + H    ++   L+   E      +   NG  PLH+A   N  +I + L+   A+    +     P+H + ++GH EI   LI+ N   +  +  +    + L  Q  H  + + LY    E++SK   G   L  AC  G + MVK +++   ++  +     TPLHQAAQ G    V YLL  GA   E T   QTPL++A
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETV--------RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPL----HLASKYG---NLEVVRLLLERGTPVDIEGKNQVTPLHV---AAHYNNDKVAMLLL---ENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIE-NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 125.946 bits (315), Expect = 9.973e-29
Identity = 132/544 (24.26%), Postives = 233/544 (42.83%), Query Frame = 2
Query:  275 AAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASV---------------------INSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLID--LNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE---MYENTFHQTPLTLA 1828
            AA + + E +  +L    +IN  +  G  +L LA K G++E VR + K++  ++D   RKG T + +A       IV IL+  GAN      +G   L+   + NH E++K LL    +  +   +G +P+A+A   G+     + +++    K+ + ++                      + T   G++    A  Y    +    L+ GA++N       + LH+A++ G + +   L   G  I+S   +L + LH    +G   V + L+V  A ++   +N L PL  +A     +   ++L + +      A V        T LH+    GH+   +LL       ++    NS   NG  PLH+AC  N  K+   L+   A +     +   P+H A   G + IV  L+    N    T+R E   +   LA ++   ++   L     ++ ++       L  A ++G+  +V L+L+   N         +PLH AA+ GQ ++   LL   A+   + +  F  TPL LA
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQA-QVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQG-DHVDAARTLLYHR------APVDDVTVDYLTPLHVAAHCGHVRVAKLLL------DRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLH---LAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLA 564          

HSP 3 Score: 95.5153 bits (236), Expect = 2.093e-19
Identity = 126/536 (23.51%), Postives = 209/536 (38.99%), Query Frame = 2
Query:  773 EGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ--------------LIKEEEKQ----FLLNSYD-----DNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG---------------NNILMY------------------ACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRGLEVISDTNSVNKSL--------TKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEK----LILHPLSNMLLLNK 2170
            EG + FL A R      +LE L+ G DIN +   G N+LH+AS+ G SE++ +L      +++     ++ALH+    G   +   L+ N A+VNV + N  TPL  +A        E     +K LL + A+  L  +   T L + +  GH   + +L +                K+++       L N ++      +G  PLH+A       +   L+ +GAN+     +   P+H AT+ G   +   L+      I  R +D    +  A +SGH  + + L  +   + +K + G                  L+Y                  A   G + + KL+L +  +   R  +  TPLH A +  + K+VE LL   A +   T    TPL +A      N     L      +    R   G+T +      N+ D+   L+  G +V +    +   L        T     +L AG   +A+    Y+     AK  +E+    L+ H     LL  K
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-------ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRG-AIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK 556          

HSP 4 Score: 89.7373 bits (221), Expect = 1.125e-17
Identity = 115/480 (23.96%), Postives = 188/480 (39.17%), Query Frame = 2
Query:  614 LHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFL------------------KXXXXXXADVKLKD--------KKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNE---------------DEANLII------------------LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLALDNQHWNTAKVFLND 1873
            + A  +PE     G +    AA  G LE     +++         + IN+++  G +    A +     ++ E +K  A ++ A  +G  ALHIAS  G S I+  L +NG N+N    N  + L++        V + LL + A+  +   +  TPL  +     Q G ++ +A L                  K      A + L++        K   T LH+    GH    +LL       EK   +N    +   PLHVA       + N L+S GA +     +   P+H A R GH ++V DL+ +    I+ + +               D A  ++                  +A   GH  + + L  +  + +S+   G   L  AC+   I +V+L+LK    ++       TPLH AA  G   +V YLL  GA    E    +TPL LA      +  +V + +
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRA--------GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVAL----QQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLL------EKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVV-DLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN 480          

HSP 5 Score: 87.0409 bits (214), Expect = 7.266e-17
Identity = 74/286 (25.87%), Postives = 120/286 (41.96%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGY---------------------LEAFYLCIQS----LMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECL 1033
            + ++ LH AA     E+   +L    +    + KG T L LA K GN E VRL+  ++G  +D + +   TP+ +A   N   +  +LL  GA+   +  +G   LH   + N +E+   LL  K  P  K   G +P+ L+A  G+                     L A +LC Q     +     N  + INS    GY+    A  + Q  ++   ++ GAD+          LH A++ G +  +  L +NG + N       + L +    G +SV E L
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL-ERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 162.925 bits (411), Expect = 4.270e-40
Identity = 137/522 (26.25%), Postives = 239/522 (45.79%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFH-QTPLTLA 1828
            LH AA S + ++++ ++ +   I+ K+  G   L +A +  + +  R +   +   +D       TP+ +A     + + K+LL   A+P     +G   LH   + N +++++LLL  + + E    +G++P+ +AA +G +      +Q   N  +            G +    A R  Q  ++   ++ GA ++    E +  LHIAS +G ++I+  L   G N N+   +  S LH+    G   VA  LL ++A   +  +   TPL    +L S+ G   +L  ++LLL     V ++ K + T LH+   + H    ++   L+   E      +   NG  PLH+A   N  +I + L+   A+    +     P+H + ++GH EI   LI+ N   +  +  +    + L  Q  H  + + LY    E++SK   G   L  AC  G + MVK +++   ++  +     TPLHQAAQ G    V YLL  GA   E T   QTPL++A
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETV--------RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPL----HLASKYG---NLEVVRLLLERGTPVDIEGKNQVTPLHV---AAHYNNDKVAMLLL---ENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIE-NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 125.946 bits (315), Expect = 9.973e-29
Identity = 132/544 (24.26%), Postives = 233/544 (42.83%), Query Frame = 2
Query:  275 AAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASV---------------------INSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLID--LNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE---MYENTFHQTPLTLA 1828
            AA + + E +  +L    +IN  +  G  +L LA K G++E VR + K++  ++D   RKG T + +A       IV IL+  GAN      +G   L+   + NH E++K LL    +  +   +G +P+A+A   G+     + +++    K+ + ++                      + T   G++    A  Y    +    L+ GA++N       + LH+A++ G + +   L   G  I+S   +L + LH    +G   V + L+V  A ++   +N L PL  +A     +   ++L + +      A V        T LH+    GH+   +LL       ++    NS   NG  PLH+AC  N  K+   L+   A +     +   P+H A   G + IV  L+    N    T+R E   +   LA ++   ++   L     ++ ++       L  A ++G+  +V L+L+   N         +PLH AA+ GQ ++   LL   A+   + +  F  TPL LA
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQA-QVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQG-DHVDAARTLLYHR------APVDDVTVDYLTPLHVAAHCGHVRVAKLLL------DRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLH---LAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLA 564          

HSP 3 Score: 95.5153 bits (236), Expect = 2.093e-19
Identity = 126/536 (23.51%), Postives = 209/536 (38.99%), Query Frame = 2
Query:  773 EGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ--------------LIKEEEKQ----FLLNSYD-----DNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG---------------NNILMY------------------ACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRGLEVISDTNSVNKSL--------TKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEK----LILHPLSNMLLLNK 2170
            EG + FL A R      +LE L+ G DIN +   G N+LH+AS+ G SE++ +L      +++     ++ALH+    G   +   L+ N A+VNV + N  TPL  +A        E     +K LL + A+  L  +   T L + +  GH   + +L +                K+++       L N ++      +G  PLH+A       +   L+ +GAN+     +   P+H AT+ G   +   L+      I  R +D    +  A +SGH  + + L  +   + +K + G                  L+Y                  A   G + + KL+L +  +   R  +  TPLH A +  + K+VE LL   A +   T    TPL +A      N     L      +    R   G+T +      N+ D+   L+  G +V +    +   L        T     +L AG   +A+    Y+     AK  +E+    L+ H     LL  K
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-------ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRG-AIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK 556          

HSP 4 Score: 89.7373 bits (221), Expect = 1.125e-17
Identity = 115/480 (23.96%), Postives = 188/480 (39.17%), Query Frame = 2
Query:  614 LHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFL------------------KXXXXXXADVKLKD--------KKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNE---------------DEANLII------------------LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLALDNQHWNTAKVFLND 1873
            + A  +PE     G +    AA  G LE     +++         + IN+++  G +    A +     ++ E +K  A ++ A  +G  ALHIAS  G S I+  L +NG N+N    N  + L++        V + LL + A+  +   +  TPL  +     Q G ++ +A L                  K      A + L++        K   T LH+    GH    +LL       EK   +N    +   PLHVA       + N L+S GA +     +   P+H A R GH ++V DL+ +    I+ + +               D A  ++                  +A   GH  + + L  +  + +S+   G   L  AC+   I +V+L+LK    ++       TPLH AA  G   +V YLL  GA    E    +TPL LA      +  +V + +
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRA--------GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVAL----QQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLL------EKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVV-DLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN 480          

HSP 5 Score: 87.0409 bits (214), Expect = 7.266e-17
Identity = 74/286 (25.87%), Postives = 120/286 (41.96%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGY---------------------LEAFYLCIQS----LMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECL 1033
            + ++ LH AA     E+   +L    +    + KG T L LA K GN E VRL+  ++G  +D + +   TP+ +A   N   +  +LL  GA+   +  +G   LH   + N +E+   LL  K  P  K   G +P+ L+A  G+                     L A +LC Q     +     N  + INS    GY+    A  + Q  ++   ++ GAD+          LH A++ G +  +  L +NG + N       + L +    G +SV E L
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL-ERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 159.073 bits (401), Expect = 4.484e-39
Identity = 137/522 (26.25%), Postives = 239/522 (45.79%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTF-HQTPLTLA 1828
            LH AA S + ++++ ++ +   I+ K+  G   L +A +  + +  R +   +   +D       TP+ +A     + + K+LL   A+P     +G   LH   + N +++++LLL  + + E    +G++P+ +AA +G +      +Q   N  +            G +    A R  Q  ++   ++ GA ++    E +  LHIAS +G ++I+  L   G N N+   +  S LH+    G   VA  LL ++A   +  +   TPL    +L S+ G   +L  ++LLL     V ++ K + T LH+   + H    ++   L+   E      +   NG  PLH+A   N  +I + L+   A+    +     P+H + ++GH EI   LI+ N   +  +  +    + L  Q  H  + + LY    E++SK   G   L  AC  G + MVK +++   ++  +     TPLHQAAQ G    V YLL  GA   E T   QTPL++A
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--------VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPL----HLASKYG---NLEVVRLLLERGTPVDIEGKNQVTPLHV---AAHYNNDKVAMLLL---ENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIE-NGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 122.094 bits (305), Expect = 1.210e-27
Identity = 129/532 (24.25%), Postives = 227/532 (42.67%), Query Frame = 2
Query:  311 ILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASV---------------------INSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLID--LNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE---MYENTFHQTPLTLA 1828
            +L    +IN  +  G  +L LA K G++E VR + K++  ++D   RKG T + +A       IV IL+  GAN      +G   L+   + NH E++K LL    +  +   +G +P+A+A   G+     + +++    K+ + ++                      + T   G++    A  Y    +    L+ GA++N       + LH+A++ G + +   L   G  I+S   +L + LH    +G   V + L+V  A ++   +N L PL  +A     +   ++L + +      A V        T LH+    GH+   +LL       ++    NS   NG  PLH+AC  N  K+   L+   A +     +   P+H A   G + IV  L+    N    T+R E     + LA ++   ++   L     ++ ++       L  A ++G+  +V L+L+   N         +PLH AA+ GQ ++   LL   A+   + +  F  TPL LA
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQA-QVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQG-DHVDAARTLLYHR------APVDDVTVDYLTPLHVAAHCGHVRVAKLLL------DRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE---TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGF--TPLHLA 564          

HSP 3 Score: 92.8189 bits (229), Expect = 1.013e-18
Identity = 99/408 (24.26%), Postives = 171/408 (41.91%), Query Frame = 2
Query:  770 CEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ--------------LIKEEEKQ----FLLNSYDDN-----GDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKT 1921
             EG + FL A R      +LE L+ G DIN +   G N+LH+AS+ G SE++ +L      +++     ++ALH+    G   +   L+ N A+VNV + N  TPL  +A        E     +K LL + A+  L  +   T L + +  GH   + +L +                K+++       L N ++ +     G  PLH+A       +   L+ +GAN+     +   P+H AT+ G   +   L+      I  R +D    +  A +SGH  + + L  +   + +K + G   L  A Q   +   + +L     +        TPLH AA  G  ++ + LL   A+      +  TPL +A         ++ L    ++  +E   ++G T
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-------ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGA-IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESGLT 427          

HSP 4 Score: 88.5817 bits (218), Expect = 2.251e-17
Identity = 125/516 (24.22%), Postives = 200/516 (38.76%), Query Frame = 2
Query:  614 LHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFL------------------KXXXXXXADVKLKD--------KKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNE---------------DEANLII------------------LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRG 1981
            + A  +PE     G +    AA  G LE     +++         + IN+++  G +    A +     ++ E +K  A ++ A  +G  ALHIAS  G S I+  L +NG N+N    N  + L++        V + LL + A+  +   +  TPL     +  Q G ++ +A L                  K      A + L++        K   T LH+    GH    +LL       EK   +N    +   PLHVA       + N L+S GA +     +   P+H A R GH ++V DL+ +    I+ + +               D A  ++                  +A   GH  + + L  +  + +S+   G   L  AC+   I +V+L+LK    ++       TPLH AA  G   +V YLL  GA    E    +TPL LA      +  +V +  N  K   + R      H+    + N DI   LL  G
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRA--------GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLA----VALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLL------EKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVV-DLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIR-NGAKVDAQARELQTPLHIAS-RLGNTDIVILLLQAG 514          

HSP 5 Score: 84.7297 bits (208), Expect = 2.832e-16
Identity = 75/286 (26.22%), Postives = 123/286 (43.01%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLE---------------------AFYLCIQS--LMNSKI--NIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECL 1033
            + ++ LH AA     E+   +L    +    + KG T L LA K GN E VRL+  ++G  +D + +   TP+ +A   N   +  +LL  GA+   +  +G   LH   + N +E+   LL  K  P  K   G +P+ L+A  G+ E                     A +LC Q   +  ++I  N  + INS    GY+    A  + Q  ++   ++ GAD+          LH A++ G +  +  L +NG + N       + L +    G +SV E L
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL-ERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331823)

HSP 1 Score: 197.208 bits (500), Expect = 5.849e-51
Identity = 221/984 (22.46%), Postives = 406/984 (41.26%), Query Frame = 2
Query:  269 HEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQ--DRKGQTPIDLACRLNMIDIVKILLYYG--ANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL-----CDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIET--IELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKN-TMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAK------------YRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMN------------------------------SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDP---MCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIV-------NRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXM---VGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            H+AA      +L +I  +  + N K   G+T L +AV+S   + +  +     + +D    + K Q P+ LA  LN +  ++++  Y    +  +    G   LH     +H E  ++L+      P    NNG  PI  AA     +   +  Q           +I+  D EG     +A+       +  CLK GA I+  Q++    +H+A   G  +I+  +      +  + ++  D    + LH         +   L+   A +N  ++   +PLL +A   S+ G +     ++L     A + +KD   + +LH +I +G   T   E +     + + + LLN  D  G  PLH A  +   +    LI  GA + L N N   P+H A R G    V+ L+D       I   D A +  L +  Q GH  + + L  +   +H +D TG N L  A   G    ++L+     +L    +   +T LH A    +   +  L+S+G ++  N    + +  A+  ++   A   +      N  M  R          +I     +   + ++ +   +          KY F  L   P+  A ++ +  E +T A             + + +L+ HPLS   L  KW  +G +F + +L+ +  +L F T      M  I             DN T ++  ++   ++TMN                               ++ ++  L  + E ++   QKL Y     N +  ++Y SA+        P   + TI +S  +IA+ L W  ++ +LQ     GI ++MF  ++ ++IK++++F  L+I + +AFYI+         N   F N   S  + + M++GELD+V  +++  ++    + +    + S+ + +  I LM   +G+AVGDI+ +  +A++    +Q+   +E E  LP
Sbjct:  130 HQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLL---SIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAA---SRSGWKTVHLLIRLG----ACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLH-RDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQC-PFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAG--------DNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP 1093          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331825)

HSP 1 Score: 196.823 bits (499), Expect = 6.284e-51
Identity = 221/984 (22.46%), Postives = 406/984 (41.26%), Query Frame = 2
Query:  269 HEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQ--DRKGQTPIDLACRLNMIDIVKILLYYG--ANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL-----CDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIET--IELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKN-TMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAK------------YRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMN------------------------------SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDP---MCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIV-------NRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXM---VGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            H+AA      +L +I  +  + N K   G+T L +AV+S   + +  +     + +D    + K Q P+ LA  LN +  ++++  Y    +  +    G   LH     +H E  ++L+      P    NNG  PI  AA     +   +  Q           +I+  D EG     +A+       +  CLK GA I+  Q++    +H+A   G  +I+  +      +  + ++  D    + LH         +   L+   A +N  ++   +PLL +A   S+ G +     ++L     A + +KD   + +LH +I +G   T   E +     + + + LLN  D  G  PLH A  +   +    LI  GA + L N N   P+H A R G    V+ L+D       I   D A +  L +  Q GH  + + L  +   +H +D TG N L  A   G    ++L+     +L    +   +T LH A    +   +  L+S+G ++  N    + +  A+  ++   A   +      N  M  R          +I     +   + ++ +   +          KY F  L   P+  A ++ +  E +T A             + + +L+ HPLS   L  KW  +G +F + +L+ +  +L F T      M  I             DN T ++  ++   ++TMN                               ++ ++  L  + E ++   QKL Y     N +  ++Y SA+        P   + TI +S  +IA+ L W  ++ +LQ     GI ++MF  ++ ++IK++++F  L+I + +AFYI+         N   F N   S  + + M++GELD+V  +++  ++    + +    + S+ + +  I LM   +G+AVGDI+ +  +A++    +Q+   +E E  LP
Sbjct:   95 HQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLL---SIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAA---SRSGWKTVHLLIRLG----ACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLH-RDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQC-PFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAG--------DNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP 1058          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331824)

HSP 1 Score: 194.126 bits (492), Expect = 5.315e-50
Identity = 219/985 (22.23%), Postives = 404/985 (41.02%), Query Frame = 2
Query:  269 HEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQ--DRKGQTPIDLACRLNMIDIVKILLYYG--ANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIP-----KLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIET--IELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFN-LQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKN-TMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEF-------------MTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMN------------------------------SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDP---MCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIV-------NRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXM---VGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            H+AA      +L +I  +  + N K   G+T L +AV+S   + +  +     + +D    + K Q P+ LA  LN +  ++++  Y    +  +    G   LH     +H E  ++L+      P    NNG  PI  AA     +   +  Q           +I+  D EG     +A+       +  CLK GA I+  Q++    +H+A   G  +I+      +  +  + ++  D    + LH         +   L+   A +N  ++   +PLL +A   S+ G +     ++L     A + +KD   + +LH +I +G   T   E +     + + + LLN  D  G  PLH A  +   +    LI  GA + L N N   P+H A R G    V+ L+D       I   D A +  L +  Q GH  + + L  +   +H +D TG N L  A   G    ++L+     + L   +   +T LH A    +   +  L+S+G ++  N    + +  A+  ++   A   +      N  M  R          +I     +   + ++ +   +          KY F+     P     + ++  EF              T+  + + +L+ HPLS   L  KW  +G +F + +L+ +  +L F T      M  I             DN T ++  ++   ++TMN                               ++ ++  L  + E ++   QKL Y     N +  ++Y SA+        P   + TI +S  +IA+ L W  ++ +LQ     GI ++MF  ++ ++IK++++F  L+I + +AFYI+         N   F N   S  + + M++GELD+V  +++  ++    + +    + S+ + +  I LM   +G+AVGDI+ +  +A++    +Q+   +E E  LP
Sbjct:  130 HQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLL---SIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAA---SRSGWKTVHLLIRLG----ACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLH-RDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTP---EQIEAKRKEFNDPKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAG--------DNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP 1092          

HSP 2 Score: 65.4698 bits (158), Expect = 2.841e-10
Identity = 89/391 (22.76%), Postives = 150/391 (38.36%), Query Frame = 2
Query:  854 INLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNE------DEANLII-LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLI-----LKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYE-NTFHQTPLTLALDNQHWNT--------AKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIAN 1963
            I L   +G+ A H A+      I+  + D   + N+ DN  ++ LH+ + + +    + LL       V N     P+    +L +++   KSL  +    N   D++   +  +T LHL     H            EE  + L+  +D         AC    RK CN              N   PIHEA +    + ++       Q+   R E       E N+ +  AV  G     E       ++ ++    +  +  AC  G I +VKL+     ++K   L   +  + TPLH A+      +V YL++ GA++   +  H++PL LA     W T        A + + D   +N + F    G    G +    E +AN
Sbjct:  118 IALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPV----HLATELNKVKSLRVMGQYRNVI-DIQQGGEHGRTALHLAAIYDH------------EECARILITEFD---------ACP---RKPCN--------------NGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNG----GRLTDFAEQVAN 461          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331826)

HSP 1 Score: 193.741 bits (491), Expect = 5.477e-50
Identity = 219/985 (22.23%), Postives = 404/985 (41.02%), Query Frame = 2
Query:  269 HEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQ--DRKGQTPIDLACRLNMIDIVKILLYYG--ANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL-----CDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIET--IELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFN-LQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKN-TMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEF-------------MTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMN------------------------------SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDP---MCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIV-------NRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXM---VGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            H+AA      +L +I  +  + N K   G+T L +AV+S   + +  +     + +D    + K Q P+ LA  LN +  ++++  Y    +  +    G   LH     +H E  ++L+      P    NNG  PI  AA     +   +  Q           +I+  D EG     +A+       +  CLK GA I+  Q++    +H+A   G  +I+  +      +  + ++  D    + LH         +   L+   A +N  ++   +PLL +A   S+ G +     ++L     A + +KD   + +LH +I +G   T   E +     + + + LLN  D  G  PLH A  +   +    LI  GA + L N N   P+H A R G    V+ L+D       I   D A +  L +  Q GH  + + L  +   +H +D TG N L  A   G    ++L+     + L   +   +T LH A    +   +  L+S+G ++  N    + +  A+  ++   A   +      N  M  R          +I     +   + ++ +   +          KY F+     P     + ++  EF              T+  + + +L+ HPLS   L  KW  +G +F + +L+ +  +L F T      M  I             DN T ++  ++   ++TMN                               ++ ++  L  + E ++   QKL Y     N +  ++Y SA+        P   + TI +S  +IA+ L W  ++ +LQ     GI ++MF  ++ ++IK++++F  L+I + +AFYI+         N   F N   S  + + M++GELD+V  +++  ++    + +    + S+ + +  I LM   +G+AVGDI+ +  +A++    +Q+   +E E  LP
Sbjct:   95 HQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLL---SIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAA---SRSGWKTVHLLIRLG----ACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLH-RDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTP---EQIEAKRKEFNDPKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAG--------DNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP 1057          

HSP 2 Score: 65.0846 bits (157), Expect = 3.956e-10
Identity = 89/391 (22.76%), Postives = 150/391 (38.36%), Query Frame = 2
Query:  854 INLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNE------DEANLII-LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLI-----LKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYE-NTFHQTPLTLALDNQHWNT--------AKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIAN 1963
            I L   +G+ A H A+      I+  + D   + N+ DN  ++ LH+ + + +    + LL       V N     P+    +L +++   KSL  +    N   D++   +  +T LHL     H            EE  + L+  +D         AC    RK CN              N   PIHEA +    + ++       Q+   R E       E N+ +  AV  G     E       ++ ++    +  +  AC  G I +VKL+     ++K   L   +  + TPLH A+      +V YL++ GA++   +  H++PL LA     W T        A + + D   +N + F    G    G +    E +AN
Sbjct:   83 IALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPV----HLATELNKVKSLRVMGQYRNVI-DIQQGGEHGRTALHLAAIYDH------------EECARILITEFD---------ACP---RKPCN--------------NGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNG----GRLTDFAEQVAN 426          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331827)

HSP 1 Score: 193.741 bits (491), Expect = 5.966e-50
Identity = 220/972 (22.63%), Postives = 400/972 (41.15%), Query Frame = 2
Query:  269 HEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQ--DRKGQTPIDLACRLNMIDIVKILLYYG--ANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL-----CDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIET--IELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFN-LQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKN-TMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMN------------------------------SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDP---MCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIV-------NRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXM---VGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            H+AA      +L +I  +  + N K   G+T L +AV+S   + +  +     + +D    + K Q P+ LA  LN +  ++++  Y    +  +    G   LH     +H E  ++L+      P    NNG  PI  AA     +   +  Q           +I+  D EG     +A+       +  CLK GA I+  Q++    +H+A   G  +I+  +      +  + ++  D    + LH         +   L+   A +N  ++   +PLL +A   S+ G +     ++L     A + +KD   + +LH +I +G   T   E +     + + + LLN  D  G  PLH A  +   +    LI  GA + L N N   P+H A R G    V+ L+D       I   D A +  L +  Q GH  + + L  +   +H +D TG N L  A   G    ++L+     + L   +   +T LH A    +   +  L+S+G ++  N    + +  A+  ++   A   +      N  M  R          +I          + +  E + D     K +TK             A+       F T+  + + +L+ HPLS   L  KW  +G +F + +L+ +  +L F T      M  I             DN T ++  ++   ++TMN                               ++ ++  L  + E ++   QKL Y     N +  ++Y SA+        P   + TI +S  +IA+ L W  ++ +LQ     GI ++MF  ++ ++IK++++F  L+I + +AFYI+         N   F N   S  + + M++GELD+V  +++  ++    + +    + S+ + +  I LM   +G+AVGDI+ +  +A++    +Q+   +E E  LP
Sbjct:  130 HQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLL---SIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAA---SRSGWKTVHLLIRLG----ACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLH-RDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIAS--------MPKVFEAVQD-----KCITK-------------ANCKKDSKSFYTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAG--------DNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP 1056          

HSP 2 Score: 65.0846 bits (157), Expect = 3.727e-10
Identity = 89/391 (22.76%), Postives = 150/391 (38.36%), Query Frame = 2
Query:  854 INLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNE------DEANLII-LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLI-----LKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYE-NTFHQTPLTLALDNQHWNT--------AKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIAN 1963
            I L   +G+ A H A+      I+  + D   + N+ DN  ++ LH+ + + +    + LL       V N     P+    +L +++   KSL  +    N   D++   +  +T LHL     H            EE  + L+  +D         AC    RK CN              N   PIHEA +    + ++       Q+   R E       E N+ +  AV  G     E       ++ ++    +  +  AC  G I +VKL+     ++K   L   +  + TPLH A+      +V YL++ GA++   +  H++PL LA     W T        A + + D   +N + F    G    G +    E +AN
Sbjct:  118 IALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPV----HLATELNKVKSLRVMGQYRNVI-DIQQGGEHGRTALHLAAIYDH------------EECARILITEFD---------ACP---RKPCN--------------NGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNG----GRLTDFAEQVAN 461          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 199.134 bits (505), Expect = 1.152e-51
Identity = 253/1008 (25.10%), Postives = 428/1008 (42.46%), Query Frame = 2
Query:  230 IDENHPNNTFNLLHEAAISKNPELLEFILSKKP-NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEI-DGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFY--------LCIQ-----------SLMNSKINIASVINSTDCEGYSCFLN--------------AIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI--ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLG--NYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTM-EFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDA-------GPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQG------CPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMC-----TIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFL---DPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEPVFV 3046
            I+E+    + ++  E A       ++ ++ K P +++ +   G++ L  A   GN + +RLI    G E+ + QD +G+TP+  A   +      +LL  GA+P       M  LH  +   +  + ++LL   K +  ++ + G +P+ LA S    +A          +CIQ           +   +K  +  V+   +  G S  L+              A+R     +I  C+  GA +   Q+    ALH A   G  E +  +  +      + N  D A    +H  +L     +AE L+   A ++  +   L+PLL    L S     K++A+L   L+  AD K+K+K  +  LH +I    G     E + Q    +E   +L+  D  G  PLH AC   +      ++  G N+ LG  +  +   +H A   G +     L++       + + DE  L  + LA ++GH  + + L  K     S D  G   L +A   G    +K++L  +  L   +N   +T LH AAQAG    V  LL  GAE+  N    + L  A+ N+        +       +M  F+ K+    +  I    E   + L     E   D NS +  +  Y+F  L A          D             + +Y + +L++HPLS   L  KW  +GS     +L  +L  L   T++I +  P    S D+           PV  S    L S+    I M  +M+++   +   E ++   Q++ YF   SN        SA+ F      PMC     T QW  G  AI+  W   + Y Q     GI ++MF  +V +++ I++LF+ L++ + +AFY +  ++  F +   + A+ + M +GEL+Y S FL   + G   F A+  ++   F +L+ I L+NLM+G+AVGDI  +  +A++    +QI   +  E  LP     +  +P  V
Sbjct:   18 INEDETEESADVF-ELAFKGKASAIDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNIRDGANRTPLHRATLFDHVELAEYLISKGAEIDSIDCKGLSPLL----LASSCSAWKTVAYL---LSIGADFKIKEKTGRNFLHFVILQPKGLKNLPETVLQSTAVKE---MLSDEDVEGCTPLHYACKLGIHDSVKNML--GLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQS-DYKGWTCLHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIM-YNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRP----SQDFSKGNGTSVIMVPVSFSEQQYLISVC---IIMVIVMNVYSICK---EVVQLAQQRVNYFTDFSNPADWSAAISALVFVV----PMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGHMAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPYWFLKRVDKPSTV 996          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 199.134 bits (505), Expect = 1.152e-51
Identity = 253/1008 (25.10%), Postives = 428/1008 (42.46%), Query Frame = 2
Query:  230 IDENHPNNTFNLLHEAAISKNPELLEFILSKKP-NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEI-DGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFY--------LCIQ-----------SLMNSKINIASVINSTDCEGYSCFLN--------------AIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI--ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLG--NYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTM-EFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDA-------GPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQG------CPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMC-----TIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFL---DPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEPVFV 3046
            I+E+    + ++  E A       ++ ++ K P +++ +   G++ L  A   GN + +RLI    G E+ + QD +G+TP+  A   +      +LL  GA+P       M  LH  +   +  + ++LL   K +  ++ + G +P+ LA S    +A          +CIQ           +   +K  +  V+   +  G S  L+              A+R     +I  C+  GA +   Q+    ALH A   G  E +  +  +      + N  D A    +H  +L     +AE L+   A ++  +   L+PLL    L S     K++A+L   L+  AD K+K+K  +  LH +I    G     E + Q    +E   +L+  D  G  PLH AC   +      ++  G N+ LG  +  +   +H A   G +     L++       + + DE  L  + LA ++GH  + + L  K     S D  G   L +A   G    +K++L  +  L   +N   +T LH AAQAG    V  LL  GAE+  N    + L  A+ N+        +       +M  F+ K+    +  I    E   + L     E   D NS +  +  Y+F  L A          D             + +Y + +L++HPLS   L  KW  +GS     +L  +L  L   T++I +  P    S D+           PV  S    L S+    I M  +M+++   +   E ++   Q++ YF   SN        SA+ F      PMC     T QW  G  AI+  W   + Y Q     GI ++MF  +V +++ I++LF+ L++ + +AFY +  ++  F +   + A+ + M +GEL+Y S FL   + G   F A+  ++   F +L+ I L+NLM+G+AVGDI  +  +A++    +QI   +  E  LP     +  +P  V
Sbjct:   18 INEDETEESADVF-ELAFKGKASAIDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNIRDGANRTPLHRATLFDHVELAEYLISKGAEIDSIDCKGLSPLL----LASSCSAWKTVAYL---LSIGADFKIKEKTGRNFLHFVILQPKGLKNLPETVLQSTAVKE---MLSDEDVEGCTPLHYACKLGIHDSVKNML--GLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQS-DYKGWTCLHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIM-YNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRP----SQDFSKGNGTSVIMVPVSFSEQQYLISVC---IIMVIVMNVYSICK---EVVQLAQQRVNYFTDFSNPADWSAAISALVFVV----PMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGHMAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPYWFLKRVDKPSTV 996          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 190.274 bits (482), Expect = 9.068e-49
Identity = 254/1021 (24.88%), Postives = 428/1021 (41.92%), Query Frame = 2
Query:  230 IDENHPNNTFNLLHEAAISKNPELLEFILSKKP-NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEI-DGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFY--------LCIQ-----------SLMNSKINIASVINSTDCEGYSCFLN--------------AIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECL-------------LVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI--ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLG--NYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTM-EFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDA-------GPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQG------CPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMC-----TIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFL---DPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEPVFV 3046
            I+E+    + ++  E A       ++ ++ K P +++ +   G++ L  A   GN + +RLI    G E+ + QD +G+TP+  A   +      +LL  GA+P       M  LH  +   +  + ++LL   K +  ++ + G +P+ LA S    +A          +CIQ           +   +K  +  V+   +  G S  L+              A+R     +I  C+  GA +   Q+    ALH A   G  E +  +  +      + N  D A    +H  +L     +AE L             L   A ++  +   L+PLL    L S     K++A+L   L+  AD K+K+K  +  LH +I    G     E + Q    +E   +L+  D  G  PLH AC   +      ++  G N+ LG  +  +   +H A   G +     L++       + + DE  L  + LA ++GH  + + L  K     S D  G   L +A   G    +K++L  +  L   +N   +T LH AAQAG    V  LL  GAE+  N    + L  A+ N+        +       +M  F+ K+    +  I    E   + L     E   D NS +  +  Y+F  L A          D             + +Y + +L++HPLS   L  KW  +GS     +L  +L  L   T++I +  P    S D+           PV  S    L S+    I M  +M+++   +   E ++   Q++ YF   SN        SA+ F      PMC     T QW  G  AI+  W   + Y Q     GI ++MF  +V +++ I++LF+ L++ + +AFY +  ++  F +   + A+ + M +GEL+Y S FL   + G   F A+  ++   F +L+ I L+NLM+G+AVGDI  +  +A++    +QI   +  E  LP     +  +P  V
Sbjct:   18 INEDETEESADVF-ELAFKGKASAIDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNIRDGANRTPLHRATLFDHVELAEYLISKPNTLSLDLICLGKGAEIDSIDCKGLSPLL----LASSCSAWKTVAYL---LSIGADFKIKEKTGRNFLHFVILQPKGLKNLPETVLQSTAVKE---MLSDEDVEGCTPLHYACKLGIHDSVKNML--GLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQS-DYKGWTCLHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIM-YNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRP----SQDFSKGNGTSVIMVPVSFSEQQYLISVC---IIMVIVMNVYSICK---EVVQLAQQRVNYFTDFSNPADWSAAISALVFVV----PMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGHMAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPYWFLKRVDKPSTV 1009          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Zebrafish
Match: trpa1a (transient receptor potential cation channel, subfamily A, member 1a [Source:ZFIN;Acc:ZDB-GENE-050105-6])

HSP 1 Score: 181.03 bits (458), Expect = 6.814e-46
Identity = 235/975 (24.10%), Postives = 411/975 (42.15%), Query Frame = 2
Query:  275 AAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKG-MEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIR-SNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYL--------CIQSLMN-------------------------SKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEII-------PKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTH----MGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLD-------AGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFF--TFMIFHYMPPIADSPDYD--NQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKV-KDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP---GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            AA+ KN   L+     + NI      G++ L  A  +G+   +R I +  G  E++ +D +G TP+  A + +      +LL  GA+P          +H  +    +  + +L+ H +    ++ + G +P+ L+A+L   EA  +        C Q+ +                          + ++I + IN  D    S    A+R     II  C+ YGA I+  Q +   ALH A   G +E++       PK+CD    IN  D    + LH  +      ++E L+   A+++  +    +PLL    L +  G  +++  L   L++ AD+  KDK     LHL I         L  ++++ E  + LLN  D  G  PLH AC   +      ++    +L   +  +   +H A   G +     L+++      +   DE  L  + LA + GH  + E L  K    HS D  G + L +A   G    +  +L  +  L    +   +T LH AA+AG    V  LL  GA++  N    + L  A+ N       + +  +  +  M   +K   T     M  I    E   + L     E   D N  N  + +Y+F  L            +        +    +  + +  L+ HP+    L  KW  +G    + ++  +   LG F  T++I +  P +  S +    N  C    ++  K   LT S + +   M+M+   +   E L+   Q+L Y +  SNY+       A+ F   +  +   +  W  G +A +  W N++ YLQ     GI ++MF+ +  +++ II+LF  L++G+A++FY +   Q  F   + S  + + M++GE++Y   F+ P   G   F  + L +   F +L+ I L+NL++G+AVGDI  +  +A +    +QI   +  E  LP
Sbjct:   56 AALEKNSRYLD----TRDNI------GASPLHYASANGHFRIIRHIVQIVGHQELNVRDEEGNTPLHWAVQKDQPGSCSVLLSLGADPNVLNNSHQAPIHMAVSLGKNFVLEQLVSHKQTDVNLEGDLGNTPVILSAALDNHEALGILYKHGAKFCRQNNLGHFPIHAAAFSGAKKSMEVILLKGEEAGLSIDAHINYVDKSCSSPLHLAVRGGNLDIIKLCIGYGAKIDQQQCDKSTALHFACSQGATEVVKIMLSSYPKVCDL---INITDGANQTPLHKAVIFDHFELSEYLMSQGANIDFVDCKGHSPLL----LATSCGAWRTVNLL---LSHGADLTKKDKSGCNFLHLAILQPR-GLKNLPTEVLQHESVRELLNDEDIEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKEKKSALHFAAEFGRINTCHRLLEMVTDTRLLNEGDEKGLTPLHLASREGHVKVVELLLRKGALFHS-DYRGWSGLHHAASEGYTQTMDTLLTSNIKLLNKTDGDGNTALHLAARAGHVAAVRLLLYRGAKIILNKNDASFLHEAVHNARREVTNMVIESDRCEEAMT-TYKPNSTKRCIVMDMIEFLPESFKHLLDTCIRESEEDVNCTNYYI-EYNFRWLQHPLQNLKKTGMEKDMAYKPLSALNAMVNFNRVNLLTHPVCKKYLEMKWSAYGIKAHLLNMTVYA--LGVFPLTYLIVNLKPTLVTSRNVTSVNMVC----TSLYKQSYLTTSSMLLVLAMNMYAVGK---EILQMFQQRLNYLRDLSNYMDWAAAICALLFVVPLLMNLKSSWHWQAGALAALTSWLNLLLYLQRFERIGIYVVMFREISRTLLSIIVLFFYLILGFALSFYALMIEQQHFGRMFLSLLQTFVMMVGEMNYQDNFMKPYLQGDLPFPDLTLAIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKRIAMQIELHTNLEERLP 997          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 157.532 bits (397), Expect = 2.727e-38
Identity = 141/554 (25.45%), Postives = 234/554 (42.24%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNS---------YDD-------------------NGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLA 1828
            N    LH A+   N  ++  +L +   I+ K+  G T L  A +SG+   V L+  ++G  +  + + G +P+ +A + + ++ VK LL + A       D +  LH      H  + KLLL  + +P  +  NG +P+ +A     ++   L I+          + I +    G +    A       I+L  L+ GA  +++   G+ ALH+A+  G  E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  +A        E  L    +LL   A   L  KK  T LH+    G +E  +LL Q     +     N          YD+                   NG  PLH+A   N  +I   L+  GA   +      +PIH A+++GH E+   L+     Q+ +  +     + LA Q     + E L  +   +  + + G   L+ AC  G+  MV  +LK   ++  +  +  TPLHQAAQ G T ++  LL  GA+    T   T L +A
Sbjct:  258 NGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLL-ERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIK--------YGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAR-------EGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKQNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRG-AQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITNGNTALAIA 794          

HSP 2 Score: 139.428 bits (350), Expect = 1.213e-32
Identity = 138/540 (25.56%), Postives = 237/540 (43.89%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFL 1867
            N  N LH AA   + +L++ +L +  +++  + KG+TAL +A  +G  + V+++ K +G  I+ Q + G TP+ +A + N +D+V+ LL  G N   +  DG   L   ++  H +++ +LL      +V+    +  + +AA     ++  L +Q+  N+ +   S        G++    A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G  +  E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   NG  PLH+AC  N  K+   LI  GA +     +   PIH A   GHL IV  L+  N     + N      + +A ++G   +   L      + ++       L  A ++G   +V+L+L+   +      +  TPLH AA+ G   +   LL  GA     T    TPL +A        AK+ L
Sbjct:   64 NGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSK-RGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKS--------GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPL----HMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLL 576          

HSP 3 Score: 93.9745 bits (232), Expect = 9.532e-19
Identity = 106/440 (24.09%), Postives = 180/440 (40.91%), Query Frame = 2
Query:  782 SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ---------------LIKEEEKQ-FLLNSYDDNGDY-------PLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG----------------NNILMYACQVGDIGM-----------------VKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMG 1930
            + FL A R      +LE LK G DI  +   G NALH+A++ G  +++ +L   G +++S     ++ALH+    G   V + L    A++N  ++N  TPL  ++        E  L  ++ LL N  +  +  +   T L + +  GH + + +L +                 K++ K   LL   D N D        PLH+A       +   L++ GA +     N   P+H A+++G+  +V  L+D    QI  +  D    +  A +SGH    E L  +   M ++ + G                 ++L +   V D+ +                  KL+L K  N   R  +  TPLH A +  + K++E L+  GA +   T    TP+ +A    H N   + L +    +    R +T   HM 
Sbjct:   34 TSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQ-------ENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRG-AQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETA-LHMA 464          

HSP 4 Score: 77.411 bits (189), Expect = 1.056e-13
Identity = 69/293 (23.55%), Postives = 122/293 (41.64%), Query Frame = 2
Query:  242 HPN----NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQ------------------SLMNSKINIASVINSTDCE-------GYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECL 1033
            HP+    N +  LH AA   + ++   +L      +  + KG T L +A K G+ E  +L+ +++        + G TP+ +A   +   +  +LL  GA+P  +  +G   LH   + N +E+   LL       ++   G+ PI LA+  G+ E   L +Q                  +    K+ +  ++             GY+  + A  Y    ++   LK GA +N     G   LH A++ G + II  L   G   N++ N  ++AL +    G +SV + L
Sbjct:  515 HPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKQNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITNG-NTALAIARRLGYISVVDTL 806          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 216.468 bits (550), Expect = 4.566e-57
Identity = 240/942 (25.48%), Postives = 427/942 (45.33%), Query Frame = 2
Query:  308 FILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGME-IDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLH----------AKCSPEVKDNN-GISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSV----DNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI-ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTG--KTHMGYIIMKNEDIANELLNRGL-EVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSR--------YTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSI--MSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMY-SSAIFFTAKVKDPMCT--IQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP------GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            F+L    ++  +    +T L  A K GN + + +I  +   E I+  D +G TP+  A + N +D +K+LL  GA+P       +  LH  I+  H  + ++              + +   K N  G  PI + A +G L+   + ++        I   IN T+ E  S    A++     ++  C+ YGA I+L Q++   ALH A+  G +EI+  +  +  + N +    D N ++ LH  +    + +AE L+   A+++  ++   TPLL    L +     KS+  L   L+  ADVKLKD   +  LHL++   G ++ +   F  ++ E  + L++  D  G  PLH AC + +    N L+    +L   + N+  P+H A   G     + L+        + + DE  +  + LA ++GH  I  FL  K   +   D  G   L YA   G    +K +L+    L    +  Q+T +H A + G  K V  LL  GA +  N    + +  A+     +T  V +    W+  ++    T   K  +  +I    +    LL+R + E I D  S +  + +Y+F  L   P      + R         T    + ++++  L+ HP+    LL KW  +G    + +L  +   L   T +I + + P +    Y                    + + M  +  MS+FG   ++ E+++   QKL Y   GSN +   +Y SS IF ++    P+    +QW FG IA+   W N + YLQ   ++GI I+MF  ++ ++++I+ LF  L++ + ++FY+    Q  F   +F+  + + M++G+++Y   FL P       +  FT +    + +F++LI I L+NL++G+AVGDI  +  +A +    +Q++  +  E  LP
Sbjct:   32 FVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEVRFFQGICFSLRTLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLL----LATSCSAWKSVNLL---LSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEF--LQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHV-EYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLDTQY--------------------TRVCMGLVFCMSLFG---IVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIH---LIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLP 935          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 214.542 bits (545), Expect = 1.965e-56
Identity = 256/988 (25.91%), Postives = 444/988 (44.94%), Query Frame = 2
Query:  236 ENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGME-IDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKC----------SPEV----KDNN-------------------GISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLC-----DNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI-ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTG--KTHMGYIIMKNEDIANELLNRGL-EVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSR--------YTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPD-YDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMY-SSAIFFTAKVKDPMCT--IQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP------GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            +++P   F L+ E  + +   +  F+L    ++  +    +T L  A K GN + + +I  +   E I+  D +G TP+  A + N +D +K+LL  GA+P       +  LH  I+  H   I L+LH+            +P +    KDN+                   G  PI + A +G L+   + ++        I   IN T+ E  S    A++     ++  C+ YGA I+L Q++   ALH A+  G +EI+  +      DN I ++  D N ++ LH  +    + +AE L+   A+++  ++   TPLL    L +     KS+  L   L+  ADVKLKD   +  LHL++   G ++ +   F  ++ E  + L++  D  G  PLH AC + +    N L+    +L   + N+  P+H A   G     + L+        + + DE  +  + LA ++GH  I  FL  K   +   D  G   L YA   G    +K +L+    L    +  Q+T +H A + G  K V  LL  GA +  N    + +  A+     +T  V +    W+  ++    T   K  +  +I    +    LL+R + E I D  S +  + +Y+F  L   P      + R         T    + ++++  L+ HP+    LL KW  +G    + +L  +   L   T MI         S D YD Q               T   + +   MS+FG   ++ E+++   QKL Y   GSN +   +Y SS IF ++    P+    +QW FG IA+   W N + YLQ   ++GI I+MF  ++ ++++I+ LF  L++ + ++FY+    Q  F   +F+  + + M++G+++Y   FL P       +  FT +    + +F++LI I L+NL++G+AVGDI  +  +A +    +Q++  +  E  LP
Sbjct:   33 DDNPLLIFKLIAEGNVCR---VRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFH-NSIALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKI-VDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLL----LATSCSAWKSVNLL---LSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEF--LQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHV-EYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLMI---------SNDFYDTQ--------------YTRVCMGLVFCMSLFG---IVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIH---LIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLP 974          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 214.542 bits (545), Expect = 2.288e-56
Identity = 258/1007 (25.62%), Postives = 455/1007 (45.18%), Query Frame = 2
Query:  236 ENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGME-IDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIK-LLLHAKC----------SPEV----KDNN-------------------GISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLC-----DNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI-ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTG--KTHMGYIIMKNEDIANELLNRGL-EVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSR--------YTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIA----------DSPDYDN----QGCPVDNSTDNKLKSLTDSEITMNSI-----MSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMY-SSAIFFTAKVKDPMCT--IQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP------GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            +++P   F L+ E  + +   +  F+L    ++  +    +T L  A K GN + + +I  +   E I+  D +G TP+  A + N +D +K+LL  GA+P       +  LH  I+  H  + + L+LH+            +P +    KDN+                   G  PI + A +G L+   + ++        I   IN T+ E  S    A++     ++  C+ YGA I+L Q++   ALH A+  G +EI+  +      DN I ++  D N ++ LH  +    + +AE L+   A+++  ++   TPLL    L +     KS+  L   L+  ADVKLKD   +  LHL++   G ++ +   F  ++ E  + L++  D  G  PLH AC + +    N L+    +L   + N+  P+H A   G     + L+        + + DE  +  + LA ++GH  I  FL  K   +   D  G   L YA   G    +K +L+    L    +  Q+T +H A + G  K V  LL  GA +  N    + +  A+     +T  V +    W+  ++    T   K  +  +I    +    LL+R + E I D  S +  + +Y+F  L   P      + R         T    + ++++  L+ HP+    LL KW  +G    + +L  +   L   T +I + + P +             D+ N    Q C  + S    L  L D++ T   +     MS+FG   ++ E+++   QKL Y   GSN +   +Y SS IF ++    P+    +QW FG IA+   W N + YLQ   ++GI I+MF  ++ ++++I+ LF  L++ + ++FY+    Q  F   +F+  + + M++G+++Y   FL P       +  FT +    + +F++LI I L+NL++G+AVGDI  +  +A +    +Q++  +  E  LP
Sbjct:   33 DDNPLLIFKLIAEGNVCR---VRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKI-VDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLL----LATSCSAWKSVNLL---LSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEF--LQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHV-EYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAIIEECEHLKRTDFYNSSMKQEC-ANVSRKLDLLQLKDTQYTRVCMGLVFCMSLFG---IVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIH---LIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLP 1016          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 209.534 bits (532), Expect = 8.218e-55
Identity = 247/992 (24.90%), Postives = 448/992 (45.16%), Query Frame = 2
Query:  236 ENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGME-IDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIK-LLLHAKC----------SPEV----KDNN-------------------GISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLC-----DNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI-ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEF-----RFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSR--------YTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSI--MSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMY-SSAIFFTAKVKDPMCT--IQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP------GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            +++P   F L+ E  + +   +  F+L    ++  +    +T L  A K GN + + +I  +   E I+  D +G TP+  A + N +D +K+LL  GA+P       +  LH  I+  H  + + L+LH+            +P +    KDN+                   G  PI + A +G L+   + ++        I   IN T+ E  S    A++     ++  C+ YGA I+L Q++   ALH A+  G +EI+  +      DN I ++  D N ++ LH  +    + +AE L+   A+++  ++   TPLL    L +     KS+  L   L+  ADVKLKD   +  LHL++   G ++ +   F  ++ E  + L++  D  G  PLH AC + +    N L+    +L   + N+  P+H A   G     + L+        + + DE  +  + LA ++GH  I  FL  K   +   D  G   L YA   G    +K +L+    L    +  Q+T +H A + G  K V  LL  GA +  N    + +  A+     +T  V +    W+  ++       +K     M Y + ++  +   +LN               +++Y+F  L   P      + R         T    + ++++  L+ HP+    LL KW  +G    + +L  +   L   T +I + + P + +   + +     +  ++ +K     E  M  +  MS+FG   ++ E+++   QKL Y   GSN +   +Y SS IF ++    P+    +QW FG IA+   W N + YLQ   ++GI I+MF  ++ ++++I+ LF  L++ + ++FY+    Q  F   +F+  + + M++G+++Y   FL P       +  FT +    + +F++LI I L+NL++G+AVGDI  +  +A +    +Q++  +  E  LP
Sbjct:   33 DDNPLLIFKLIAEGNVCR---VRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKI-VDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLL----LATSCSAWKSVNLL---LSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEF--LQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKVG--ILN---------------VSQYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAIIEECEHLKRTDFYNSSMK----QEFCMGLVFCMSLFG---IVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIH---LIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLP 982          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 204.142 bits (518), Expect = 4.335e-53
Identity = 247/963 (25.65%), Postives = 426/963 (44.24%), Query Frame = 2
Query:  308 FILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGME-IDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKC----------SPEV----KDNN-------------------GISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLC-----DNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI-ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTG--KTHMGYIIMKNEDIANELLNRGL-EVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSR--------YTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMY-SSAIFFTAKVKDPMCT--IQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP------GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            F+L    ++  +    +T L  A K GN + + +I  +   E I+  D +G TP+  A + N +D +K+LL  GA+P       +  LH  I+  H   I L+LH+            +P +    KDN+                   G  PI + A +G L+   + ++        I   IN T+ E  S    A++     ++  C+ YGA I+L Q++   ALH A+  G +EI+  +      DN I ++  D N ++ LH  +    + +AE L+   A+++  ++   TPLL    L +     KS+  L   L+  ADVKLKD   +  LHL++   G ++ +   F  ++ E  + L++  D  G  PLH AC + +    N L+    +L   + N+  P+H A   G     + L+        + + DE  +  + LA ++GH  I  FL  K   +   D  G   L YA   G    +K +L+    L    +  Q+T +H A + G  K V  LL  GA +  N    + +  A+     +T  V +    W+  ++    T   K  +  +I    +    LL+R + E I D  S +  + +Y+F  L   P      + R         T    + ++++  L+ HP+    LL KW  +G    + +L  +   L   T MI                         N    L         I  +FG   ++ E+++   QKL Y   GSN +   +Y SS IF ++    P+    +QW FG IA+   W N + YLQ   ++GI I+MF  ++ ++++I+ LF  L++ + ++FY+    Q  F   +F+  + + M++G+++Y   FL P       +  FT +    + +F++LI I L+NL++G+AVGDI  +  +A +    +Q++  +  E  LP
Sbjct:   32 FVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFH-NSIALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKI-VDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLL----LATSCSAWKSVNLL---LSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEF--LQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHV-EYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLMI------------------------SNDFYVL---------IQLLFG---IVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIH---LIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLP 941          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 187.578 bits (475), Expect = 7.183e-48
Identity = 229/970 (23.61%), Postives = 421/970 (43.40%), Query Frame = 2
Query:  224 QYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCK--------GSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYD-GMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN----INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGH----IETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHF---FMLDAGPYD----SASVNSRYTEFMTI----AKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGC--PVDNSTDNKLKSLTDSEITMNSIM----SMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKV-KDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFK---IFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            +Y DEN        LH AA     EL+E I      IN  SC+        G+T L  A +    E V+ +  Q G   + ++R   +P+ +A      +++K+L  + A  +  E + G   L      ++ E +++LL         +  G  P+  AA  G  +   L +     +  +  + IN  + +  S    A++     +I  CL  GA I++ +N    ALH A+  G ++I+  +  +       +N+VD N ++ LH         +AE L+   A +N  +    +PL+ +           S   + LLL   A V +KD   +  LHL +   +    +    +  Q IKE     L+   D++G  PLH AC   +    N L+    ++   + ++  P+H A   G +   + L+  +I    + NE + + +    LA ++GH  + + L  K   +   D  G   L +A   G    +K+IL  +     R +   +T LH AA+ G  K V  LLS  A++  N    + L +AL N+        + +  W   ++  F          IM+  +   E +   L+     ++ +KS   YH    F     P       A       E +TI     ++ + +L+ HP+    LL KW  +G    M +L ++   L   T ++    P +A    +++ G      ++ + ++ +L    I +  I+    S+FG+ +   E ++   QK  YF   +N +  ++Y+++I F   +  +    +QW  G IAI   W N + YLQ   N GI I+M + +  ++++   +F+ L++ + ++FY++   Q  F     S  + + M++G+++Y   FL+P F+    +  +    +  F++ + I L+NL++G+AVGDI  +   A +    +Q+   +  E  LP
Sbjct:   59 KYEDEN-----LCPLHHAAAEGQVELMELI------INGSSCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQ-GANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILAT-------ASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKE-----LVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQ-DISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLL-LKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQV-FTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMA----FNSTGIINGTSSTHEERIDTLNSFPIKICMILVFLSSIFGYCK---EVIQIFQQKRNYFLDYNNALEWVIYTTSIIFVLPLFLNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLP 994          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 171.4 bits (433), Expect = 6.694e-43
Identity = 224/964 (23.24%), Postives = 398/964 (41.29%), Query Frame = 2
Query:  302 LEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEI-DGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKC---------------SPEVKDNN-------------------GISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN----INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGH----IETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHF---FMLDAGPYD----SASVNSRYTEFMTI----AKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKV-KDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFK---IFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            LE  +  +  ++K   +    L  A   G  E + LI      E+ +  D  G TP+  A   N ++ VK LL  GANP     + M  LH  +   + E+IK+L   K                S   KDN+                   G  P+  AA  G  +   L +     +  +  + IN  + +  S    A++     +I  CL  GA I++ +N    ALH A+  G ++I+  +  +       +N+VD N ++ LH         +AE L+   A +N  +    +PL+ +           S   + LLL   A V +KD   +  LHL +   +    +    +  Q IKE     L+   D++G  PLH AC   +    N L+    ++   + ++  P+H A   G +   + L+  +I    + NE + + +    LA ++GH  + + L  K   +   D  G   L +A   G    +K+IL  +     R +   +T LH AA+ G  K V  LLS  A++  N    + L +AL N+        + +  W   ++  F          IM+  +   E +   L+     ++ +KS   YH    F     P       A       E +TI     ++ + +L+ HP+    LL KW  +G    M +L ++   L   T ++    P +A    +++ G  + N T +  +   D                         + K  YF   +N +  ++Y+++I F   +  +    +QW  G IAI   W N + YLQ   N GI I+M + +  ++++   +F+ L++ + ++FY++   Q  F     S  + + M++G+++Y   FL+P F+    +  +    +  F++ + I L+NL++G+AVGDI  +   A +    +Q+   +  E  LP
Sbjct:   47 LEDFIKNRRKLSKYEDENLCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILAT-------ASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKE-----LVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQ-DISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLL-LKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQV-FTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMA----FNSTG--IINGTSSTHEERID-------------------------TLKRNYFLDYNNALEWVIYTTSIIFVLPLFLNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLP 964          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 169.088 bits (427), Expect = 9.739e-42
Identity = 136/512 (26.56%), Postives = 233/512 (45.51%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE 1786
            N    LH A+   N  +++ +L +   I+ K+  G T L  A +SG+ + V L+ ++K   +  + + G +P+ +A + + ++ VK LL Y A       D +  LH      H  + KLLL  + +P  +  NG +P+ +A     ++   L ++   + +    S +       +   LN        I+L  L+ GA  ++    G+ ALH+A+  G  E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  SA    Q+ V   L      L   A   L  KK  T LH+    G ++  +LL Q      ++   +S   NG  PLH+A   N  +I + L++ GA           P+H A+++GH ++V  L+D     I +  +     + LA Q    N+ + L     +  +  + G   L+ AC  G++ MV  +LK+  N+  +  +  TPLHQAAQ G T ++  LL  GA+
Sbjct:  244 NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLN--------IVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE-GQVDVASVL------LEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ------RRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKG-ANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAK 732          

HSP 2 Score: 165.622 bits (418), Expect = 1.034e-40
Identity = 166/607 (27.35%), Postives = 272/607 (44.81%), Query Frame = 2
Query:  230 IDENHPN-NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRGLEVISDTNSVNKS-LTKYHF 2038
            ID N  N N  N LH AA   +  L++ +L +  +++  + KG+TAL +A  +G AE V+++ K+ G  I+ Q + G TP+ +A + N ID+VK LL  GAN   +  DG   L   ++  H + + +LL      +V+    +  + +AA     ++  L +Q+  N+ +    ++N T   G++    A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G   V E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   NG  PLH+AC  N  K+   L+  GA++     +   PIH A   GHL IV  L+  N     + N      + +A ++G   +   L      + ++       L  A ++G   +V+L+L+   +      +  TPLH +A+ GQ  +   LL  GA     T    TPL +A      + AK+ L      ++     K G T +     KN+  IA+ LLN G E    TN+V K  +T  H 
Sbjct:   34 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKE-GANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPL----HMAAQGDHVECVKHLLQYKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAG---KNGYTPLHIAAKKNQMQIASTLLNYGAE----TNTVTKQGVTPLHL 614          

HSP 3 Score: 114.005 bits (284), Expect = 7.314e-25
Identity = 112/465 (24.09%), Postives = 191/465 (41.08%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMV 1660
            LH AA   +  + + +L K+ N N ++  G T L +A K    + + L+ K  G  I      G TPI +A  +  ++IV +LL  GA+P  +   G   LH   R+  +E+++ LL      + +     +P+ +A+ LG  E   L +Q + +         ++    GY+    + R  Q  +    L+ GA  +LA  +G   LH+A++ G  ++   L       +S   N  + LH+      + +A  LL   A  N   +  +TPL    +L SQ G    +  L   L+  A++ +  K   T LHL      +   ++L +   + +      +Y   G  PL VAC     K+ N+L+ +GAN+     N   P+H+A                                   Q GH +I   L     + ++    GN  L  A ++G I +V
Sbjct:  348 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY-GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHP--------DAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPL----HLASQEGHTDMVTLL---LDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRD------AYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAA----------------------------------QQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVV 756          

HSP 4 Score: 101.679 bits (252), Expect = 4.098e-21
Identity = 105/448 (23.44%), Postives = 185/448 (41.29%), Query Frame = 2
Query:  782 SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ--------------------------LIKEE-----EKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG----------------NNILMYACQVGDIGM-----------------VKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMG 1930
            + FL A R      ++E LK G DIN     G NALH+A++ G   ++ +L   G +++S     ++ALH+    G   V + L+   A++N  ++N  TPL  +A        E  +  +K LL N A+     +   T L + +  GH + + +L +                          L++ +     + + ++N   ++G  PLH+A       +   L++ GA +     N   P+H A+++G+  +VK L+D    QI  +  D    +  A +SGH  + E L  +   + ++ + G                 ++L Y   V D+ +                  KL+L K  N   R  +  TPLH A +  + K++E L+  GA +   T    TP+ +A    H N   + L +    +    R +T   HM 
Sbjct:   12 ASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQ-------ENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRG-GQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA-LHMA 450          

HSP 5 Score: 96.6709 bits (239), Expect = 1.312e-19
Identity = 121/502 (24.10%), Postives = 221/502 (44.02%), Query Frame = 2
Query:  356 STALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIR--YKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN--------INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTF-HQTPLTLA 1828
            + + L A ++GN + V    K  G++I+  ++ G   + LA +   + +V+ LL  G++   +   G   LH    +   E++K+L+    +   +  NG +P+ +AA   +++     ++ L+ +  N ++       +G++    A++  + Q   IL        + L       ALHIA+    ++    L  N  N        +N    +  + LH+  H G+++VA  LL   A V+   RN +TPL    ++ S+ G   +   +KLLL+    +  K +   T LH    SGH + +ELL       E++  L +   NG  PLH+A   +  +   +L+   A +     +    +H A   GH  + K L+D        R  +    + +A +     + E L      + +  E+G   +  A  +G + +V L+L+   +  + N    T LH AA+AGQ ++V  LL  GA +       QTPL +A
Sbjct:   11 NASFLRAARAGNLDKVVEYLK-GGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDV----VKYLLENGANQSTATE----DGFTPLAVALQQGHNQAVAILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPL----HVASKRG---NTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL------ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANP-NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIA 483          

HSP 6 Score: 69.3218 bits (168), Expect = 2.916e-11
Identity = 61/260 (23.46%), Postives = 106/260 (40.77%), Query Frame = 2
Query:  242 HPN----NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAAS----------------------LGYLEAFYLCIQ---SLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL 934
            HP+    N +  LH +A     ++   +L      +  + KG T L +A K G+ +  +L+ +++    D   + G TP+ +A + N + I   LL YGA        G+  LH   +  H +M+ LLL    +  +   +G++ + LAA                       LGY      C      ++N  +   + +N+    GY+    A +     II   L++GA  N     G  AL IA  +G+  ++  L
Sbjct:  501 HPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAA-DSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 759          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 160.999 bits (406), Expect = 3.329e-39
Identity = 140/545 (25.69%), Postives = 238/545 (43.67%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG------------NNI---------------------LMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE 1786
            N    LH A+   N  +++ +L +   I+ K+  G T L  A +SG+ + V L+ ++K   +  + + G +P+ +A + + ++ VK LL Y A       D +  LH      H  + KLLL  + +P  +  NG +P+ +A     ++   L ++   + +    S +       +   LN        I+L  L+ GA  ++    G+ ALH+A+  G  E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  SA    Q+ V   L      L   A   L  KK  T LH+    G ++  +LL Q      ++   +S   NG  PLHVA   + +K+   L+ +GA+      N   P+H A +K  ++I   L++   +  T+  +    L  LA Q GH ++   L  K   +H   ++G             N+                     L+ AC  G++ MV  +LK+  N+  +  +  TPLHQAAQ G T ++  LL  GA+
Sbjct:  265 NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLN--------IVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE-GQVDVASVL------LEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ------RRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLH-LASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAK 786          

HSP 2 Score: 157.147 bits (396), Expect = 4.460e-38
Identity = 148/548 (27.01%), Postives = 247/548 (45.07%), Query Frame = 2
Query:  230 IDENHPN-NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFL 1867
            ID N  N N  N LH AA   +  L++ +L +  +++  + KG+TAL +A  +G AE V+++ K+ G  I+ Q + G TP+ +A + N ID+VK LL  GAN   +  DG   L   ++  H + + +LL      +V+    +  + +AA     ++  L +Q+  N+ +    ++N T   G++    A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G   V E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   NG  PLH+AC  N  K+   L+  GA++     +   PIH A   GHL IV  L+  N     + N      + +A ++G   +   L      + ++       L  A ++G   +V+L+L+   +      +  TPLH +A+ GQ  +   LL  GA     T    TPL +A      + AK+ L
Sbjct:   55 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKE-GANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPL----HMAAQGDHVECVKHLLQYKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLL 583          

HSP 3 Score: 108.612 bits (270), Expect = 3.035e-23
Identity = 119/492 (24.19%), Postives = 198/492 (40.24%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLF-----------------QLIKEEEKQFLLN----------SYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMV 1660
            LH AA   +  + + +L K+ N N ++  G T L +A K    + + L+ K  G  I      G TPI +A  +  ++IV +LL  GA+P  +   G   LH   R+  +E+++ LL      + +     +P+ +A+ LG  E   L +Q + +         ++    GY+    + R  Q  +    L+ GA  +LA  +G   LH+A++ G  ++   L       +S   N  + LH+  H  +  VA  LL   A  +   +N  TPL  +A   +Q+ +  +L      LN  A+     K+  T LHL    GH + + LL                   L  +E+K  + +          +Y   G  PL VAC     K+ N+L+ +GAN+     N   P+H+A                                   Q GH +I   L     + ++    GN  L  A ++G I +V
Sbjct:  369 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY-GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHP--------DAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKK-NQMQIASTL------LNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAA----------------------------------QQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVV 810          

HSP 4 Score: 101.679 bits (252), Expect = 4.172e-21
Identity = 105/448 (23.44%), Postives = 185/448 (41.29%), Query Frame = 2
Query:  782 SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ--------------------------LIKEE-----EKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG----------------NNILMYACQVGDIGM-----------------VKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMG 1930
            + FL A R      ++E LK G DIN     G NALH+A++ G   ++ +L   G +++S     ++ALH+    G   V + L+   A++N  ++N  TPL  +A        E  +  +K LL N A+     +   T L + +  GH + + +L +                          L++ +     + + ++N   ++G  PLH+A       +   L++ GA +     N   P+H A+++G+  +VK L+D    QI  +  D    +  A +SGH  + E L  +   + ++ + G                 ++L Y   V D+ +                  KL+L K  N   R  +  TPLH A +  + K++E L+  GA +   T    TP+ +A    H N   + L +    +    R +T   HM 
Sbjct:   33 ASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQ-------ENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRG-GQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA-LHMA 471          

HSP 5 Score: 100.138 bits (248), Expect = 1.274e-20
Identity = 127/533 (23.83%), Postives = 233/533 (43.71%), Query Frame = 2
Query:  263 LLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIR--YKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN--------INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTF-HQTPLTLA 1828
            +++E A  K+    +F  S +     K    + + L A ++GN + V    K  G++I+  ++ G   + LA +   + +V+ LL  G++   +   G   LH    +   E++K+L+    +   +  NG +P+ +AA   +++     ++ L+ +  N ++       +G++    A++  + Q   IL        + L       ALHIA+    ++    L  N  N        +N    +  + LH+  H G+++VA  LL   A V+   RN +TPL    ++ S+ G   +   +KLLL+    +  K +   T LH    SGH + +ELL       E++  L +   NG  PLH+A   +  +   +L+   A +     +    +H A   GH  + K L+D        R  +    + +A +     + E L      + +  E+G   +  A  +G + +V L+L+   +  + N    T LH AA+AGQ ++V  LL  GA +       QTPL +A
Sbjct:    1 MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLK-GGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDV----VKYLLENGANQSTATE----DGFTPLAVALQQGHNQAVAILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPL----HVASKRG---NTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL------ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANP-NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIA 504          

HSP 6 Score: 70.4774 bits (171), Expect = 1.486e-11
Identity = 65/287 (22.65%), Postives = 121/287 (42.16%), Query Frame = 2
Query:  242 HPN----NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECL-KYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPL 1087
            HP+    N +  LH +A     ++   +L      +  + KG T L +A K G+ +  +L+ +++    D   + G TP+ +A   +   +  +LL  GA+P  +  +G   LH   + N +++   LL+           G++P+ LA+  G+ +   L +    N  ++  S + S         L+    + +  + + L K+GAD +     G   L +A   G  +++  L   G N+N+   N  + LH     G   +   LL + A  N    N  T L
Sbjct:  522 HPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAA-DSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTS---------LHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 798          

HSP 7 Score: 67.781 bits (164), Expect = 8.166e-11
Identity = 60/251 (23.90%), Postives = 101/251 (40.24%), Query Frame = 2
Query:  257 FNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAAS----------------------LGYLEAFYLCIQ---SLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL 934
            F  LH AA   + ++ + +L ++   +     G T L +A    N + V L+  +KG       + G TP+ +A + N + I   LL YGA        G+  LH   +  H +M+ LLL    +  +   +G++ + LAA                       LGY      C      ++N  +   + +N+    GY+    A +     II   L++GA  N     G  AL IA  +G+  ++  L
Sbjct:  564 FTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQK-VALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 156.377 bits (394), Expect = 3.762e-38
Identity = 138/545 (25.32%), Postives = 236/545 (43.30%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG---------------------------------NNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE 1786
            N    LH A+   N  +++ +L +   I+ K+  G T L  A +SG+ + V L+ ++K   +  + + G +P+ +A + + ++ VK LL Y A       D +  LH      H  + KLLL  + +P  +  NG +P+ +A     ++   L ++   + +    S +       +   LN        I+L  L+ GA  ++    G+ ALH+A+  G  E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  SA        E  +    +LL   A   L  KK  T LH+    G ++  +LL Q      ++   +S   NG  PLHVA   + +K+   L+ +GA+      N   P+H A +K  ++I   L++   +  T+  +    L  LA Q GH ++   L  K   +H   ++G                                    L+ AC  G++ MV  +LK+  N+  +  +  TPLHQAAQ G T ++  LL  GA+
Sbjct:  244 NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLN--------IVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAR-------EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ------RRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLH-LASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAK 765          

HSP 2 Score: 154.451 bits (389), Expect = 1.313e-37
Identity = 165/629 (26.23%), Postives = 271/629 (43.08%), Query Frame = 2
Query:  251 NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLN-----DNNWKNTM-------------------------EFRFKTGKTHMGYIIMKNE-DIANELLNRGLEVISDTNSVNK-SLTKYHF 2038
            N  N LH AA   +  L++ +L +  +++  + KG+TAL +A  +G AE V+++ K+ G  I+ Q + G TP+ +A + N ID+VK LL  GAN   +  DG   L   ++  H + + +LL      +V+    +  + +AA     ++  L +Q+  N+ +    ++N T   G++    A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G   V E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   NG  PLH+AC  N  K+   L+  GA++     +   PIH A   GHL IV  L+  N     + N      + +A ++G   +   L      + ++       L  A ++G   +V+L+L+   +      +  TPLH +A+ GQ  +   LL  GA     T    TPL +A      + AK+ L      D+  KN +                             K G T +     KN+  IA+ LLN G E    TN+V K  +T  H 
Sbjct:   42 NGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKE-GANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPL----HMAAQGDHVECVKHLLQYKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAE----TNTVTKQGVTPLHL 647          

HSP 3 Score: 105.145 bits (261), Expect = 2.763e-22
Identity = 119/492 (24.19%), Postives = 198/492 (40.24%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLF-----------------QLIKEEEKQFLLN----------SYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMV 1660
            LH AA   +  + + +L K+ N N ++  G T L +A K    + + L+ K  G  I      G TPI +A  +  ++IV +LL  GA+P  +   G   LH   R+  +E+++ LL      + +     +P+ +A+ LG  E   L +Q + +         ++    GY+    + R  Q  +    L+ GA  +LA  +G   LH+A++ G  ++   L       +S   N  + LH+  H  +  VA  LL   A  +   +N  TPL  +A   +Q+ +  +L      LN  A+     K+  T LHL    GH + + LL                   L  +E+K  + +          +Y   G  PL VAC     K+ N+L+ +GAN+     N   P+H+A                                   Q GH +I   L     + ++    GN  L  A ++G I +V
Sbjct:  348 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY-GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHP--------DAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAK-KNQMQIASTL------LNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQA----------------------------------AQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVV 789          

HSP 4 Score: 98.5969 bits (244), Expect = 2.618e-20
Identity = 106/435 (24.37%), Postives = 182/435 (41.84%), Query Frame = 2
Query:  782 SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSA--NLISQI------GVEKSLA----------FLKXXXXXXADVKLKDKKKQTI----LHLLIASGHIETIELLFQLIKEEEKQ--FLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG----------------NNILMYACQVGDIGM-----------------VKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKT 1912
            + FL A R      ++E LK G DIN     G NALH+A++ G   ++ +L   G +++S     ++ALH+    G   V + L+   A++N  ++N  TPL  +A  N I  +      G  +S A           L+   N    + L++  K  +    LH+       ++  LL Q     + Q   ++N   ++G  PLH+A       +   L++ GA +     N   P+H A+++G+  +VK L+D    QI  +  D    +  A +SGH  + E L  +   + ++ + G                 ++L Y   V D+ +                  KL+L K  N   R  +  TPLH A +  + K++E L+  GA +   T    TP+ +A    H N   + L +    +    R +T
Sbjct:   12 ASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRG-GQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGET 445          

HSP 5 Score: 92.4337 bits (228), Expect = 2.083e-18
Identity = 151/643 (23.48%), Postives = 266/643 (41.37%), Query Frame = 2
Query:  362 ALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIR--YKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN--------INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVA-------CSNNL--------------------------RKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLI--DLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMK--NEDIANELLNRGLEVISDTNSVNKSLTKYH-----------FFMLDAGPYDSASVNSRYTEFMTIAK 2113
            + L A ++GN + V    K  G++I+  ++ G   + LA +   + +V+ LL  G++   +   G   LH    +   E++K+L+    +   +  NG +P+ +AA   +++     ++ L+ +  N ++       +G++    A++  + Q   IL        + L       ALHIA+    ++    L  N  N        +N    +  + LH+  H G+++VA  LL   A V+   RN +TPL    ++ S+ G   +   +KLLL+    +  K +   T LH    SGH + +ELL       E++  L +   NG  PLH+A       C  +L                           ++   L+ + AN      N   P+H A +K  +++++ L+    +IQ IT   E     I +A   GH NI   L          +  G   L  A + G + +V+ +L+    +  R   + TPLH A++ G+T++V+ LL   A     T +  TPL ++      + A V L      +      K G T + ++  K  + D+A  LL R     +D+   N  LT  H             +L+ G    A+  + YT     AK
Sbjct:   13 SFLRAARAGNLDKVVEYLK-GGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHID----VVKYLLENGANQSTATE----DGFTPLAVALQQGHNQAVAILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPL----HVASKRG---NTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLL------ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAIT---ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHS---LATKKGFTPL-HVAAKYGSLDVAKLLLQR--RAAADSAGKN-GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAK 617          

HSP 6 Score: 66.2402 bits (160), Expect = 2.201e-10
Identity = 65/287 (22.65%), Postives = 121/287 (42.16%), Query Frame = 2
Query:  242 HPN----NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECL-KYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPL 1087
            HP+    N +  LH +A     ++   +L      +  + KG T L +A K G+ +  +L+ +++    D   + G TP+ +A   +   +  +LL  GA+P  +  +G   LH   + N +++   LL+           G++P+ LA+  G+ +   L +    N  ++  S + S         L+    + +  + + L K+GAD +     G   L +A   G  +++  L   G N+N+   N  + LH     G   +   LL + A  N    N  T L
Sbjct:  501 HPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTS---------LHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 777          

HSP 7 Score: 65.4698 bits (158), Expect = 3.423e-10
Identity = 60/251 (23.90%), Postives = 101/251 (40.24%), Query Frame = 2
Query:  257 FNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAAS----------------------LGYLEAFYLCIQS---LMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL 934
            F  LH AA   + ++ + +L ++   +     G T L +A    N + V L+  +KG       + G TP+ +A + N + I   LL YGA        G+  LH   +  H +M+ LLL    +  +   +G++ + LAA                       LGY      C      ++N  +   + +N+    GY+    A +     II   L++GA  N     G  AL IA  +G+  ++  L
Sbjct:  543 FTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDN-QKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q7Z020|TRPA1_DROME (Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=4)

HSP 1 Score: 196.823 bits (499), Expect = 6.299e-50
Identity = 221/984 (22.46%), Postives = 406/984 (41.26%), Query Frame = 2
Query:  269 HEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQ--DRKGQTPIDLACRLNMIDIVKILLYYG--ANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKL-----CDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIET--IELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKN-TMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAK------------YRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMN------------------------------SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDP---MCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIV-------NRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXM---VGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            H+AA      +L +I  +  + N K   G+T L +AV+S   + +  +     + +D    + K Q P+ LA  LN +  ++++  Y    +  +    G   LH     +H E  ++L+      P    NNG  PI  AA     +   +  Q           +I+  D EG     +A+       +  CLK GA I+  Q++    +H+A   G  +I+  +      +  + ++  D    + LH         +   L+   A +N  ++   +PLL +A   S+ G +     ++L     A + +KD   + +LH +I +G   T   E +     + + + LLN  D  G  PLH A  +   +    LI  GA + L N N   P+H A R G    V+ L+D       I   D A +  L +  Q GH  + + L  +   +H +D TG N L  A   G    ++L+     +L    +   +T LH A    +   +  L+S+G ++  N    + +  A+  ++   A   +      N  M  R          +I     +   + ++ +   +          KY F  L   P+  A ++ +  E +T A             + + +L+ HPLS   L  KW  +G +F + +L+ +  +L F T      M  I             DN T ++  ++   ++TMN                               ++ ++  L  + E ++   QKL Y     N +  ++Y SA+        P   + TI +S  +IA+ L W  ++ +LQ     GI ++MF  ++ ++IK++++F  L+I + +AFYI+         N   F N   S  + + M++GELD+V  +++  ++    + +    + S+ + +  I LM   +G+AVGDI+ +  +A++    +Q+   +E E  LP
Sbjct:   95 HQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLL---SIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAA---SRSGWKTVHLLIRLG----ACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLH-RDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQC-PFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAG--------DNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP 1058          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. UniProt/SwissProt
Match: sp|O75762|TRPA1_HUMAN (Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=TRPA1 PE=1 SV=3)

HSP 1 Score: 187.963 bits (476), Expect = 3.263e-47
Identity = 226/962 (23.49%), Postives = 413/962 (42.93%), Query Frame = 2
Query:  329 NINK----KSCKGSTALLL--AVKSGNAECVRLICKQKGMEI-DGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLL-HAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNS---------KINIASVINSTDC----------EGYSC-----FLN---------AIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEF---RFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSAS-------VNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIM-----SMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAK--VKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFK---IFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            N NK    K C       L  A   G  E +  I +   +E+    D  G TP+  A   N I+ VK LL  GANP    ++ M  LH  ++  + E++K+LL H      ++  NG + + +A +    EA  + ++               I+ A+   S +C           GYS      F+N         A++     +I  CL  GA I+  +     A+H A+  G +EI+  +  +      + N  D      +H  SL     +A+ L+   A +N  +    +PL+ +           S   + LLL+  A V +KD   +  LHL +   +     L  + ++ ++ + L+   D++G  PLH AC        N L+    ++   + ++  P+H A   G +   + L+  +I    + NE + + +    LA ++GH  + + L  K   +   D  G   L +A   G    +K+IL  +     R +   +T LH AA+ G  K V  LLS  A++  N    + L LAL N+        +    W   ++         K  +  +I    +    LL+  +   ++  S      +Y+F  L   P +          +    T    + +  + +L+ HP+    LL KW  +G    M +L ++   L   T ++ +  P +A    +++ G   + S  +++   T+S +    ++     S+FG+ +   E+ +   QK  YF   SN +  ++Y++ I F     V+ P   +QW  G IA+   W N + YLQ   N GI I+M + ++ ++++  ++F+ L++ + ++FYI+   Q PF +   S  + + M++G+++Y   FL+P  +       +    +  F+I + I L+NL++G+AVGDI  +   A +    +Q+   +  E  LP
Sbjct:   49 NFNKQKKLKRCDDMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILAT-------ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPY-GLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQ-DISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLL-LKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQC-PLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMA----FNSTGIINETSDHSEILDTTNSYLIKTCMILVFLSSIFGYCK---EAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIP-AHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLP 991          

HSP 2 Score: 105.531 bits (262), Expect = 1.321e-21
Identity = 115/475 (24.21%), Postives = 194/475 (40.84%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDG-----------------------------------------MCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHL------GIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGH 1549
            LH A      E ++F+LS+  N N ++      L +AV+  N E ++++ + + ++++ +   G T + +AC  N  + ++ILL  GA P KS   G                                            LH  +++  LEMIK+ L      +  +    + I  AA+ G  E   L I S   S      ++N+TD    +    A  +    +    +  GADIN   +EG++ L +A+      I+  L   G  ++  DN   + LHL      G+ N      +   +    ++  N    TPL  +        V   L F       N  +  K K K++ LH   + G I T + L Q I +     LLN  D +G  PLH+A  N   K+   L+ +GA L L ++N    +H A+  G+ + +K ++D N++     +ED    +  A + GH
Sbjct:  102 LHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGS----VDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDG-CTPLHYACRQGGPGSVNNLLGF-------NVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTR---LLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGH 560          

HSP 3 Score: 69.3218 bits (168), Expect = 1.756e-10
Identity = 66/277 (23.83%), Postives = 124/277 (44.77%), Query Frame = 2
Query:  263 LLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACR------------LNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN-INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHV 1054
            +LH A++  + EL ++++S   +INK   +G + L+LA  S +   V L+   KG ++D +D  G+  + L  +            + M  I +++       M  + DG   LH+  R      +  LL    S   K  +  SP+  AAS G +      +Q + ++++     +N  D  G +    A +     ++   LK GA + L+ + G  ALH AS  G+++ +  + D  +   + +D + ++ALH     G       LL ++A +
Sbjct:  312 MLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLL-SKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELV-------MDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRL-----LNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADI 574          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q8BLA8|TRPA1_MOUSE (Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus OX=10090 GN=Trpa1 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.025e-47
Identity = 229/970 (23.61%), Postives = 421/970 (43.40%), Query Frame = 2
Query:  224 QYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCK--------GSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYD-GMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN----INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGH----IETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHF---FMLDAGPYD----SASVNSRYTEFMTI----AKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGC--PVDNSTDNKLKSLTDSEITMNSIM----SMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKV-KDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFK---IFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            +Y DEN        LH AA     EL+E I      IN  SC+        G+T L  A +    E V+ +  Q G   + ++R   +P+ +A      +++K+L  + A  +  E + G   L      ++ E +++LL         +  G  P+  AA  G  +   L +     +  +  + IN  + +  S    A++     +I  CL  GA I++ +N    ALH A+  G ++I+  +  +       +N+VD N ++ LH         +AE L+   A +N  +    +PL+ +           S   + LLL   A V +KD   +  LHL +   +    +    +  Q IKE     L+   D++G  PLH AC   +    N L+    ++   + ++  P+H A   G +   + L+  +I    + NE + + +    LA ++GH  + + L  K   +   D  G   L +A   G    +K+IL  +     R +   +T LH AA+ G  K V  LLS  A++  N    + L +AL N+        + +  W   ++  F          IM+  +   E +   L+     ++ +KS   YH    F     P       A       E +TI     ++ + +L+ HP+    LL KW  +G    M +L ++   L   T ++    P +A    +++ G      ++ + ++ +L    I +  I+    S+FG+ +   E ++   QK  YF   +N +  ++Y+++I F   +  +    +QW  G IAI   W N + YLQ   N GI I+M + +  ++++   +F+ L++ + ++FY++   Q  F     S  + + M++G+++Y   FL+P F+    +  +    +  F++ + I L+NL++G+AVGDI  +   A +    +Q+   +  E  LP
Sbjct:   59 KYEDEN-----LCPLHHAAAEGQVELMELI------INGSSCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQ-GANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILAT-------ASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKE-----LVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQ-DISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLL-LKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQV-FTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMA----FNSTGIINGTSSTHEERIDTLNSFPIKICMILVFLSSIFGYCK---EVIQIFQQKRNYFLDYNNALEWVIYTTSIIFVLPLFLNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLP 994          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q6RI86|TRPA1_RAT (Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Trpa1 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.589e-46
Identity = 233/970 (24.02%), Postives = 419/970 (43.20%), Query Frame = 2
Query:  224 QYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCK--------GSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYD-GMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGIN----INSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGH----IETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHF---FMLDAGPYDSASVNSRYT-------EFMTI----AKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIA-DSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIM--SMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKV-KDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFK---IFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            +Y DEN       LLH AA     EL++ I      IN  SC+        G+T L  A +    E V+ +  Q G   + ++R    P+ +A +    +++K+L  + A  +  E + G   L      ++ E +++LL         +  G  P+  AA  G      L +     +  +  + IN  + +  S    A++     +I  CL  GA I++ +N    ALH A+  G ++I+  +  +       +N+VD N ++ LH         +A+ L+   A +N  +    +PL+ +           S   + LLL+  A V +KD   +  LHL +   +    +    L  Q IKE     L+   D++G  PLH AC        N L+    ++   + ++  P+H A   G +   + L+  +I    + NE + + +    LA ++GH  + + L  K   +   D  G   L +A   G    +K+IL  +     R +   +T LH AA+ G  K V  LLS  A++  N    + L +AL N+        +    W   ++  F          IM+  +   E +   L+     ++ +KS   YH    F     P    S+  + T       E +TI     ++ + +L+ HP+    LL KW  +G    M +L ++   L   T ++    P +A +S    N+         N L S    +I M  +   S+FG+ +   E ++   QK  YF   +N +  ++Y++++ F   +  D    +QW  G IAI   W N + YLQ   N GI I+M + +  ++++   +F+ L++ + ++FY++   Q  F     S  + + M++G+++Y   FL+P F+    +  +    +  F++ + I L+NL++G+AVGDI  +   A +    +Q+   +  E  LP
Sbjct:   59 KYEDEN-----LCLLHHAAAEGQVELMQLI------INGSSCEALNVMDDYGNTPLHWAAEKNQVESVKFLLSQ-GANPNLRNRNMMAPLHIAVQGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKRCMELILAYGEKTGYSREAHINFVNHKKASPLHLAVQSGDLDMIKMCLDSGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLADYLISVGADINSTDSEGRSPLILAT-------ASASWNIVNLLLSKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFLQMQHIKE-----LVMDEDNDGCTPLHYACRQGAPVSVNNLLRFNVSVHSKSKDKKSPLHFAASYGRINTCQRLLQ-DISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLL-LKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRSKRWDECLQV-FTHDSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPL---SMTKKVTPTQDVIYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAFNSTGIINETISTHEERINTLNSFP-LKICMILVFLSSIFGYCK---EVVQIFQQKRNYFLDYNNALEWVIYTTSMIFVLPLFLDIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLP 994          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q18297|TRPA1_CAEEL (Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans OX=6239 GN=trpa-1 PE=2 SV=5)

HSP 1 Score: 182.185 bits (461), Expect = 2.315e-45
Identity = 232/1106 (20.98%), Postives = 454/1106 (41.05%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKP-NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRL--NMIDIVKILLYYGANPMK-----------------SEYD-----GMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIA-------SVINSTDCEGYSCFL---------------NAIRYKQRTIILECLKYGADINLA---QNEGKNA----------LHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHA-HVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLF-----------------------QLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTM---------EFRFKTG---KTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLD--------------------AGPYD-----SASVNSRYTEFMTIAKYRKEKLIL---------HPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIA--------DSPDYD-NQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCT------IQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYF----LDPGFKIF----TAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQ-----AKFYEPVFVYKQMRRSVFQRFFS 3088
            +N  +++H++A   N   L+  L K P  +N +     T L  A + GN + V+L+  +  +  + ++R+G TP+ +A +      DI  I+    A+  +                 +E D      +  LH+    ++   +  L+  K   + +D+N ++P+ LA   G  E     IQ L+ +  N+        +V +     G   +L               N    +++T +   ++      L    Q E KN+          +H A+E G+ E++  L + G N N ++      LH+      L V   L+     +++V +   LTPL+ +    S+  VE  +A         A++ + DK ++T + +      + ++E +                        +++ E+ ++ ++N  D + + P+H+  SN   ++   L   GA++   N +E   +H A   G    V+ L++ +I+ + +++E   + + LA +SGH    + L     +  +K+      L  A   G +   + ++ K   ++  +    T LH AA  G   +V Y ++ G  +   +   +T   +A +N H + A+ FL  + WKN M         + R       +T    ++ K  ++A+ +++  +E   +     +S+  Y+F  LD                       YD          S  + +  + KY   KL+          HPLS  LL  KW R G   +   L  +L ++   T  + H   P          DS  +D N+ CP  N+        T  ++    I+      +++ E  +   +K  Y     N++   +YS+A+       +   T       QW    + I   W N++F ++ +P FGI ++MF ++V +  +   +F+  +I ++ +FY++ +N+  F   + S  K   M+IGE ++   F         K+F    TA+   L   F I+++I L+NL+VG+AV DI  +   A++    +Q+  + + E+ L   +Q     A      F Y ++ ++ F  ++S
Sbjct:   48 DNLRSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALP-NTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLACVHGSQE----IIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIA-------KKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIE-SSSDTKTVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCIEKSKEETDSTQSVA-YNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLTQYVRHTKAPYNVWNEESYYDSEYFDENETCPQINT--------TKPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQRTKKYATCRYATFPYGKLHKTGFAGWWS 1131          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. TrEMBL
Match: A0A267FPG6 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025935g2 PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.238e-103
Identity = 265/939 (28.22%), Postives = 462/939 (49.20%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKE--EEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLID----LNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAA--QAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKS-LTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMP-PIADSPDYDNQ-GC---PVDNSTDNKLKSLTDSEITMNSIMSMFGFL--RLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYE 3034
            LH A  S    ++  ++    N+N K  +GS  L +A        ++ +   + + +D  D +GQT + +ACR N  ++V+ILL + ANP   E DG   LH P R N+L++ ++L +       +D +G++P+ +AAS    E     +     S  NI  ++N  D EG S    A R  + ++I      GADIN+   E    LH AS +G  E + KL + G + N  D    + LH    +    +   LL   +     +   +TP   +    +Q+     LA   L +    D++++     T LH  + +G IE +  L     E  E  + +LN+ D    YP+H A      ++   L+S GA+  + +     P+  A + G +E+V+++ +    L  Q +  R+      +++A + GH  +FE+L  +  +   KDE G   LM +   G   +  +++ K  ++   +  ++T LH A   +      VE LL  GA++ +N   +TP+ +A+ N +    ++F +D +    M +R + G TH+  +I  +   A  +LN+ +   S  + ++K+ +  Y+F  LD GP D AS + RY    T+ K R+ +L+ HP+   L+ +KW     FFW  DL+ +  +L   T  +    P P+ +    D Q GC     D  +    + LT+  + +   + + G L  RL+ E++K   ++LQYFK   N+  +++Y     F        C   W  G  ++I+ W  ++F  + +P  GI  LMF+ V+ S++K++++F   +IG+A+AF I    QTPF+   +S  K +DM +GELD+V+YF+   +       L++  +F I++ I L+NL+VGIAVGDID +  +A + +  ++IT   E E+ LPR  Q + + 
Sbjct:  178 LHYAVKSDRVGVVAALIQAGANVNMKGREGSRPLHVAANFNQIGALKELLSSRKVRVDATDDRGQTALHVACRRNHEEVVQILLGHKANPQLKELDGTSVLHLPSRRNNLQLCQILTNDTALISCRDKHGVTPLMVAASESGEELLSHFVSVCKLSDKNIVQMLNIKDAEGNSAMHYAARSDKPSMIQGLKNCGADINIRNLENSTPLHAASALGHKESVIKLLELGADPNQQDKLGRTPLHSCAISKQEEICGILLKAGSDPQAADAEFMTPFHWACRR-NQLNEAAHLADADLDVIAATDIQMR-----TGLHWAVLAGSIELVNYLLDKAAELPEGCETVLNASDAQDKYPVHYAVEVGNTELLVALLSRGADFHVVDMEGRTPVQLAVKMGCIELVQNIFEHSEKLKHQALKHRDMSGMTSLLIAAEQGHSELFEYLLEQGADFMVKDEIGRTALMLSVGSGHHEIASVMIDKGVDVNASDSSRNTALHYACKHEDSDASCVELLLKNGAQLQQNYNGETPVDVAVLNNNNPAIQLFFSDAHRTWVMTYRKENGYTHLDVLIQHSPQTAELILNQAM-TESGADHMDKNFMVVYNFTDLDPGPDDPASAHRRYLALRTMVKRRRVELLEHPVCQALIESKWAVARYFFWF-DLLCYAVFLCCLTAFVADNGPLPLWE---IDTQTGCRNYTTDGVSSGTRQKLTNPTLILEKAI-VIGILSIRLVIETVKVAFKRLQYFKNYENFFFIVLYIFTFIFVYPPDSEPCQYNWICGMFSVIMAWCLLIFQFEHLPKIGIYSLMFQQVIVSLVKVLVIFSFCIIGFALAFNIGMVAQTPFKYITYSILKTFDMTVGELDFVTYFISNSYGGMQTGLLVVFVIFVIIMPIGLMNLLVGIAVGDIDGISKEASLKLIDIRITLFYELETNLPRYFQRRLHR 1104          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. TrEMBL
Match: A0A267E899 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025935g1 PE=3 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 5.725e-103
Identity = 264/939 (28.12%), Postives = 461/939 (49.09%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKE--EEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLID----LNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAA--QAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKS-LTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMP-PIADSPDYDNQ-GC---PVDNSTDNKLKSLTDSEITMNSIMSMFGFL--RLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYE 3034
            LH A  S    ++  ++    N+N K  +GS  L +A        ++ +   + + +D  D +GQT + +ACR N  ++V+ILL + ANP   E DG   LH P R N+L++ ++L +       +D +G++P+ +AAS    E     +     S  NI  ++N  D EG S    A R  + ++I      GADIN+   E    LH AS +G  E + KL + G + N  D    + LH    +    +   LL   +     +   +TP   +    +Q+     LA   L +    D++++     T LH  + +G IE +  L     E  E  + +LN+ D    YP+H A      ++   L+S GA+  + +     P+  A + G +E+V+ + +    L  Q +  R+      +++A + GH  +F++L  +  +   KDE G   LM +   G   +  +++ K  ++   +  ++T LH A   +      VE LL  GA++ +N   +TP+ +A+ N +    ++F +D +    M +R + G TH+  +I  +   A  +LN+ +   S  + ++K+ +  Y+F  LD GP D AS + RY    T+ K R+ +L+ HP+   L+ +KW     FFW  DL+ +  +L   T  +    P P+ +    D Q GC     D  +    + LT+  + +   + + G L  RL+ E++K   ++LQYFK   N+  +++Y     F        C   W  G  ++I+ W  ++F  + +P  GI  LMF+ V+ S++K++++F   +IG+A+AF I    QTPF+   +S  K +DM +GELD+V+YF+   +       L++  +F I++ I L+NL+VGIAVGDID +  +A + +  ++IT   E E+ LPR  Q + + 
Sbjct:  178 LHYAVKSDRVGVVAALIQAGANVNMKGREGSRPLHVAANFNQIGALKELLSSRKVRVDATDDRGQTALHVACRRNHEEVVQILLGHKANPQLKELDGTSVLHLPSRRNNLQLCQILTNDTALISCRDKHGVTPLMVAASESGEELLSHFVSVCKLSDKNIVQMLNIKDAEGNSAMHYAARSDKPSMIQGLKNCGADINIRNLENSTPLHAASALGHKESVMKLLELGADPNQQDKLGRTPLHSCAISKQEEICGILLKAGSDPQAADAEFMTPFHWACRR-NQLNEAAHLADADLDVIAATDIQMR-----TGLHWAVLAGSIELVNYLLDKAAELPEGCETVLNASDAQDKYPVHYAVEVGNTELLVALLSRGADFHVVDMEGRTPVQLAVKMGCIELVQKIFEHSEKLKHQALKHRDMSGMTSLLIAAEQGHSELFDYLLEQGADFMVKDEIGRTALMLSVGSGHHEIASVMIDKGVDVNASDSSRNTALHYACKHEDSDASCVELLLKNGAQLQQNYNGETPVDVAVLNNNNPAIQLFFSDAHRNWVMTYRKENGYTHLDVLIQHSPQTAELILNQAM-TESGADHMDKNFMVVYNFTDLDPGPDDPASAHRRYLALRTMVKRRRVELLEHPVCQALIESKWAVARYFFWF-DLLCYAVFLCCLTAFVADNGPLPLWE---IDTQTGCRNYTTDGVSSGTRQKLTNPTLILEKAI-VIGILSIRLVIETVKVAFKRLQYFKNYENFFFIVLYIFTFIFVYPPDSEPCQYNWICGMFSVIMAWCLLIFQFEHLPKIGIYSLMFQQVIVSLVKVLVIFSFCIIGFALAFNIGMVAQTPFKYITYSILKTFDMTVGELDFVTYFISNSYGGMQTGLLVVFVIFVIIMPIGLMNLLVGIAVGDIDGISKEASLKLIDIRITLFYELETNLPRYFQRRLHR 1104          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. TrEMBL
Match: A0A267G9R9 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000210g4 PE=3 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 2.812e-99
Identity = 263/936 (28.10%), Postives = 461/936 (49.25%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIAS-VINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLN--IQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQ-AGQT-KMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMP-PIA--DSPDYDNQGCPVDNST--DNKLKSLTDSEITMN-SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYE 3034
            LH A      +++  ++    N+N K  +GS  + +A     ++ +R I K +   +D  D +GQT + +ACR N    VKILL + AN    E DG   LH P R N+LE+ ++L         KD  G++P+ +AA+ G  +     I     +    A  +++  D EG S    A +  +   I    ++G +++L   E    +H+A+ +G  E + KL   G   N  D N  + LH  I    L + + LL+  A     + + +TPL    +   + G+ +  A  +LL  +   + L D   +T LH  + +  ++ +ELL     + ++    N+ D +  YP+H A   N  ++   L++ GA+    +         A + GH  +V+D+  L   I++  +R+ D   +  +++A + GH  +  FL  +  +  +KDE G   LM +C  G   +V  ++ K  ++   + +++T LH A + AG + + +E LLS GA++ +N   +TP+ +A+ N +     +  +D      M +R  TG +HM  +I  +   A  +LNR +      N     +  ++FF LD GP D AS  +RY    T+ + ++E L+ HPL   LL  KW     FFW  D   +  +L   T  +    P PI+  D+    N GC   +S+    + + LT+  + +  S++  F  +RL+ E +K + ++LQY K   N   + +Y     F        C   W FG  ++IL W  ++F  + +P  GI  LMF+ V+ S++K++L+F   +IG+ +AF I   +QTPF+   +S  K +DM +GE+++V+YF+           L++  +F +++ I L+NL+VGIAVGDI+ +  +A + +  ++I  + E E+ LPR  Q + Y 
Sbjct:   94 LHYAVKCNRVDMVSLLMQAGANVNIKGREGSRPIHVAANFNQSDALREILKSRRTRVDATDDRGQTALHVACRRNHEPSVKILLSHKANSQLKELDGTSVLHLPSRRNNLELCQMLTTDTGLITCKDKYGVTPLMVAAAEGSEDLLNYFISVCKKTTHGAAGRILDMQDSEGNSSVHFAAKNDKFLAIEILSEHGVNLDLQNLEQSAPIHLAATLGHRESVAKLIHLGALPNLSDKNGRTPLHCCIIARQLEICDTLLLAGAQSRAADEDFMTPL----HWACRRGLTQ--AARRLLRVDPGCLSLVDIHMRTGLHWAVLACAVDLVELLLAQAGDSDES--ANASDFHDKYPVHYAVEMNDSQLVRILLTHGADFHAVDTEGRTATQLAVKLGHEGLVRDICGLGQYIKRQALRHRDLRGVTSLLIAAEHGHTRVLHFLLEQGADFTAKDEFGRTALMLSCGGGHSDIVATMIDKGVDVNASDANRNTALHYACKHAGSSARSLELLLSNGAQLQQNYNGETPVDVAVLNNNGPAISLLFSDAYCDWVMSYRKDTGMSHMDILIQHSPQTALTILNRSMTKSRADNFEKNFMVTHNFFYLDPGPDDPASKPNRYLGLRTMVERQREDLLKHPLCAALLEYKWSFTRYFFW-CDFFFYAVFLCCLTAFVADQGPLPISLVDA----NTGCRNTSSSGGSGQRQKLTNGRLILEKSVVIGFLCVRLVLEFIKLVFKRLQYLKNYENLFFVTLYILTFVFIYPPDSEPCIDNWIFGIFSVILAWCLLIFQFEHLPVTGIYSLMFQKVIISLVKVLLIFAFFIIGFGLAFNIGLVSQTPFKYPMYSILKTFDMTVGEMEFVTYFISGTSGRMQLALLVVFVIFVVVMPIGLMNLLVGIAVGDIEGISKEAGLRLVEIRINLVYEMETNLPRYFQRRLYR 1016          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. TrEMBL
Match: A0A267H4S2 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000210g3 PE=3 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.263e-98
Identity = 262/936 (27.99%), Postives = 461/936 (49.25%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIAS-VINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLN--IQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQ-AGQT-KMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMP-PIA--DSPDYDNQGCPVDNST--DNKLKSLTDSEITMN-SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYE 3034
            LH A      +++  ++    N+N K  +GS  + +A     ++ +R +   +   +D  D +GQT + +ACR N    VKILL + AN    E DG   LH P R N+LE+ ++L         KD  G++P+ +AA+ G  +     I     +    A  +++  D EG S    A +  +   I    ++GA+++L   E    +H+A+ +G  E + KL   G   N  D N  + LH  I    L + + LL+  A     + + +TPL    +   + G+ +  A  +LL  +   + L D   +T LH  + +  ++ +ELL     + ++    N+ D +  YP+H A   N  ++   L++ GA+    +         A + GH  +V+D+  L   I++  +R+ D   +  +++A + GH  +  FL  +  +  +KDE G   LM +C  G   +V  ++ K  ++   + +++T LH A + AG + + +E LLS GA++ +N   +TP+ +A+ N +     +  +D      M +R  TG +HM  +I  +   A  +LNR +      N     +  ++FF LD GP D AS  +RY    T+ + ++E L+ HPL   LL  KW     FFW  D   +  +L   T  +    P PI+  D+    N GC   +S+    + + LT+  + +  S++  F  +RL+ E +K + ++LQY K   N   + +Y     F        C   W FG  ++IL W  ++F  + +P  GI  LMF+ V+ S++K++L+F   +IG+ +AF I   +QTPF+   +S  K +DM +GE+++V+YF+           L++  +F +++ I L+NL+VGIAVGDI+ +  +A + +  ++I  + E E+ LPR  Q + Y 
Sbjct:   94 LHYAVKCNRVDMVSLLMQAGANVNIKGREGSRPIHVAANFNQSDALRELLNSRRTRVDATDDRGQTALHVACRRNHEPSVKILLSHKANSQLKELDGTSVLHLPSRRNNLELCQMLTTDTGLITCKDKYGVTPLMVAAAEGSEDLLNYFISVCKKTTHGAAGRILDMQDSEGNSSVHFAAKNDKFLAIEILSEHGANLDLQNLEQSAPIHLAATLGHRESVAKLIHLGALPNLSDKNGRTPLHCCIIARQLEICDTLLLAGAQSRAADEDFMTPL----HWACRRGLTQ--AARRLLRVDPGCLSLVDIHMRTGLHWAVLACAVDLVELLLAQAGDSDES--ANASDFHDKYPVHYAVEMNDSQLVRILLTHGADFHAVDTEGRTATQLAVKLGHEGLVRDICGLGQYIKRQALRHRDLRGVTSLLIAAEHGHTRVLHFLLEQGADFTAKDEFGRTALMLSCGGGHSDIVATMIDKGVDVNASDVNRNTALHYACKHAGSSARSLELLLSNGAQLQQNYNGETPVDVAVLNNNGPAISLLFSDAYCDWVMSYRKDTGMSHMDILIQHSPQTALTILNRSMTKSGADNLEKNFMVTHNFFYLDPGPDDPASKPNRYLGLRTMVERQREDLLKHPLCAALLEYKWSFTRYFFW-CDFFFYAVFLCCLTAFVADQGPLPISLVDA----NTGCRNTSSSGGSGQRQKLTNGRLILEKSVVIGFLCVRLVLEFIKLVFKRLQYLKNYENLFFVTLYILTFVFIYPPDSEPCIDNWIFGIFSVILAWCLLIFQFEHLPVTGIYSLMFQKVIISLVKVLLIFAFFIIGFGLAFNIGLVSQTPFKYPMYSILKTFDMTVGEMEFVTYFISGTSGRMQLALLVVFVIFVVVMPIGLMNLLVGIAVGDIEGISKEAGLRLVEIRINLVYEMETNLPRYFQRRLYR 1016          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. TrEMBL
Match: A0A267EGL5 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000210g1 PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 2.897e-98
Identity = 261/936 (27.88%), Postives = 460/936 (49.15%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIAS-VINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLN--IQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQ-AGQT-KMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMP-PIA--DSPDYDNQGCPVDNST--DNKLKSLTDSEITMN-SIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYE 3034
            LH A      +++  ++    N+N K  +GS  + +A     ++ +R +   +   +D  D +GQT + +ACR N    VKILL + AN    E DG   LH P R N+LE+ ++L         KD  G++P+ +AA+ G  +     I     +    A  +++  D EG S    A +  +   I    ++G +++L   E    +H+A+ +G  E + KL   G   N  D N  + LH  I    L + + LL+  A     + + +TPL    +   + G+ +  A  +LL  +   + L D   +T LH  + +  ++ +ELL     + ++    N+ D +  YP+H A   N  ++   L++ GA+    +         A + GH  +V+D+  L   I++  +R+ D   +  +++A + GH  +  FL  +  +  +KDE G   LM +C  G   +V  ++ K  ++   + +++T LH A + AG + + +E LLS GA++ +N   +TP+ +A+ N +     +  +D      M +R  TG +HM  +I  +   A  +LNR +      N     +  ++FF LD GP D AS  +RY    T+ + ++E L+ HPL   LL  KW     FFW  D   +  +L   T  +    P PI+  D+    N GC   +S+    + + LT+  + +  S++  F  +RL+ E +K + ++LQY K   N   + +Y     F        C   W FG  ++IL W  ++F  + +P  GI  LMF+ V+ S++K++L+F   +IG+ +AF I   +QTPF+   +S  K +DM +GE+++V+YF+           L++  +F +++ I L+NL+VGIAVGDI+ +  +A + +  ++I  + E E+ LPR  Q + Y 
Sbjct:   94 LHYAVKCNRVDMVSLLMQAGANVNIKGREGSRPIHVAANFNQSDALRELLNSRRTRVDATDDRGQTALHVACRRNHEPSVKILLSHKANSQLKELDGTSVLHLPSRRNNLELCQMLTTDTGLITCKDKYGVTPLMVAAAEGSEDLLNYFISVCKKTTHGAAGRILDMQDSEGNSSVHFAAKNDKFLAIEILSEHGVNLDLQNLEQSAPIHLAATLGHRESVAKLIHLGALPNLSDKNGRTPLHCCIIARQLEICDTLLLAGAQSRAADEDFMTPL----HWACRRGLTQ--AARRLLRVDPGCLSLVDIHMRTGLHWAVLACAVDLVELLLAQAGDSDES--ANASDFHDKYPVHYAVEMNDSQLVRILLTHGADFHAVDTEGRTATQLAVKLGHEGLVRDICGLGQYIKRQALRHRDLRGVTSLLIAAEHGHTRVLHFLLEQGADFTAKDEFGRTALMLSCGGGHSDIVATMIDKGVDVNASDANRNTALHYACKHAGSSARSLELLLSNGAQLQQNYNGETPVDVAVLNNNGPAISLLFSDAYCDWVMSYRKDTGMSHMDILIQHSPQTALTILNRSMTKSGADNFEKNFMVTHNFFYLDPGPDDPASKPNRYLGLRTMVERQREDLLKHPLCAALLEYKWSFTRYFFW-CDFFFYAVFLCCLTAFVADQGPLPISLVDA----NTGCRNTSSSGGSGQRQKLTNGRLILEKSVVIGFLCVRLVLEFIKLVFKRLQYLKNYENLFFVTLYILTFVFIYPPDSEPCIDNWIFGIFSVILAWCLLIFQFEHLPVTGIYSLMFQKVIISLVKVLLIFAFFIIGFGLAFNIGLVSQTPFKYPMYSILKTFDMTVGEMEFVTYFISGTSGRMQLALLVVFVIFVVVMPIGLMNLLVGIAVGDIEGISKEAGLRLVEIRINLVYEMETNLPRYFQRRLYR 1016          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 186.037 bits (471), Expect = 1.414e-47
Identity = 246/980 (25.10%), Postives = 412/980 (42.04%), Query Frame = 2
Query:  272 EAAISKNPELLEFILSKKPNI--NKKSCKGSTALLLAVKSGNAECVRLICKQKG-MEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAAS----------------------LGYL-----------EAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI--ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE---DIANELLNRGL-EVISDTNSVNKSLTKYHFFMLDA-------GPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDN-QGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNY------VVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP---GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            E +   N   LEF+  K P +  ++  C G+  +  A  S N   +RLI    G  E++ QD  G+TP+  A   N      +LL  GA+P          LH  I   H  +++LLL   +   +++ + G +P  +A S                      LG+            EA  + +Q      I  +  IN  D    S    A+R     +I  C+  GA ++  Q +   ALH A   G +E +  +      +  + N  D A    +H  +L     +AE L+   A ++  +   L+PLL    L +     K+++FL   L   AD ++KDK  +  LHL+I    G     E L Q     E   L++  D  G  PLH AC   +      ++S+   L   +  +   +H A   G L     L++  I    + NE E N +    LA + GH  + E L  +     S D  G + L +A   G    + ++L  +  L    N   +T LH AA+AG    V+ LL+ GA    N    + L  A+ N     A   + +      +   FK G      ++   E   +    LL+  + E   D N++N  +T Y+F  L A          D +           + +Y + +L+ HP+    L  KW+ +GS   + +L  +L  L   T++I +  P    S +        V   T + + S+    I M  +M+++   +   E ++   Q+L YF   +N       +  L++   +FF+   K       W  G +AI+  W N + Y Q    FGI ++MF  ++ ++I  I+LF+ L++ + ++FY +  ++  F +   S A+ + M +GEL+Y +  L+    G   F  +   +  LF +L+ I L+NLM+G+AVGDI  +  +A +    +QI   +  E  LP
Sbjct:   25 EWSCKGNISSLEFLSQKNPELLKSRDEC-GAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLL----LATTCSAWKTVSFL---LLKGADFRVKDKAGRNFLHLVIFQPKGLKNLPENLLQSKAVRE---LMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLE-TISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQS-DYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSL-FKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHIT-YNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTMASVSFRTQSYMISVC---IVMVLVMNVYAICK---ELVQLAQQRLIYFMDSTNVSDWASAISSLVFVIPLFFSVDNK-----WHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQNTLLEAYEQGQLAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLP 978          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 186.037 bits (471), Expect = 1.414e-47
Identity = 246/980 (25.10%), Postives = 412/980 (42.04%), Query Frame = 2
Query:  272 EAAISKNPELLEFILSKKPNI--NKKSCKGSTALLLAVKSGNAECVRLICKQKG-MEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAAS----------------------LGYL-----------EAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI--ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE---DIANELLNRGL-EVISDTNSVNKSLTKYHFFMLDA-------GPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDN-QGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNY------VVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP---GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            E +   N   LEF+  K P +  ++  C G+  +  A  S N   +RLI    G  E++ QD  G+TP+  A   N      +LL  GA+P          LH  I   H  +++LLL   +   +++ + G +P  +A S                      LG+            EA  + +Q      I  +  IN  D    S    A+R     +I  C+  GA ++  Q +   ALH A   G +E +  +      +  + N  D A    +H  +L     +AE L+   A ++  +   L+PLL    L +     K+++FL   L   AD ++KDK  +  LHL+I    G     E L Q     E   L++  D  G  PLH AC   +      ++S+   L   +  +   +H A   G L     L++  I    + NE E N +    LA + GH  + E L  +     S D  G + L +A   G    + ++L  +  L    N   +T LH AA+AG    V+ LL+ GA    N    + L  A+ N     A   + +      +   FK G      ++   E   +    LL+  + E   D N++N  +T Y+F  L A          D +           + +Y + +L+ HP+    L  KW+ +GS   + +L  +L  L   T++I +  P    S +        V   T + + S+    I M  +M+++   +   E ++   Q+L YF   +N       +  L++   +FF+   K       W  G +AI+  W N + Y Q    FGI ++MF  ++ ++I  I+LF+ L++ + ++FY +  ++  F +   S A+ + M +GEL+Y +  L+    G   F  +   +  LF +L+ I L+NLM+G+AVGDI  +  +A +    +QI   +  E  LP
Sbjct:   25 EWSCKGNISSLEFLSQKNPELLKSRDEC-GAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLL----LATTCSAWKTVSFL---LLKGADFRVKDKAGRNFLHLVIFQPKGLKNLPENLLQSKAVRE---LMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLE-TISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQS-DYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSL-FKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHIT-YNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTMASVSFRTQSYMISVC---IVMVLVMNVYAICK---ELVQLAQQRLIYFMDSTNVSDWASAISSLVFVIPLFFSVDNK-----WHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQNTLLEAYEQGQLAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLP 978          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 185.652 bits (470), Expect = 1.746e-47
Identity = 247/990 (24.95%), Postives = 415/990 (41.92%), Query Frame = 2
Query:  272 EAAISKNPELLEFILSKKPNI--NKKSCKGSTALLLAVKSGNAECVRLICKQKG-MEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHA-KCSPEVKDNNGISPIALAAS----------------------LGYL-----------EAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI--ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE---DIANELLNRGL-EVISDTNSVNKSLTKYHFFMLDA-------GPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDN-QGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNY------VVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDP---GFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEP 3037
            E +   N   LEF+  K P +  ++  C G+  +  A  S N   +RLI    G  E++ QD  G+TP+  A   N      +LL  GA+P          LH  I   H  +++LLL   +   +++ + G +P  +A S                      LG+            EA  + +Q      I  +  IN  D    S    A+R     +I  C+  GA ++  Q +   ALH A   G +E +  +      +  + N  D A    +H  +L     +AE L+   A ++  +   L+PLL    L +     K+++FL   L   AD ++KDK  +  LHL+I    G     E L Q     E   L++  D  G  PLH AC   +      ++S+   L   +  +   +H A   G L     L++  I    + NE E N +    LA + GH  + E L  +     S D  G + L +A   G    + ++L  +  L    N   +T LH AA+AG    V+ LL+ GA    N    + L  A+ N     A   + +      +   FK G      ++   E   +    LL+  + E   D N++N  +T Y+F  L A          D +           + +Y + +L+ HP+    L  KW+ +GS   + +L  +L  L   T++I +  P    S +        V   T + + S+    I M  +M+++   +   E ++   Q+L YF   +N       +  L++   +FF+   K       W  G +AI+  W N + Y Q    FGI ++MF  ++ ++I  I+LF+ L++ + ++FY +  ++  F +   S A+ + M +GEL+Y +  L+    G   F  +   +  LF +L+ I L+NLM+G+AVGDI  +  +A +    +QI   +  E  LP     +  +P
Sbjct:   25 EWSCKGNISSLEFLSQKNPELLKSRDEC-GAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLL----LATTCSAWKTVSFL---LLKGADFRVKDKAGRNFLHLVIFQPKGLKNLPENLLQSKAVRE---LMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLE-TISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQS-DYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSL-FKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHIT-YNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTMASVSFRTQSYMISVC---IVMVLVMNVYAICK---ELVQLAQQRLIYFMDSTNVSDWASAISSLVFVIPLFFSVDNK-----WHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQNTLLEAYEQGQLAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLPYWYMKRVDKP 988          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 179.874 bits (455), Expect = 1.420e-45
Identity = 231/951 (24.29%), Postives = 412/951 (43.32%), Query Frame = 2
Query:  353 GSTALLLAVKSGNAECVRLICKQKGM-EIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMI-KLLLHAKCSPEVKDNNGISPIALAASLGYLEAF--------YLC-------------------------IQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIP-------KLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWN-TAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANE----LLNRGL-EVISDTNSVNKSLTKYHFFMLDAGPY-----DSASVNSRYTEFMTI---AKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAI----FFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKI---FTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            G++ L  A   G+   ++LI +  G  E++  D +G TP+  A + +       LL  GA+P       +  LH  +   H  ++ +L+ H++ +  ++ + G +P+ LAAS+   EA          LC                         +Q    + ++I S IN  D    S    A+R     +I  C+ +GA IN  Q +   ALH A   G +E +        ++CD    IN  D    + LH         +AE L+   A ++  +    +PLL    L +  G  +++  L   L++ A++K++DK     LHL I         L  ++++ E  + LLN  D  G  PLH AC   +      ++    +L   +  +   +H A   G +     L++       +   DE  +  + LA + GH  + E L  K    HS D  G + L +A   G    ++ +L  +  L  + +   +T LH AA+AG    V  LL  GA+   N    + L  A+ N     T+ V  +D   +    F+  + K     I++   +   E    LL+  + E   D NS   ++ +Y+F  L    +     D+   +  Y     +    ++ + +L+ HP+    L  KW+ +G    + ++I +   +   T++I +  P +  + +       V  S D +   +T     M  +++M  +  +  E ++   Q+L+Y +  SN   L+ +SS I    F    + +   +  W  G +A ++ W N++ YLQ    FGI ++MF+ +  +++ II+LF+ L++ +A+AFY +   Q  F   + S  + + M++GE+ Y   FL P       F  M   +   F +L+ I L+NL++G+AVGDI  +  +A +    +QI   S  E  LP
Sbjct:   45 GASPLHYAACKGHLRAIKLIVQIAGQQELNVVDEEGNTPLHWAVQKDQRGSCSALLSLGADPNILNKSLLSPLHLAVSLRHNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPLHLAVRGGNLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLMLLAYDRVCDI---INITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLL----LATSCGAWRTVNLL---LSHGAELKVRDKAGCNFLHLAILQPR-GLKNLPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLRKGALFHS-DYKGWSCLHHAAAEGFTQTMETLLISNIKLLDKIDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLNKGDASFLHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKR---CIVLDMIEFLPESYKHLLDTCIKESDDDVNSCTYNI-EYNFQWLQHTNHRIQNTDNIEEDDDYKPLAALNAMVEFNRVELLTHPVCKKFLEMKWKAYGMKAHLLNMIVYTLGVLPLTYLIVNLRPKLTVNKNVTTVT-MVTTSIDKQCYFITS---CMFLVLAMNTY-AVGKEIVQMFQQRLKYLRDMSN---LMDWSSTICSLLFVIPLLLNVESSWHWQAGALAGLISWINLLLYLQRFERFGIYVVMFREICRTLLSIIVLFIYLILAFALAFYALMVEQRHFGRMFLSLMQTFVMMVGEISYQDNFLKPYMSSQLPFPLMTYGIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKQIGMQIELHSNLEERLP 971          

HSP 2 Score: 78.1814 bits (191), Expect = 4.037e-14
Identity = 107/462 (23.16%), Postives = 194/462 (41.99%), Query Frame = 2
Query:  638 VKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNG-ININ--------------SVDNNLDSAL---------------HLGIHNGSLSVA------------ECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNI-FEFLYFKDIE--MHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMY----ENTFHQTPLTLALDNQHWNTAKVFLN 1870
            V+D+ G SP+  AA  G+L A  L +Q     ++N+       D EG +    A++  QR      L  GAD N+      + LH+A  +  + ++ +L  +   N+N              SVDN+    +               H  IH  + + A            E  +   +H+N  ++++ +PL    +L  + G   +L  ++L + + A +  +   K T LH     G  E ++L+  L+  +    ++N  D     PLH A   +  ++  YLIS+GA++   +     P+  AT  G    V  L+  +  ++ +R++   N + LA+    G  N+  E L  + +   ++ +D  G   L YAC++G    VK +L  + +L  ++  + + LH AA+ G+      LL    +       +    TPL LA    H    ++ L 
Sbjct:   40 VRDDTGASPLHYAACKGHLRAIKLIVQIAGQQELNV------VDEEGNTPLHWAVQKDQRGSCSALLSLGADPNILNKSLLSPLHLAVSLRHNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPL----HLAVRGG---NLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLM--LLAYDRVCDIINITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLLLATSCGAWRTVNLLLS-HGAELKVRDKAGCNFLHLAILQPRGLKNLPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLR 485          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 170.629 bits (431), Expect = 9.715e-43
Identity = 225/947 (23.76%), Postives = 400/947 (42.24%), Query Frame = 2
Query:  353 GSTALLLAVKSGNAECVRLICKQKGM-EIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMI-KLLLHAKCSPEVKDNNGISPIALAASLGYLEAF--------YLC-------------------------IQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIP-------KLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMR-NHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWN-TAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANE----LLNRGL-EVISDTNSVNKSLTKYHFFMLDAGPY-----DSASVNSRYTEFMTI---AKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKI---FTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILP 3007
            G++ L  A   G+   ++LI +  G  E++  D +G TP+  A + +       LL  GA+P       +  LH  +   H  ++ +L+ H++ +  ++ + G +P+ LAAS+   EA          LC                         +Q    + ++I S IN  D    S    A+R     +I  C+ +GA IN  Q +   ALH A   G +E +        ++CD    IN  D    + LH         +AE L+   A ++  +    +PLL    L +  G  +++  L   L++ A++K++DK     LHL I         L  ++++ E  + LLN  D  G  PLH AC   +      ++    +L   +  +   +H A   G +     L++       +   DE  +  + LA + GH  + E L  K    HS D  G + L +A   G    ++ +L  +  L  + +   +T LH AA+AG    V  LL  GA+   N    + L  A+ N     T+ V  +D   +    F+  + K     I++   +   E    LL+  + E   D NS   ++ +Y+F  L    +     D+   +  Y     +    ++ + +L+ HP+    L  KW+ +G    + ++I +   +   T++I +  P +  + +       V  S D +LK L D    M+++M                          S+ +  L++   +    +      +  W  G +A ++ W N++ YLQ    FGI ++MF+ +  +++ II+LF+ L++ +A+AFY +   Q  F   + S  + + M++GE+ Y   FL P       F  M   +   F +L+ I L+NL++G+AVGDI  +  +A +    +QI   S  E  LP
Sbjct:   45 GASPLHYAACKGHLRAIKLIVQIAGQQELNVVDEEGNTPLHWAVQKDQRGSCSALLSLGADPNILNKSLLSPLHLAVSLRHNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPLHLAVRGGNLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLMLLAYDRVCD---IINITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLL----LATSCGAWRTVNLL---LSHGAELKVRDKAGCNFLHLAILQPR-GLKNLPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLRKGALFHS-DYKGWSCLHHAAAEGFTQTMETLLISNIKLLDKIDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLNKGDASFLHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKR---CIVLDMIEFLPESYKHLLDTCIKESDDDVNSCTYNI-EYNFQWLQHTNHRIQNTDNIEEDDDYKPLAALNAMVEFNRVELLTHPVCKKFLEMKWKAYGMKAHLLNMIVYTLGVLPLTYLIVNLRPKLTVNKNVTTVT-MVTTSIDKRLKYLRD----MSNLMDW------------------------SSTICSLLFVIPLLLNVE-----SSWHWQAGALAGLISWINLLLYLQRFERFGIYVVMFREICRTLLSIIVLFIYLILAFALAFYALMVEQRHFGRMFLSLMQTFVMMVGEISYQDNFLKPYMSSQLPFPLMTYGIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKQIGMQIELHSNLEERLP 941          

HSP 2 Score: 77.7962 bits (190), Expect = 4.933e-14
Identity = 107/462 (23.16%), Postives = 194/462 (41.99%), Query Frame = 2
Query:  638 VKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNG-ININ--------------SVDNNLDSAL---------------HLGIHNGSLSVA------------ECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNI-FEFLYFKDIE--MHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMY----ENTFHQTPLTLALDNQHWNTAKVFLN 1870
            V+D+ G SP+  AA  G+L A  L +Q     ++N+       D EG +    A++  QR      L  GAD N+      + LH+A  +  + ++ +L  +   N+N              SVDN+    +               H  IH  + + A            E  +   +H+N  ++++ +PL    +L  + G   +L  ++L + + A +  +   K T LH     G  E ++L+  L+  +    ++N  D     PLH A   +  ++  YLIS+GA++   +     P+  AT  G    V  L+  +  ++ +R++   N + LA+    G  N+  E L  + +   ++ +D  G   L YAC++G    VK +L  + +L  ++  + + LH AA+ G+      LL    +       +    TPL LA    H    ++ L 
Sbjct:   40 VRDDTGASPLHYAACKGHLRAIKLIVQIAGQQELNV------VDEEGNTPLHWAVQKDQRGSCSALLSLGADPNILNKSLLSPLHLAVSLRHNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPL----HLAVRGG---NLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLM--LLAYDRVCDIINITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLLLATSCGAWRTVNLLLS-HGAELKVRDKAGCNFLHLAILQPRGLKNLPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLR 485          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 3.685e-38
Identity = 133/502 (26.49%), Postives = 230/502 (45.82%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLL 1771
            LH AA S + +++E +L +   I  K+  G + L +A +  +  CV+L+  ++   +D       TP+ +A       + K+LL  G  P     +G   LH   + N +++++LLL    S      +G++PI +A+ +G+L    L +Q+  +S        N+T+  G +    A R  Q  ++   L+ GA + +   E +  LHIAS +G +EI+  L   G + N+   +  + L+     G   VA  LL N A ++   +   TPL    ++ S+ G    +A L L    +AD K+  +   T LH+     H +   LL       +K    +S   NG  PLH+A   N  ++   L+  GA   +       P+H A ++GH ++V  L+  +   I++  +     + LA Q    N+ E L     ++++  +     L  A   G+I MV  +L+    +  +  +  TPLHQAAQ G T +V  LL
Sbjct:  275 LHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQA-PVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASS--------NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPL----HIASKYG-RLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLL------DKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRH-ASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL 755          

HSP 2 Score: 139.813 bits (351), Expect = 4.634e-34
Identity = 160/631 (25.36%), Postives = 261/631 (41.36%), Query Frame = 2
Query:  272 EAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASV---------------------INSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGAN-------------------------LLLGNYNES--------LPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ---TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRGLEV 1990
             AA + N E L   L    +IN  +  G  AL LA K G+ + V  + K++  EID   + G T + +A      DIV++L+ +GAN      +G   L+   + NHLE++K LL    +  V   +G +P+A+A   G+ +   L ++S    K+ + ++                      + T   G++    A  Y    +    L  GA ++     G   LH+A++ G + ++  L D G  I++   +  + LH    +G   V E LL   A +    +N L+PL    ++ +Q    + LA ++LLL   A V        T LH+    GH    +LL     E   + L      NG  PLH+AC  N  K+   L+  GA+                         LLL N   S         P+H A+R G LE+VK L+    +      ED+  L I A + G   I + L  +  + ++   +G+  L +A + G   +  L+L+   ++        TPLH A++ G+ ++   LL   A        Q   TPL +A    H   A + L+     ++     K G T +     KN+ ++   LL  G E 
Sbjct:   17 RAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREA-EIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPL----HMATQ---GEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARAL------NGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHI-ASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTA---KNGYTPLHIAAKKNQLEVGKVLLELGAET 629          

HSP 3 Score: 100.138 bits (248), Expect = 1.107e-21
Identity = 92/360 (25.56%), Postives = 158/360 (43.89%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLH--AKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIA---------------------------SVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ 1258
            +H A+   +  +++ +L    + N  + +G T L +A ++G  E V+ +  Q G  +  + R+ QTP+ +A RL   +IV++LL  G++P      G   L+   R  H ++  LLL   A  SP  K   G +P+ +A+  G LE   L ++   ++   +A                           +  +ST   GY+    A +  Q  +    L+ GA+ N+   +G   LH+A++ G ++++  L     +I+       +A+HL      ++VAE L  + A VN   +   TPL    ++ S  G  K + FL   L N A V  K +   T LH     GH   +  L Q
Sbjct:  407 IHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL-QSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTK--KGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPL----HVASHYGNIKMVNFL---LRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQ 756          

HSP 4 Score: 98.2117 bits (243), Expect = 4.146e-21
Identity = 98/380 (25.79%), Postives = 167/380 (43.95%), Query Frame = 2
Query:  761 STDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQF----------------LLNSYDDNGDY-------PLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLA 1828
            S   +  + FL A R      +++ LK G DIN     G NALH+AS+ G  +++ +L      I++     ++ALH+    G   +   L+   A++N  ++N  TPL  +A        E  L  +K LL+N A+  +  +   T L + +  GH + + LL +   + + +                 LL  ++ N D        PLH+A       +   L++ GA +     N   P+H A ++G+  +VK L+D    +I  +  D    +  A +SGH  + E L  +D  + +K + G + L  A Q   +  V+L+L +   +        TPLH AA  G  ++ + LL  G E      +  TPL +A
Sbjct:    6 SFQSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQ-------ENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRG-AKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIA 377          

HSP 5 Score: 73.559 bits (179), Expect = 1.619e-13
Identity = 79/339 (23.30%), Postives = 143/339 (42.18%), Query Frame = 2
Query:  212 KIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILL--YYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEA----FYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILEC----------------------LKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFL 1144
            ++ V+  ++  P      LH A+     E+++ +L +  + N  +  GST L  A + G+ +   L+  + G +I    +KG TP+ +A +   +++  +LL  Y  A+P  +  +G+  LH     +H ++  LLL    SP     NG +P+ +AA    LE       L  ++ M ++  +A  ++    EG++  +  +  +  +I L                         K+ AD+N         LH+AS  G  +++  L  N   +N+   N  + LH     G   V   LL + A  N    N  T  L+ A  +  I V  +L+ L
Sbjct:  461 RVGVKAREDQTP------LHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLL-ENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAP-LHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTA-LAIARRLGYISVVDTLSIL 790          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 7.776e-37
Identity = 134/511 (26.22%), Postives = 223/511 (43.64%), Query Frame = 2
Query:  353 GSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGY-SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNE--------------DEANLII------------------LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE 1786
            G T L  A +SG+ + V ++ +Q G  I  + + G +P+ +A + + ++ V++L+ Y A       D +  LH      H    K+LL    +P V+  NG +P+ +A     +    L    L+    +I +V  S     + S F+  +      I+L  L+ GA  N     G+ ALH+A+  G +E++  L  NG  +++      + LH+    G L + + LL + A  +    N  TPL    ++ ++ G E   A L   L + A + +  KK  T LH+    G +E   LL Q           ++   NG  PLHVA   + +K+   L+ +GA+      N   P+H A +K  LEI   L++   +   I  +              D A+L++                  LA Q    N+ E L      +++  + G   L+ AC  G+I MV  +L+   ++  +  +  TPLHQAAQ G T +V  LL  GA 
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQ-GAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMEL----LLKYGASIEAVTESGLTPMHVSAFMGNL-----NIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPL----HVAAREGHEDVTAIL---LEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASP------DAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGAR 493          

HSP 2 Score: 130.954 bits (328), Expect = 4.675e-31
Identity = 115/412 (27.91%), Postives = 189/412 (45.87%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGA--NLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQIT 1495
            +H +A   N  ++  +L    + N  + +G TAL +A ++G  E VR + +  G ++D + R+ QTP+ +A RL  ++IV++LL + A+P  +  +G   LH   R  H ++  +LL    S  V    G +P+ +A+  G +E   L +Q   +         ++    G +    A  Y  + + L  L  GA  +     G   LHIA++    EI   L + G   N++     + LHLG   G   VA  LL  +A VN   ++ L+PL    +L +Q   E  +   ++L+ + A V    K   T L +    G+I+ +  L Q   +      +NS   NG  PLH A       I N L+  GA  N +  N N +L I  A R G++ +V  L  +  + IT
Sbjct:  142 MHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRN-GAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASP--------DAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPL----HLAAQ---EDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGAD------VNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAI--ARRLGYISVVDTLKVVTEETIT 529          

HSP 3 Score: 82.4185 bits (202), Expect = 3.897e-16
Identity = 71/289 (24.57%), Postives = 123/289 (42.56%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQ------------------SLMNSKINIASV-------INSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLV 1039
            +N +  LH AA   + ++   +L    ++   + KG T L +A K G  E   L+  Q+    D   + G TP+ +A   +   +  +LL  GA+P  +  +G   LH   + + LE+   LL            G++P+ L A  G+ +   L +                   +    K+N+A +       +N+T   GY+  + A  Y    ++   L++GAD+N     G   LH A++ G + I+  L   G   N V  N ++AL +    G +SV + L V
Sbjct:  235 SNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL-QRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKV 522          

HSP 4 Score: 60.8474 bits (146), Expect = 1.782e-9
Identity = 55/214 (25.70%), Postives = 91/214 (42.52%), Query Frame = 2
Query: 1295 SYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLN--IQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTP---------------------------------LHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLA 1828
            ++  +G  PLH A  +   ++   L+ +GA +L    N   P+H AT+  H+E V+ L+     +  IT+   D    + +A   GHY   + L  K    + +   G   L  AC+   I +++L+LK   +++       TP                                 LH AA+AGQT++V  LL  GA++  +    QTPL +A
Sbjct:    1 AHRQDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITL---DYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIA 211          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 1.744e-36
Identity = 134/502 (26.69%), Postives = 229/502 (45.62%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLL 1771
            LH AA S + +++E +L +   I  K+  G + L +A +  +  CV+L+  ++   +D       TP+ +A       + K+LL  G  P     +G   LH   + N +++++LLL    S      +G++PI +A+ +G+L    L +Q+  +S        N+T+  G +    A R  Q  ++   L+ GA + +   E +  LHIAS +G +EI+  L   G + N+   +  + L+     G   VA  LL N A ++   +   TPL    ++ S+ G    +A L L    +AD K   K   T LH+     H +   LL       +K    +S   NG  PLH+A   N  ++   L+  GA   +       P+H A ++GH ++V  L+  +   I++  +     + LA Q    N+ E L     ++++  +     L  A   G+I MV  +L+    +  +  +  TPLHQAAQ G T +V  LL
Sbjct:  282 LHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQA-PVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASS--------NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPL----HIASKYG-RLEVATLLLEKYASADPK--GKNGLTPLHVATHYDHQKVALLLL------DKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS-ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL 760          

HSP 2 Score: 139.043 bits (349), Expect = 1.021e-33
Identity = 142/565 (25.13%), Postives = 237/565 (41.95%), Query Frame = 2
Query:  272 EAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASV-----------------------------INSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFH-QTPLTLALDNQHWNTAKVFLNDN 1876
             AA + N E L   L    +IN  +  G  AL LA K G+ + V  + K++  EID   + G T + +A      DIV++L+ +GAN      +G   L+   + NHLE++K LL    +  V   +G +P+A+A   G+ +   L ++S    K+ + ++                             +N T   G++    A  Y    +    L  GA ++     G   LH+A++ G + ++  L D G  I++   +  + LH    +G   V E LL   A +    +N L+PL    ++ +Q    + LA ++LLL   A V        T LH+    GH    +LL     E   + L      NG  PLH+AC  N  K+   L+  GA++     +   PIH A+  GHL +V         Q+ ++N   +N                         + +  G   L  A + G + +VK +L+    + ++     TPLH A++ G+ ++V+ LL  G++    T    TPL  A    H + A + L + 
Sbjct:   16 RAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREA-EIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPL----HMATQ---GEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARAL------NGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVV---------QLLLQNGASSN-------------------------ATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENG 532          

HSP 3 Score: 100.138 bits (248), Expect = 1.031e-21
Identity = 98/385 (25.45%), Postives = 168/385 (43.64%), Query Frame = 2
Query:  770 CEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ--------------------------LIKEEE-----KQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLA 1828
             +  + FL A R      +++ LK G DIN     G NALH+AS+ G  +++ +L      I++     ++ALH+    G   +   L+   A++N  ++N  TPL  +A        E  L  +K LL+N A+  +  +   T L + +  GH + + LL +                          L++ E       + +LN   ++G  PLH+A       +   L++ GA +     N   P+H A ++G+  +VK L+D    +I  +  D    +  A +SGH  + E L  +D  + +K + G + L  A Q   +  V+L+L +   +        TPLH AA  G  ++ + LL  G E      +  TPL +A
Sbjct:    8 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQ-------ENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGA-KIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIA 384          

HSP 4 Score: 98.9821 bits (245), Expect = 2.712e-21
Identity = 91/358 (25.42%), Postives = 158/358 (44.13%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLH--AKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSK-------------------------INIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ 1258
            +H A+   +  +++ +L    + N  + +G T L +A ++G  E V+ +  Q G  +  + R+ QTP+ +A RL   +IV++LL  G++P      G   L+   R  H ++  LLL   A  SP  K   G +P+ +A+  G LE   L ++   ++                          ++  +  +ST   GY+    A +  Q  +    L+ GA+ N+   +G   LH+A++ G ++++  L     +I+       +A+HL      ++VAE L  + A VN   +   TPL    ++ S  G  K + FL   L N A V  K +   T LH     GH   +  L Q
Sbjct:  414 IHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL-QSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTK--KGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPL----HVASHYGNIKMVNFL---LRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQ 761          

HSP 5 Score: 69.707 bits (169), Expect = 2.585e-12
Identity = 77/306 (25.16%), Postives = 136/306 (44.44%), Query Frame = 2
Query:  233 DENHPNNTFNL-LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECL-KYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFL 1144
            D N P  + +  L+ A+   + ++   +L    +I+  + KG T L +A K G  E   L+  +K    D + + G TP+ +A   +   +  +LL  GA+P  +  +G   LH   + N LE+ K+LL       +    G++P+ LAA  G+ +   L +    ++ I++A+       +G    ++    + +  + E L K+ AD+N         LH+AS  G  +++  L  N   +N+   N  + LH     G   V   LL + A  N    N  T  L+ A  +  I V  +L+ L
Sbjct:  501 DPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLL-EKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGR--HASISLAT-------KGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTA-LAIARRLGYISVVDTLSIL 795          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 1.229e-31
Identity = 117/424 (27.59%), Postives = 193/424 (45.52%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGA--NLLLGNYNESLPIHEATRKGHLEIV---KDLIDLNIQQITIRNEDEANL 1522
            +H +A   N  ++  +L    + N  + +G TAL +A ++G  E VR + +  G ++D + R+ QTP+ +A RL  ++IV++LL + A+P  +  +G   LH   R  H ++  +LL    S  V    G +P+ +A+  G +E   L +Q   +         ++    G +    A  Y  + + L  L  GA  +     G   LHIA++    EI   L + G   N++     + LHLG   G   VA  LL  +A VN   ++ L+PL    +L +Q   E  +   ++L+ + A V    K   T L +    G+I+ +  L Q   +      +NS   NG  PLH A       I N L+  GA  N +  N N +L I  A R G++ +V   K + +  I   T+ N    N+
Sbjct:   52 MHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRN-GAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASP--------DAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPL----HLAAQ---EDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGAD------VNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAI--ARRLGYISVVDTLKVVTEETITSTTVSNPSSRNV 451          

HSP 2 Score: 126.716 bits (317), Expect = 7.826e-30
Identity = 117/457 (25.60%), Postives = 187/457 (40.92%), Query Frame = 2
Query:  512 LLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNE--------------DEANLII------------------LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE 1786
            LL  GANP     +G   LH   + N + +++LLL    S E    +G++P+ ++A +G L                                          I+L  L+ GA  N     G+ ALH+A+  G +E++  L  NG  +++      + LH+    G L + + LL + A  +    N  TPL    ++ ++ G E   A L   L + A + +  KK  T LH+    G +E   LL Q           ++   NG  PLHVA   + +K+   L+ +GA+      N   P+H A +K  LEI   L++   +   I  +              D A+L++                  LA Q    N+ E L      +++  + G   L+ AC  G+I MV  +L+   ++  +  +  TPLHQAAQ G T +V  LL  GA 
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLN-----------------------------------------IVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPL----HVAAREGHEDVTAIL---LEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASP------DAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGAR 403          

HSP 3 Score: 108.612 bits (270), Expect = 3.076e-24
Identity = 108/413 (26.15%), Postives = 173/413 (41.89%), Query Frame = 2
Query:  311 ILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSA------------------NLISQIGV--------EKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLI 1471
            +L K  N N ++  G T L +A K      + L+ K  G  I+     G TP+ ++  +  ++IV ILL  GA+P  +   G   LH   R+   E+++ LL      + K     +P+ +AA LG LE   L +Q + +         ++    GY+    A R     +    L++GA + +   +G   LH+AS+ G  E+   L     + ++   N  + LH+  H  +  VA  LL   A  +   +N  TPL  +A                  N I++ GV        E       LLL   ADV    K   + LHL      +   E+L +          +N+    G  PL VAC     K+ N+L+  GA++     N   P+H+A ++GH  IV  L+
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKY-GASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASP--------DAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVK------HGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 398          

HSP 4 Score: 82.8037 bits (203), Expect = 3.064e-16
Identity = 71/289 (24.57%), Postives = 123/289 (42.56%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQ------------------SLMNSKINIASV-------INSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLV 1039
            +N +  LH AA   + ++   +L    ++   + KG T L +A K G  E   L+  Q+    D   + G TP+ +A   +   +  +LL  GA+P  +  +G   LH   + + LE+   LL            G++P+ L A  G+ +   L +                   +    K+N+A +       +N+T   GY+  + A  Y    ++   L++GAD+N     G   LH A++ G + I+  L   G   N V  N ++AL +    G +SV + L V
Sbjct:  145 SNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL-QRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKV 432          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 1.498e-26
Identity = 133/569 (23.37%), Postives = 234/569 (41.12%), Query Frame = 2
Query:  239 NHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDR--KGQ-TPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCF---LNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFH--QTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKT 1921
              P+N    L EA    +   +  +L +  ++++ + +G + L LA  +G  E  +++     M  + +DR  KG  TP+  A     +DIV++LL +GA+       G   L +     +++++++LL A  + E  + +G +P+  AAS G++E   L ++    + IN  S          +C+   L  +R+         L+ GAD     +E   AL  A   G  E+   L ++G  +N   ++ +S L L    G + +A  L+   A++   N    TPL+ +A                                          GH E + LL       +   +    ++  +  L +AC     ++ ++LI  GA+L LG    S P+ EA ++GHLE+VK                                  +L      +H+   TG+  L YAC+ G   +  L+L+   +L+  +    TPL +AA+AG    V++L+S GA++   T +   T L+LA    H +  ++ L      N    R K G T
Sbjct:   97 GQPDNRS--LAEACSDGDVNAVRKLLGEGRSVHETTEEGESLLCLACSAGYYELAQVLL---AMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLER--GAGINTHSNEFKESALTLACYKGHLEMVRF--------LLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAR----------------------------------------EGHEEMVALLLA-----QGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGC---STPLMEAAQEGHLELVK----------------------------------YLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPN---HRLKDGST 565          

HSP 2 Score: 97.4413 bits (241), Expect = 1.142e-20
Identity = 124/500 (24.80%), Postives = 201/500 (40.20%), Query Frame = 2
Query:  296 ELLEFILSKKPNINKKSCKGSTALLLAVKSGN-AECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQ-TILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQ-ITIRNEDEANLIIL--AVQSGHYNIFEFLYFKDIEMHSKDETGNN---ILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLL 1771
            EL + +L+   N+  +  KG    L+A  SG   + VRL+    G +++ Q   G T +  AC    +D+V++LL  GAN       G   L       H+E+ +LLL          N                           S + +A       C  Y   L  +R+         L+ GAD     +E   AL  A   G  E+   L ++G  +N   ++ +S L L    G + +A  L+   A++   N    TPL+ +A    + G E+ +A L   L   A++  + ++ Q T L L    G +E  + L +   + E              PL  A      ++  YL++ GAN+          +  A   GH     D+ DL +Q    + +E E     L  A ++GH    +FL  K  +++    T NN   +L  AC  G + +V+L+L    +   R    ST L +AA+ G T +V YL+
Sbjct:  147 ELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAH-GADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNE-----------------------FKESALTLA-------C--YKGHLEMVRF--------LLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAA----REGHEEMVALL---LAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGC---------STPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGH----TDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRA--TANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLI 583          

HSP 3 Score: 93.5893 bits (231), Expect = 1.645e-19
Identity = 89/330 (26.97%), Postives = 157/330 (47.58%), Query Frame = 2
Query:  296 ELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQ-DRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNN--GISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININS--VDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKE 1270
            +L+  ++++  NI  +  KG T L+LA  +G+   V L+    G +I+ Q +R   TP+ LAC     ++V++L+  GAN           L       ++ +IK+LL+A      +  +  GISP+ LAA  G+  A  L +   M S IN     N       +CF    R++  ++++E     A++      G   L  A+  G++E+   L + G ++N+  V ++ D+AL +    G     E ++   AH++V N+   TPL  +AN          L  ++LL+N+ ADV   D +K T L      GH++ +  L + + +
Sbjct:  947 DLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLL-DNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLD--MGSDINAQIETNRNTALTLACFQG--RHEVVSLLVE---RKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAAN-------GGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQ 1261          

HSP 4 Score: 85.1149 bits (209), Expect = 6.270e-17
Identity = 77/292 (26.37%), Postives = 139/292 (47.60%), Query Frame = 2
Query: 1166 ADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNI-LMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYEN---TFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHM------GYIIMKNEDIANELLNRGLEVISDTN 2005
            A+++ +DKK  T L L   +GH+  +ELL     + E Q      +   D PL +ACS   +++   LI+ GAN    N ++  P+  A   G++ I+K L++   + I  R   +  +  ++LA  +GH    + L     +++++ ET  N  L  AC  G   +V L++++  N++ R     TPL +AA  G  ++   LL  GA++      +   T LT+A D  H+   ++ ++       ++ R K G T +      G++     D+   L+N G +V +  N
Sbjct:  957 ANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQ-----SERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAE-INSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAH---IDVRNKKGNTPLWLAANGGHL-----DVVQLLVNSGADVDAADN 1234          

HSP 5 Score: 76.6406 bits (187), Expect = 2.567e-14
Identity = 90/343 (26.24%), Postives = 153/343 (44.61%), Query Frame = 2
Query:  359 TALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGAN-PMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKN-ALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKS-LAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISE 1378
            TAL LA   G+ + V ++   +G  I+ +D+KG TP+ LA     +++V++LL  GA+   +SE      L         E+++LL+    + E ++ +  +P++LAAS GY+      I+ L+N+   I S   S    G S  + A        +   L  G+DIN      +N AL +A   G  E++  L +   N+        + L      G   V   LL   A VN        P+ SS +    I  +K    F +L+++  A + +++KK  T L L    GH++ ++LL     +      +++ D+    PL  A      K+  YL+ E
Sbjct:  935 TALTLACAGGHEDLVTVLIA-RGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVN----IIKILLNAGAEINSRTGSK--LGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAA------PVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGAD------VDAADNRKITPLMAAFRKGHVKVVRYLVKE 1258          

HSP 6 Score: 73.9442 bits (180), Expect = 1.435e-13
Identity = 76/320 (23.75%), Postives = 143/320 (44.69%), Query Frame = 2
Query:  836 LKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININS-VDNNLDSALHLGIHNGSLSVAECLLV---NHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIAS--GHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLID--LNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLL 1771
            +  GA+I     +G   L +A+  G   ++  L DNG +I +  +   D+ L L    G   V E L+    N  H NV +   L+ L +S   ++          +K+LLN  A++  +   K  I  L++A+  GH   ++LL  +  +   Q      + N +  L +AC     ++ + L+   AN+         P+ EA   G+ E+ + L++   ++    + +  +  L I A   GHY   E +  +   +  +++ GN  L  A   G + +V+L++    ++   ++ + TPL  A + G  K+V YL+
Sbjct:  953 IARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLS-LAASGGYVN---------IIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQI-----ETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTI-AADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLV 1256          

HSP 7 Score: 63.929 bits (154), Expect = 1.817e-10
Identity = 52/162 (32.10%), Postives = 80/162 (49.38%), Query Frame = 2
Query: 1400 NYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLY--FKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ---TPLTLALDNQHWNTAKVFLN 1870
            N++ +L +  A   GH ++V  LI      I  R++     +ILA  +GH N+ E L     DIE  S + T +  L  AC  G   +V+L++ +  N + RN    TPL  AA  G   +++ LL+ GAE+   T  +   +PL LA  N H    K+ L+
Sbjct:  932 NHDTALTL--ACAGGHEDLVTVLIARGAN-IEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQS-ERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLD 1089          

HSP 8 Score: 58.5362 bits (140), Expect = 7.742e-9
Identity = 61/242 (25.21%), Postives = 103/242 (42.56%), Query Frame = 2
Query: 1301 DDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLID--LNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQ--STPLHQAAQAGQTKMVEYLLSIGAEMYEN--TFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHM------GYIIMKNEDIANELLNRGLEV 1990
            + N D  L +AC+     +   LI+ GAN+   +     P+  A   GH+ +V+ L+D   +I+  + R +D    + LA   G   + E L  +      ++ +    L  A   G + ++K++L     +  R   +   +PL  AA  G T  V+ LL +G+++     T   T LTLA          + +     K  +E R KTG T +      GY      ++   LL RG +V
Sbjct:  930 ESNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKD--TPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLV---ERKANVEHRAKTGLTPLMEAASGGYA-----EVGRVLLERGADV 1161          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 65.855 bits (159), Expect = 2.509e-11
Identity = 45/166 (27.11%), Postives = 85/166 (51.20%), Query Frame = 2
Query: 1322 LHVACSNNLRKICNYLISEGANL-LLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGH-----YNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENT 1801
            LH A  NN   + ++L+S+GA++        + P+H A R G++ IV D +  +    T+ ++   NL+ L+V S +     Y +F  +    +++  +D  G   L++A   GD   V  +LK   ++++ +    TPLH     GQ  +++YL+  GA+ ++ T
Sbjct:  113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIV-DFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKT 277          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 62.3882 bits (150), Expect = 2.899e-10
Identity = 56/233 (24.03%), Postives = 99/233 (42.49%), Query Frame = 2
Query:  374 AVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSE-YDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNR 1069
            A K G+ + V+ + +   ++I+       + +  AC  N   + K LL  GANP ++    G   LH   R  ++ ++ LLL     P +KD  G++ +  +     +      +  ++N+  N+   I+S D    +  L A        +   LK+G+ +    N G NALH A   G   +I  L  +G N    +N       L    G+ S+ E  L +H +  + N+
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVD--IDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLAEGMGTKSLFEQALQHHGYDRLGNQ 287          

HSP 2 Score: 49.6766 bits (117), Expect = 2.495e-6
Identity = 43/165 (26.06%), Postives = 78/165 (47.27%), Query Frame = 2
Query: 1322 LHVACSNNLRKICNYLISEGANL-LLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYF------KDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYE 1795
            LH AC NN   +  +L+  GAN         +  +H A R G++ IV DL+  +    T+++E   N++  +V S +  +  ++ +       ++++ SKD      L++A   GD   V+L+LK    +   ++     LH A   G  +++  L+  GA  YE
Sbjct:   88 LHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIV-DLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYE 251          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 57.3806 bits (137), Expect = 1.853e-9
Identity = 57/221 (25.79%), Postives = 98/221 (44.34%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILSKKPNIN-KKSCKGSTALLLAVKSGNAECVR-LICKQKGMEIDG-QDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYD-----GMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAF-YLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQ-RTIILECLKYGADINLAQNEGKNALHIA 898
            LH+A +      ++ +L  KP++  +K   G   L  +V     E    L+ K + + +D   D  G TP  +AC +  +++VK L      P+K + +     G+ CLH  +     E+ + L+    S  +KD     P+  AAS+G L+    LC            S +N  D +G++   +A+        +L   KYGA+ +L  N+G  A  +A
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLY---DRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLG--------KSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVA 215          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 55.4546 bits (132), Expect = 4.197e-8
Identity = 42/146 (28.77%), Postives = 74/146 (50.68%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFIL-SKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRK-GQTPIDLACRLNMIDIVKILLYYGAN-PMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYL 694
            LH   +  +P+  E +L S  PN+  KS   S+ L LA +  N   + ++   K  +I+ QD +  +TP+ LACRLN  +    LLY GA+  ++ +  G   +         +++KLL+    + +++D  G +P+  A   G+L
Sbjct:  477 LHLCVLGAHPKTTEVLLQSLDPNVKLKS---SSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHL 619          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 50.8322 bits (120), Expect = 7.076e-7
Identity = 30/99 (30.30%), Postives = 50/99 (50.51%), Query Frame = 2
Query: 1178 LKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLID 1474
            +K  K  T +HL +  GH +T+ LL Q          +N   +NG  P+H+AC N+  +  + LI  GA+L + + N   P+H     G +  +K L++
Sbjct:   70 IKTFKGNTCVHLALMKGHEQTLHLLLQQFPR-----FINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLN 163          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Nematostella
Match: EDO27354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9H1])

HSP 1 Score: 126.331 bits (316), Expect = 3.458e-30
Identity = 95/410 (23.17%), Postives = 194/410 (47.32%), Query Frame = 2
Query: 1589 MHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNK-LKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAK--VKDPMCTI---QWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDY 2797
            ++++D      L  A   G    + L+L K+  +  ++ +   P +      +  +V+  L+ GA++   N   +T L +A+D +    AKV +  + W   +  R   G+  M  +I    D+A   L++ +       S       +H  +LD GP      +   +E M   +   E+L+ HP++  LL  KW  FG   +   L+ FL ++  F++ I        DS    +   P  ++ + + L+    S  ++  ++ +F  +  + E  +    +L YFK  +N V L++Y+ AI F +    ++P+ T     W+ G + + L + NV+ Y++ I + G+ + M+  V  S +K+I +FL +++G  + +Y++ + +  F    ++F + + M++GE+DY
Sbjct:   99 LNARDLDLQTPLHVAAARGSPESINLLLGKNCTIDAKDANDQYPFYIV----EVNIVKLCLAEGADVTXRNKDDKTCLDVAIDWKRTEVAKVLIQHDRWWEVICTRNSAGELPMVGLIEALPDVAKLALDQCIVRCPLPTSHQDYCLTFHTVLLDPGPCKEGQTSRDASEVMV--ENDCEELLSHPVTQGLLRYKWFAFGKVPYYIYLMVFLIFVILFSYFIITER----DSSTLYHPTHPNASALEKQYLEKRPSSTNSITIVLILFATIEFLKEFYQIFMIRLDYFKDITNLVELVLYTCAIIFISPYLAEEPLYTAAYGHWNAGVVTLFLAYLNVLLYIKGIGSSGLYVTMYFEVWYSFLKVITVFLVVLLGSTLVYYLLLKEEDDFSGVHYAFVRTFVMMVGEIDY 498          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Nematostella
Match: EDO39112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB40])

HSP 1 Score: 92.8189 bits (229), Expect = 2.976e-19
Identity = 78/294 (26.53%), Postives = 137/294 (46.60%), Query Frame = 2
Query: 1196 QTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVA---CSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAV--QSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEM-YENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGP 2059
            +T LH+  A     T+E++ +       + ++NS D  G  PLH A   C     KI   LI  GAN+L  +++E LP+H A  +G L+ +  L+  N +  TI   D  +L  L +   +        L  K  E+  +D+     L Y   VG    VK++L+ D +L+ R+ ++ TPL  AA  G+ ++   LL  GA++  E +     L +ALDN + +     +   +WK  +      G + +  +I +   +A  +L++ +E  +  ++  +    Y F +L   P
Sbjct:    4 RTCLHVAAACSDFRTVEIILR----NGGKSIINSKDSYGKTPLHYAVIRCQGG--KIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPE--TINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDITNEIIRHESWKTLLLNTKADGVSPLKKLIERVPCLAKVVLDKCIEHSTWVDTDKEYSVTYDFQLLSPPP 289          

HSP 2 Score: 50.447 bits (119), Expect = 4.082e-6
Identity = 55/226 (24.34%), Postives = 99/226 (43.81%), Query Frame = 2
Query:  359 TALLLAVKSGNAECVRLICKQKGMEI-DGQDRKGQTPIDLAC-RLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEV---KDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSV 1021
            T L +A    +   V +I +  G  I + +D  G+TP+  A  R     I+++L+  GAN +  ++D    LHH      L+ I +LL A  +PE     DN  ++ + +AA+    EA  L ++          + ++  D E  +             +   L+Y AD+       K  L  A+  G  E+   L D+G +I +  ++  +AL + + N +L +
Sbjct:    5 TCLHVAAACSDFRTVEIILRNGGKSIINSKDSYGKTPLHYAVIRCQGGKIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQA--NPETINEVDNRSLTALHIAAAAARTEACRLLLEK--------GAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDI 220          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Nematostella
Match: EDO33180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST04])

HSP 1 Score: 87.0409 bits (214), Expect = 1.460e-17
Identity = 91/381 (23.88%), Postives = 170/381 (44.62%), Query Frame = 2
Query: 1601 DETGNNILMYACQVGDIGMVKLILKKDFNL--QMRNHHQSTPLHQAAQAGQTKMVEYLLS-IGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFM-TIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAK--VKDPMCTIQWS---FGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIV 2716
            D  G   L +A   G +  V+LI   + N      N  Q T LH AA+ G +++V++LLS    ++  N ++Q  L +A++    N   V  N   W+  M  R + G T + ++++K    A + L+R +E        + S+T + F  L   P        ++ + + T+ KY++   + H +   ++  KW   G   ++ +L  +L +L   T M       I D                N +  +    I    +MS+F  L+   E  +   +K +Y  +  N++   +Y S++ +  +  V D   ++          AI + W   + YL+    FGI I+M  N++ ++IKII+LF+  +I + I F+++
Sbjct:   15 DTEGRTALHFAAAKGSLRSVQLICMANPNCINDEDNADQDTSLHLAAKNGHSEVVDFLLSDPNQKITYNGYNQNGLDVAIEAGRENVVMVIANHTRWRE-MCHRVEEGLTQLQHLVIKMPSAAEKFLDRCVEECGAGKDEDYSVT-FDFMFLQGMPDIRKDDPKKFLDCLHTMVKYKRVNCLSHQVCGAIMNIKWRSVGWKAYVMNLTFYLIFLLLLTSMTIMLDARIED----------------NLVIDIPKYTII---VMSLFHLLK---ELFQIWDEKFKYLLKADNWMEWFLYMSSLVYMIQYEVFDNHVSVTGETRPLAATAIFIAWVIFVLYLRRFSTFGIYIIMMTNIIKTLIKIIILFIPFVIAFGIPFFLL 371          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Nematostella
Match: EDO41103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D6])

HSP 1 Score: 76.2554 bits (186), Expect = 1.137e-14
Identity = 52/183 (28.42%), Postives = 100/183 (54.64%), Query Frame = 2
Query: 2537 WSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLD----------------PGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEP 3037
            W  G+ A++L + N + +L+ +  FG+ I M+  V+ S+IK++++F+  ++ +A+AFY + + Q  F++F +SF K + M++  +DY +  +D                P F +F  +       F ILI I L+NL++G+AVGDID +   A +    +++ Y++  +  LP+       +P
Sbjct:  161 WPLGSTAMLLCFTNAILFLRRVHVFGLYISMYIEVLKSLIKVLMVFILFILAFALAFYCLLKEQDAFKSFKWSFLKTFMMMVNGMDYQTTIVDSLGEHNPVSGAPLVPVPSFTVFIMVL------FVILIVILLVNLLIGLAVGDIDAIRQTANLRQLAMEVEYVANLDERLPKRFLKALQKP 337          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 71.633 bits (174), Expect = 3.753e-14
Identity = 53/192 (27.60%), Postives = 93/192 (48.44%), Query Frame = 2
Query:  476 ACRLNMIDIVKILLYYGANPMKS-EYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGIS---PIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGA-DINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLL 1036
            ACR    D V+ LL      + + + DG   LH+   +NH++++++LL A    +V+ +  I    PI  AA    +E+  + +++         + +N T+C G +   +A R     ++   L+ G  D+N+   +   +LH+A+ IG + II  L   G NI + DN+  +A HL    G   V + LL
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRA--------GADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          

HSP 2 Score: 55.0694 bits (131), Expect = 1.780e-8
Identity = 31/107 (28.97%), Postives = 53/107 (49.53%), Query Frame = 2
Query:  296 ELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLL 616
            E    +L    ++N  +C G TAL  A + G+++ V L+ +   M+++  DR   T + +A  +    I+K LL+ GAN    + DG    H   R    E+++ LL
Sbjct:   79 ESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          

HSP 3 Score: 47.7506 bits (112), Expect = 5.294e-6
Identity = 46/180 (25.56%), Postives = 78/180 (43.33%), Query Frame = 2
Query:  941 NGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNR---NLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLI 1471
            N  N+N++D +  S LH       + + + LL   A V+V        + P++ +A   +   +E     L+      ADV + +   QT LH     GH + +ELL +     + Q  +N  D +    LHVA       I   L+  GAN+   + +     H A R+G  E+++ L+
Sbjct:   18 NLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNA---IESCRVLLRAG----ADVNITNCYGQTALHHATRRGHSKMVELLLR-----DGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          

HSP 4 Score: 46.9802 bits (110), Expect = 8.456e-6
Identity = 40/177 (22.60%), Postives = 79/177 (44.63%), Query Frame = 2
Query:  329 NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQT---PIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLH-AKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYG 847
            N+N     G + L  A  + + + V+++    G ++D +         PI  A + N I+  ++LL  GA+   +   G   LHH  R  H +M++LLL   +    V D +  + + +AA +G           ++ + +   + I + D +G++ F  A R  +  ++   L+ G
Sbjct:   21 NLNTLDADGFSPLHYATTTNHVDIVQMLL-DAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGS--------NPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Medaka
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:101174541])

HSP 1 Score: 196.438 bits (498), Expect = 7.333e-51
Identity = 245/995 (24.62%), Postives = 436/995 (43.82%), Query Frame = 2
Query:  266 LHEAAISKNPELLEFILS--KKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYD-GMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSL----SVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLI--ASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLG--NYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANL--IILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL-QMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE---DIANELLNRGLEVISDTNSVNKSLTKYHFFMLDA--GPYDSASVNSRYTEFMTI---AKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPI--ADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAI----FFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFK---IFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEP-VFVYKQMRRSVFQRFFSELDSGNQQ-------IESASEN 3133
            LH AA   +  L++FI++      +N    +G+  L  AV+    E  R +    G + +  +    +P+ LA  L   D++K+LL Y A     + D G   L      N+ E + +LL        ++  G  P+  AA  G  +A  + +++        A  IN  D    S    A+R      I  C+  GA I+  QN+    LH+A   G +E++  +      +    N  D A    +H  ++     +AE L+   A +N C+    TPLL    L +  G  K +A L   L+  A+V LKDK     LHL I    G     E   ++++    + LL+  D+ G  PLH AC   +      ++     L L   + ++   +H A + G +   + L++       +   DE  L  + LA + GH  + + L  K    HS D  G + L +A   G    + ++L  +  L    +   +T LH AA+AG    V  +L  GAE+  N  H + L  A+ N   +     ++ +  +  ++  F  G +    I+   E   +    LL+  +    D ++      +Y+F  L A   P   +  + +    + +    KY + +L+ HP+    L  KW  +GS     ++  +L  L   T +I    P +   D+ D+     PV  +     KS +   + M  IM+++   +   E ++   Q+  YF+  SN+     ++SA+    F    + +   ++ W  G +A++  W   + YLQ   N GI ++MF  ++ ++++I++LF  LM+ +++AF+ +  NQ+ F+    S  + + M++GEL+Y +  LD   K    F  +   +   F +L+ I L+NLM+G+AVGDI  +  +A +    +QI   +  E  LP     +  +P + +Y    R   + F + L SG ++       ++S S+N
Sbjct:   64 LHHAAAGGHVTLIQFIITVLDPKELNCSDDQGNVPLHWAVERNKPESCRALL-DLGADPNVLNTALLSPLHLAVSLRQNDLMKLLLSYNATDCNLQGDLGNTPLMMACSINNCEALTILLKHGAKLCQQNKLGHFPMHAAAFAGAKKAMEVILKAGEEHGHPAAVHINYLDKSNSSPLHLAVRGGNIEAIRLCIATGAKIDQQQNDRSTPLHLACTQGATEVVKLMLSTVDQVEDFINLTDGACQTPLHRATIFDHSELAEYLISLGADLNSCDCKGNTPLL----LATSCGAWKCVALL---LSKGANVNLKDKCGCNFLHLAIHQPKGLKNIPE---EVLQRNSVKALLSCEDNEGCTPLHYACRLGIHDSVKNMLGLSGQLGLACKSKDKKSALHFAAQYGRINTCQRLLETITDSRLLNEGDERGLTPLHLASKEGHTKVVQLLLRKGALFHS-DYKGWSCLHHAASEGYTQTMAILLSANLKLLDKTDEDGNTALHIAARAGHVAAVRLMLVKGAELVLNKNHTSFLHEAVQNGRKDVVNAVVDSDRCEEALQL-FTPGTSQRCPILDMIEFLPETYKHLLDCCVRESDDDHNSPDYHIEYNFQWLQAPISPQKLSDESLKIQPLVAVNAMVKYNRIELLNHPVCKKYLAMKWVAYGSKAHALNMFLYLLGLLPLTHLIVSLRPSMNTTDTGDHVINMVPVSFTEQTVFKSFS---MVMVLIMNIYSIGK---EIVQLSQQRWNYFRDHSNHND---WASAVYSLLFIIPLMINAEGSLHWQAGALAVLHYWIGFLLYLQRFENVGIFVVMFGEIMRTLVRIVMLFFFLMLAFSLAFHALMLNQSQFETVPLSVIQTFVMMVGELNYQNNILDAFLKNELPFGILTYFIFVQFVMLMPILLVNLMIGLAVGDIAEVQRNASLKRIAMQIDLHTSLEDKLPYWFMKRVDKPSIIIYPN--RKCSRHFLTHLFSGEEEKNEVWSRLQSKSQN 1034          

HSP 2 Score: 55.4546 bits (132), Expect = 3.741e-7
Identity = 57/239 (23.85%), Postives = 99/239 (41.42%), Query Frame = 2
Query: 1181 KDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIR--------------NEDEANLIILAVQS--------GHYNIFEF----------LYFKDIEMHSK---------DETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLS 1774
            KD+   + LH   A GH+  I+ +  ++  +E    LN  DD G+ PLH A   N  + C  L+  GA+  + N     P+H A      +++K L+  N     ++              N  EA  I+L   +        GH+ +             +  K  E H           D++ ++ L  A + G+I  ++L +     +  + + +STPLH A   G T++V+ +LS
Sbjct:   56 KDECGASPLHHAAAGGHVTLIQFIITVLDPKE----LNCSDDQGNVPLHWAVERNKPESCRALLDLGADPNVLNTALLSPLHLAVSLRQNDLMKLLLSYNATDCNLQGDLGNTPLMMACSINNCEALTILLKHGAKLCQQNKLGHFPMHAAAFAGAKKAMEVILKAGEEHGHPAAVHINYLDKSNSSPLHLAVRGGNIEAIRLCIATGAKIDQQQNDRSTPLHLACTQGATEVVKLMLS 290          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 155.221 bits (391), Expect = 1.063e-37
Identity = 155/598 (25.92%), Postives = 260/598 (43.48%), Query Frame = 2
Query:  236 ENHPN------NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLF----QLIKEEEKQFL-----------------------LNSYDDNGDYPLHVACSNNLRKICNYLISEG-------------------------ANLLLGNYN----ESL----PIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQT-PLTLA 1828
            +N PN        F  LH AA  +N  + + +L++  N+N     G T L +A + GN   VRL+   +G +ID Q +   TP+  A R   + I++ILL +GA       +G+  +H   + +H++ ++ LL      +    + ++P+ +AA  G+          +    ++  +  N+    G++    A +      +   LK+ A +      G   LH+A+ +G   I+  L   G + N+ +  +++ LH+    G   VA+ LL N A V+   ++  TPL  +A +  +         +KLLL++ A+         T LH+    GHI TI +L     Q +K  +K F                         N+   NG  PLHVA  +N   +   L+S+G                         A++LL N      ESL    P+H A+++G  ++V  LI      + + N++    + L  Q GH  I + L  +   +++    G   L  AC  G+I MVK +L++  ++  +     TPLHQAAQ G T +V  LL  GA   E T + T PL +A
Sbjct:  192 QNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLL-DRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGH--------HRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHK-------ELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQA-NVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIA 772          

HSP 2 Score: 140.584 bits (353), Expect = 2.909e-33
Identity = 146/574 (25.44%), Postives = 241/574 (41.99%), Query Frame = 2
Query:  329 NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINI--------------ASVINSTDC-------EGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRG 1981
            NIN  +  G   L LA K G+ + V L     G+E++   +KG T + +A       +V  L+ YGAN     + G   L+   + NHLE++K LL    +  +   +G +P+A+A   G+     L I      K+ +              A+V+   D         G++    A  Y+  ++    L  GA++N     G   LHIAS  G   ++  L D G  I++   +  + LH    NG + + E LL + A +    +N L+P+  +A       V + L +       NA++        T LH+    GH    ++L       +K    N+   NG  PLH+AC  N  +  + L+   A+L     +   P+H A   GHL IVK+L+          N      + +A ++GH  + +FL     ++ ++ +     L  A ++G   +VKL+L    N         TPLH AA+ G    +  LL  GA+  + T    TPL +A      + A++ L      N      K G T +   +  N  D+   L+++G
Sbjct:   35 NINIANQNGLNGLHLASKEGHVKMV-LELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQY-------NAEIDDITLDHLTPLHVAAHCGHHRMAKVLL------DKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASP-NASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAA---GKNGLTPLHVAVHHNNLDVVKLLVSKG 590          

HSP 3 Score: 105.916 bits (263), Expect = 1.527e-22
Identity = 110/429 (25.64%), Postives = 187/429 (43.59%), Query Frame = 2
Query:  770 CEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQF----------------LLNSYDDNGDY-------PLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGY-IIMKNEDIANELLNRG 1981
             +  + FL A R       L+ +K G +IN+A   G N LH+AS+ G  +++ +L  +GI + +     ++ALH+    G   V   L+   A+VN  +    +PL  +A        E  L  +K LL N A+  L  +   T L + +  GH   + LL     + + +                 +L   D N D        PLH+A       +   L++ GAN+     N   P+H A+R+G++ +V+ L+D    QI  + +DE   +  A ++GH  I E L      + +K + G + +  A Q   +  V+ +L+ +  +        TPLH AA  G  +M + LL  GA+      +  TPL +A    H  +  + L  +    ++E   ++G T +     M + +I   LL RG
Sbjct:    8 ADAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQ-------ENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGA-QIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHS---ASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRG 425          

HSP 4 Score: 103.99 bits (258), Expect = 4.968e-22
Identity = 119/510 (23.33%), Postives = 222/510 (43.53%), Query Frame = 2
Query:  353 GSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGK---NALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTF-HQTPLTLALDNQHWNTAKVFLN 1870
             +T+ L A +SGN +   L   + G+ I+  ++ G   + LA +   + +V  LL+ G     +   G   LH    +   +++  L++   +   + + G SP+ +AA   +LE     +++  N  +           +G++    A++     ++   + YG        +GK    ALHIA+    +     L  N  N + +     + LH+  H  ++SVA+ LL   A+VN   +N +TPL    ++ S+ G   ++  ++LLL+  A +  + K + T LH    +GH+  IE+L       E    + +   NG  P+H+A   +       L+   A +     +   P+H A   GH  + K L+D    +   R  +    + +A +  H    + L      + +  E+G   L  A  +G + +VK +L++  +    N    TPLH A++AG  ++ ++LL   A++       QTPL  A    H    K+ L+
Sbjct:   10 AATSFLRAARSGNLDKA-LDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTE--------DGFTPLAVALQQGHENVVALLINYG-------TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPL----HIASRRG---NVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILL------EHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGA-KANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLD 489          

HSP 5 Score: 72.7886 bits (177), Expect = 2.114e-12
Identity = 59/248 (23.79%), Postives = 107/248 (43.15%), Query Frame = 2
Query:  257 FNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLE---------AFYLCIQSLMNSKINIA----------------SVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEII 925
            F  LH A+     ++ E +L +  N N     G T L +AV   N + V+L+   KG       R G TP+ +A + N I++  +LL  GA+P      G+  LH   +    +M+ +L+  + +  + + NG++P+ L A  G++          A       +  + +++A                + +N+    GY+    A +     I+   LK+GA  N   + G + L IA  +G+  +I
Sbjct:  535 FTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVI 781          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 152.525 bits (384), Expect = 6.752e-37
Identity = 142/567 (25.04%), Postives = 246/567 (43.39%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTG---KTHMGYI 1936
             N    LH A+   N  ++  +L +   I+ K+  G T L  A +SG+   V ++  +KG  +  + + G +P+ +A + + ++ VK LL + A       D +  LH      H  + KLLL  + +P  +  NG +P+ +A     ++   L ++   + +    S +       +   LN        I+L  L+ GA  +++   G+ +LH+A+  G +E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  SA        E  L    +LL   A   L  KK  T LH++   G ++  +LL Q      +Q   +S   NG  PLHVA   + +K+   L+ +GA+      N   P+H A +K  ++I   L+    +   +  +    L  LA Q GH ++   L  K  +++   ++G   L  A Q   + + +++++   NL  +     TPL  A   G  KMV +LL  GA +   T +  TPL  A    + +   V L      N +     T       +GYI
Sbjct:  272 RNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLL-EKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLN--------IVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAR-------EGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQ------RQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLH-LASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYI 815          

HSP 2 Score: 122.865 bits (307), Expect = 9.492e-28
Identity = 131/549 (23.86%), Postives = 232/549 (42.26%), Query Frame = 2
Query:  224 QYIDENH------PNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCK--GSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKI-----NIASVINST-------------DCEGYSCFLN---AIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGA 1783
            QY  E H       ++  + L  A      ++LE++   K  ++  +C   G  AL LA K G+ + V+ +   +G  +D   +KG T + ++      ++VK L+  GA+      +G   L+   + NHL++++ LL    +      +G +P+A+A   G+ +   + +++    K+     +IA+  + T             D +  S F     A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G  +  E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   NG  PLH+AC  N  K+   L+  GA++     +   PIH A   GHL IV  L+  N     + N      + +A ++G   +   L      + ++       L  A ++G   +V+L+L+   +      +  TPLH +A+ GQ +    LL  GA
Sbjct:   32 QYFCEEHVPAEMLSDSNTSFLRAARAGNIDKVLEYL---KGGVDISTCNQNGLNALHLAAKEGHMDLVQELL-DRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPL----HMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGA 562          

HSP 3 Score: 96.2857 bits (238), Expect = 1.406e-19
Identity = 108/434 (24.88%), Postives = 178/434 (41.01%), Query Frame = 2
Query:  782 SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ---------------LIKEEEKQ-FLLNSYDDNGDY-------PLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQ----------------VGDIGM-----------------VKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKT 1912
            + FL A R      +LE LK G DI+     G NALH+A++ G  +++ +L D G  ++S     ++ALH+    G   V + L+   A +N  ++N  TPL  +A        E  L  ++ LL N  +     +   T L + +  GH + + +L +                 K++ K   LL   D N D        PLH+A       +   L++ GA +     N   P+H A+++G+  +V+ L+D    QI  +  D    +  A +SGH    E L  K   + ++ + G + L  A Q                V D+ +                  KL+L K  N   R  +  TPLH A +  + K++E L+  GA +   T    TP+ +A    H N   + L +    +    R +T
Sbjct:   49 TSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQ-------ENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRG-SQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGET 474          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 150.599 bits (379), Expect = 2.874e-36
Identity = 142/567 (25.04%), Postives = 246/567 (43.39%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTG---KTHMGYI 1936
             N    LH A+   N  ++  +L +   I+ K+  G T L  A +SG+   V ++  +KG  +  + + G +P+ +A + + ++ VK LL + A       D +  LH      H  + KLLL  + +P  +  NG +P+ +A     ++   L ++   + +    S +       +   LN        I+L  L+ GA  +++   G+ +LH+A+  G +E++  L  NG  +++      + LH+    G   + + LL + AH +    N  TPL  SA        E  L    +LL   A   L  KK  T LH++   G ++  +LL Q      +Q   +S   NG  PLHVA   + +K+   L+ +GA+      N   P+H A +K  ++I   L+    +   +  +    L  LA Q GH ++   L  K  +++   ++G   L  A Q   + + +++++   NL  +     TPL  A   G  KMV +LL  GA +   T +  TPL  A    + +   V L      N +     T       +GYI
Sbjct:  257 RNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLL-EKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLN--------IVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAR-------EGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQ------RQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLH-LASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYI 800          

HSP 2 Score: 139.428 bits (350), Expect = 8.744e-33
Identity = 130/512 (25.39%), Postives = 229/512 (44.73%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGA 1783
             N  N LH AA   + +L++ +L +   ++  + KG+TAL ++  +G AE V+ + K +G +I+ Q + G TP+ +A + N +D+V+ LL  G N   +  DG   L   ++  H +++ +LL      +V+    +  + +AA     ++  L +Q+  N+ +   S        G++    A  Y    +    L  GA ++     G   LH+AS+ G + ++  L D G  I++   +  + LH    +G  +  E LL   A +    +N L+PL    ++ +Q    + +  L        DV L      T LH+    GH    +LL       +K+   N+   NG  PLH+AC  N  K+   L+  GA++     +   PIH A   GHL IV  L+  N     + N      + +A ++G   +   L      + ++       L  A ++G   +V+L+L+   +      +  TPLH +A+ GQ +    LL  GA
Sbjct:   63 QNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVK-RGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKS--------GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPL----HMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLL------DKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGA 547          

HSP 3 Score: 94.7449 bits (234), Expect = 3.780e-19
Identity = 106/434 (24.42%), Postives = 178/434 (41.01%), Query Frame = 2
Query:  782 SCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQ---------------LIKEEEKQ-FLLNSYDDNGDY-------PLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETG----------------NNILMYACQVGDIGM-----------------VKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKT 1912
            + FL A R      +LE LK G DI+     G NALH+A++ G  +++ +L D G  ++S     ++ALH+    G   V + L+   A +N  ++N  TPL  +A        E  L  ++ LL N  +     +   T L + +  GH + + +L +                 K++ K   LL   D N D        PLH+A       +   L++ GA +     N   P+H A+++G+  +V+ L+D    QI  +  D    +  A +SGH    E L  K   + ++ + G                 ++L +   V D+ +                  KL+L K  N   R  +  TPLH A +  + K++E L+  GA +   T    TP+ +A    H N   + L +    +    R +T
Sbjct:   34 TSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQ-------ENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRG-SQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGET 459          

HSP 4 Score: 85.1149 bits (209), Expect = 3.044e-16
Identity = 115/499 (23.05%), Postives = 207/499 (41.48%), Query Frame = 2
Query:  440 GQDRKGQTPID------LACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDN---------GININSVDNNLDSA--------------------LHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFH-QTPLTLA 1828
            GQ RK     D       A R   ID V   L  G +      +G+  LH   +  H+++++ LL      +     G + + +++  G  E        ++ + +   + IN+    G++    A +     ++   L+ G + + A  +G   L IA + G ++++  L +N          ++I +  ++  SA                    LH+  H G+++VA  LL   A V+   RN +TPL    ++ S+ G   +   ++LLL+  + +  K +   T LH    SGH  ++E+L       EK   L +   NG  PLH+A   +  +   +L+   A +     +    +H A   GH  + K L+D        R  +    + +A +     + E L      + +  E+G   +  A  +G + +V L+L+   +  + N    T LH AA+AGQ ++V  LL  GA +       QTPL +A
Sbjct:   21 GQRRKRPKKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAE--------VVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPL----HVASKRG---NTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLL------EKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANP-NARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIA 497          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 129.028 bits (323), Expect = 1.280e-29
Identity = 141/587 (24.02%), Postives = 248/587 (42.25%), Query Frame = 2
Query:  257 FNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDR-------------KGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLM--NSKIN--------------------IASVI-------NSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEK---------------------QFLL------NSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLII---LAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENT 1801
            F  L+ AA   + E+++F+L    N +  +  G T L +A++ G+   V L+         G+ R              G TP+ +A     +++ ++LL  GAN      D +  LH   R+ H  +I++LL      + K  NG+SPI +AA   +++    C++ L+  N++I+                    +A V+       NS    G++    A +     ++   LK+ A I      G   LH+AS +G   I+  L   G + ++ +  +++ LH+   +G   VAE LL N A V+   ++  TPL  +A +  +         +KLLL + A+         + LH+    GH++T+ LL  +  ++ K                     + LL      N+   NG  PLHVA  +N   + N L+S+G +      N    +H A ++  +E+   L+    Q     N +    +    LA Q G  +I   L  K   ++  +++G   L    Q G +G+  +++K+  ++        TPLH A   G  KMV++LL   A +   T
Sbjct:  107 FTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLIS---YGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMD----CVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHK-------ELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLL----QHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKT 669          

HSP 2 Score: 126.716 bits (317), Expect = 5.824e-29
Identity = 136/562 (24.20%), Postives = 242/562 (43.06%), Query Frame = 2
Query:  329 NINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQ---NEGKN----ALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGA---EMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE-DIANELLNRG 1981
            +IN  +  G  AL LA K G+ + V L     G+ ++   +KG T + +A       +V  L+ YG N       G   L+   + NHLE++K LL    +  +   +G +P+A+A   G+     L I      K+ + ++ +      +  FL+   +      L    +  ++N+AQ   N G N     LH A+  G   II  L DNG  I +   N  S +H+      +   + LL  +A ++    + LTPL    ++ +  G  +     K+LL+  A    +     T LH+     H+  ++LL +          + +  ++G  PLHVA       I   L+ +GA+    N     P+H A+R GH E+ + L+  N   +  + +D+   +  A + GH  + + L       +S    G++ L  A + G +  V+L+L  +           TPLH A++ G+  + E LL  GA      +N    TPL +A+ + + +   + ++     ++     + G T +     +N+ ++AN LL  G
Sbjct:   32 DINTANQNGLNALHLASKEGHVKMV-LELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTD------FCFFLSVTGFTP----LHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPL----HVAAHCGHHR---MAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLK------HSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQ-NAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGL--TPLHVAVHHNNLDVVNLLVSKGGSPHSAA---RNGYTALHIAAKQNQVEVANSLLQHG 563          

HSP 3 Score: 124.02 bits (310), Expect = 4.526e-28
Identity = 116/481 (24.12%), Postives = 204/481 (42.41%), Query Frame = 2
Query:  248 NNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNL 1690
            N+    LH AA + +  ++E +L     I  K+  G + + +A +  + +CV+ +  Q   EID       TP+ +A       + K+LL  GA P     +G   LH   + NHL ++ LLL    S E    +G++P+ +A+ +G+L    + +Q   +   +   V         S       +         L+  A ++    + +  LH A+ +G  E++  L ++  N NS      S LH+    G +     LL   A      +   TPL    ++ S+ G    +   +LLL   A+     K   T LH+ +   +++ + LL        K    +S   NG   LH+A   N  ++ N L+  GA+    +     P+H A+++G  +IV  LI      + + N+     + L  Q GH  I + L  +   +++    G   L  AC  G+I MVK +L++  N+
Sbjct:  208 NDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLL-QYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEF--------LLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPL----HVASKYG---KVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVS------KGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQA-NVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANV 665          

HSP 4 Score: 117.087 bits (292), Expect = 5.289e-26
Identity = 140/565 (24.78%), Postives = 236/565 (41.77%), Query Frame = 2
Query:  230 IDENHPN-NTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVK-----------DNNGISPIALAASLGYLEAFYLCIQSLMNSKINI-------------------ASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQ-TPLTLA 1828
            ID N  N N  N LH A+   + +++  +L     +   + KG+TAL +A  +G  + V  +    G  ++ Q +KG TP+ +A + N +++VK LL  GAN      DG   L   ++  H  ++ LL+      +V+              G +P+ +AA    L    L +    N ++                      + I +    G S    A +      + + L+Y A+I+    +    LH+A+  G   +   L D G   NS   N  + LH+      L V + LL + A +     + LTPL    ++ S +G    L  +K+LL   A     + K +T LH+   SGH E  E L Q     + +    + DD    PLH A     +++   L+   AN          P+H A R+GH++ V+ L+D+  QQ  +  +    L + A + G  ++ E L  +    ++  + G   L  A    ++ +V L++ K  +      +  T LH AA+  Q ++   LL  GA     +    TPL LA
Sbjct:   31 IDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNY-GTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPL----HVASFMG---HLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAK----AKDDQ--TPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHV-ASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLA 580          

HSP 5 Score: 105.531 bits (262), Expect = 1.999e-22
Identity = 108/397 (27.20%), Postives = 169/397 (42.57%), Query Frame = 2
Query:  788 FLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEE--------------------------------KQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLN--IQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAE-MYENTFHQTPLTLALDNQHWNTAKVFLND 1873
            FL A R       LE +K G DIN A   G NALH+AS+ G  +++ +L  NGI + +     ++ALH+    G   V   L+    +VN  ++   TPL  +A        E  L  +K LL N A+  +  +   T L + +  GH   + LL     + +                                 Q LLN   ++   PLH A  N   +I   L+  GA +     N   PIH A +  H++ VK L+  N  I  IT+   D    + +A   GH+ + + L  K  + +S+   G   L  AC+   + ++ L+LK   +++       TPLH A+  G   +V+ LL  GA     N   +TPL +A  + H+  A+  L +
Sbjct:   11 FLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQ-------ENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITL---DHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQN 397          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Planmine SMEST
Match: SMESG000070631.1 (SMESG000070631.1)

HSP 1 Score: 1856.26 bits (4807), Expect = 0.000e+0
Identity = 984/1047 (93.98%), Postives = 988/1047 (94.36%), Query Frame = 2
Query:    2 MTEVEVDSNLLTHKHFHLYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEPVFVYKQMRRSVFQRFFSELDSGNQQIESASENTFF 3142
            MT+VEVDSNLLTHKHFHLYPFFKFSSRSFSSSKDKEKEKILKSFQRHQVLLQLLHAVQNGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKG+EID QDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKLLLNNNADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLW NVMFYLQTIPNFGIPILMFK       K  ++  G                 PF  F                           IFTAMKLILVTLFSILISISLINLMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEPVFVYKQMRRSVFQRFFSELDSGNQQIESASENTFF
Sbjct:    1 MTKVEVDSNLLTHKHFHLYPFFKFSSRSFSSSKDKEKEKILKSFQRHQVLLQLLHAVQNGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGLEIDSQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKLLLNNNADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWTNVMFYLQTIPNFGIPILMFKKCCFERDKDNIIVSGTDDRIRNRILYRKSESNPFSKFL--------------------------IFTAMKLILVTLFSILISISLINLMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFYEPVFVYKQMRRSVFQRFFSELDSGNQQIESASENTFF 1021          

HSP 2 Score: 87.4261 bits (215), Expect = 4.159e-17
Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 1
Query: 2632 QKCCFERDKDNIIVSGTDDRIRNRILYRKSESNPFSKFLVFICKTL 2769
            +KCCFERDKDNIIVSGTDDRIRNRILYRKSESNPFSKFL+F    L
Sbjct:  878 KKCCFERDKDNIIVSGTDDRIRNRILYRKSESNPFSKFLIFTAMKL 923          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Planmine SMEST
Match: SMESG000070631.1 (SMESG000070631.1)

HSP 1 Score: 1701.8 bits (4406), Expect = 0.000e+0
Identity = 874/878 (99.54%), Postives = 876/878 (99.77%), Query Frame = 2
Query:    2 MTEVEVDSNLLTHKHFHLYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFK 2635
            MT+VEVDSNLLTHKHFHLYPFFKFSSRSFSSSKDKEKEKILKSFQRHQVLLQLLHAVQNGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKG+EID QDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKLLLNNNADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLW NVMFYLQTIPNFGIPILMFK
Sbjct:    1 MTKVEVDSNLLTHKHFHLYPFFKFSSRSFSSSKDKEKEKILKSFQRHQVLLQLLHAVQNGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGLEIDSQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKLLLNNNADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGTIAIILLWTNVMFYLQTIPNFGIPILMFK 878          

HSP 2 Score: 92.8189 bits (229), Expect = 8.391e-19
Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 1
Query: 2632 QKCCFERDKDNIIVSGTDDRIRNRILYRKSESNPFSKFLVFICKTL 2769
            +KCCFERDKDNIIVSGTDDRIRNRILYRKSESNPFSKFLVFI KTL
Sbjct:  878 KKCCFERDKDNIIVSGTDDRIRNRILYRKSESNPFSKFLVFIFKTL 923          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Planmine SMEST
Match: SMESG000078033.1 (SMESG000078033.1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.228e-163
Identity = 328/959 (34.20%), Postives = 538/959 (56.10%), Query Frame = 2
Query:  176 NGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRG-LEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDN-QGCPVDNS--TDNKLKSLTDSEITMNSIMSMFGFLRLINESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPM---CTIQWSFGTIAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAIAFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKXXXXXXXXXXXXXXXXXXMVGIAVGDIDRMMNDAKISMKILQITYLSETESILPRALQAKFY 3031
            +G +  L++V  K+W + ++     N F+LLH A +  + +++ F+L  KP++N         + LA + G+ E V L+CK K   ID  D KGQTP+  ACR   +++VKILL Y A+  K E D +  +HHP+R N  +M+K+L+       V++NNG +P+ +AA  G+ E F L +  +     NI S++N  D +G+SC  +A++ +   II  C+    D++  QN+GK   H A+ IG+SE+   +  N  ++N  DN L++ +H  I N +L + + LL   A++NVCNR+  TP++ +   I+Q     +   +K L   NA++K+KD + +TI H LI   +IE +E   Q +  E    L+NS DD+ + PLH A      +IC  L+  GA+  L + N+ L +H AT KGHL+ V  L++ + +    R+ +E + I LA ++G Y IF+ L     +  SKD+ G N LM+A + G + +V+ +L  + N+ + +  +ST LHQAA+ G   +V+ L   GA++ E+ F  T L +A+ NQ W+  + FLN+ NWK  M FR + G  H+  +I  NE+I  ELL++  +E +S+    N  + K+ F +LD+GP D AS++ RY    ++A   +  L+ HPLS  LL  KW +FG  F++ D I +L +L      +  Y  P+ D+  Y +  GC   NS  + +KL +     + MNS++      +L+   LK  SQ++++F    NY+ +       FF   +K+P+   C  +W F    I ++W  +++Y++  P  GI ++MF+ V+ S+IK   +F GL +G+   FYI+N +Q PF+       K   M+IGEL+ VSYF+  G K +  +   ++  F I++ I+  NLM+G+AVGDI  +  +A++ M  L++ ++ E ES LP   Q   Y
Sbjct:   55 HGYLQFLQSVPLKVWAKRLNVIDEKNNFSLLHYACLENHKDIVSFLLIFKPDVNVIGANKIRPIHLAAQQGHMEIVELLCKYKSTHIDAADVKGQTPLHTACRRGHLNVVKILLKYQASVQKLELDSISVMHHPVRRNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQNDGKTIFHSAAIIGYSELFDLIETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANINVCNRHFQTPIMLACIEITQ--SRNTAEIIKTLNQANANLKIKDFEMKTIFHYLIEKENIEMLEYFTQTLNSEILLELINSQDDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIKGHLDCVIILLEASKETSYYRDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRNTLMFAAKSGCLPIVEDLLNDEVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGAKLSEDMFGSTQLDVAILNQQWHVVRFFLNNENWKKVMNFRHQNGHGHIKVLIKYNEEITLELLDKCIIENMSNVMDPNYEI-KFWFGILDSGPDDKASISKRYLALKSMADCGQLDLLKHPLSEKLLQCKWNKFGLAFYLIDFIVYLLFLICINVYMSIY-TPMTDTDSYTSYSGCKQTNSSVSSDKLDAPV-GVVLMNSLIYAIITGQLLLLLLKLFSQRIRFFMEVWNYIFITNDILVFFF---IKNPLQLPCLYEWQFAPGLIFVVWFLLLYYMRFFPYIGIQVMMFQKVLVSIIKAFAIFFGLFVGFGFGFYIINSSQDPFKTQGLGIIKSIAMMIGELEIVSYFV-TGKKNYANVSYAMIVCFMIIMPITFFNLMIGLAVGDISNVNAEAELEMIKLRVNFVWEMESQLPVRWQRILY 1004          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Planmine SMEST
Match: SMESG000078033.1 (SMESG000078033.1)

HSP 1 Score: 424.861 bits (1091), Expect = 1.088e-133
Identity = 251/718 (34.96%), Postives = 406/718 (56.55%), Query Frame = 2
Query:  176 NGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLAFLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRG-LEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMIFHYMPPIADSPDYDN-QGCPVDNST 2323
            +G +  L++V  K+W + ++     N F+LLH A +  + +++ F+L  KP++N         + LA + G+ E V L+CK K   ID  D KGQTP+  ACR   +++VKILL Y A+  K E D +  +HHP+R N  +M+K+L+       V++NNG +P+ +AA  G+ E F L +  +     NI S++N  D +G+SC  +A++ +   II  C+    D++  QN+GK   H A+ IG+SE+   +  N  ++N  DN L++ +H  I N +L + + LL   A++NVCNR+  TP++ +   I+Q     +   +K L   NA++K+KD + +TI H LI   +IE +E   Q +  E    L+NS DD+ + PLH A      +IC  L+  GA+  L + N+ L +H AT KGHL+ V  L++ + +    R+ +E + I LA ++G Y IF+ L     +  SKD+ G N LM+A + G + +V+ +L  + N+ + +  +ST LHQAA+ G   +V+ L   GA++ E+ F  T L +A+ NQ W+  + FLN+ NWK  M FR + G  H+  +I  NE+I  ELL++  +E +S+    N  + K+ F +LD+GP D AS++ RY    ++A   +  L+ HPLS  LL  KW +FG  F++ D I +L +L      +  Y  P+ D+  Y +  GC   NS+
Sbjct:   55 HGYLQFLQSVPLKVWAKRLNVIDEKNNFSLLHYACLENHKDIVSFLLIFKPDVNVIGANKIRPIHLAAQQGHMEIVELLCKYKSTHIDAADVKGQTPLHTACRRGHLNVVKILLKYQASVQKLELDSISVMHHPVRRNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQNDGKTIFHSAAIIGYSELFDLIETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANINVCNRHFQTPIMLACIEITQ--SRNTAEIIKTLNQANANLKIKDFEMKTIFHYLIEKENIEMLEYFTQTLNSEILLELINSQDDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIKGHLDCVIILLEASKETSYYRDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRNTLMFAAKSGCLPIVEDLLNDEVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGAKLSEDMFGSTQLDVAILNQQWHVVRFFLNNENWKKVMNFRHQNGHGHIKVLIKYNEEITLELLDKCIIENMSNVMDPNYEI-KFWFGILDSGPDDKASISKRYLALKSMADCGQLDLLKHPLSEKLLQCKWNKFGLAFYLIDFIVYLLFLICINVYMSIY-TPMTDTDSYTSYSGCKQTNSS 768          
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Planmine SMEST
Match: SMESG000078036.1 (SMESG000078036.1)

HSP 1 Score: 399.438 bits (1025), Expect = 2.030e-125
Identity = 240/673 (35.66%), Postives = 384/673 (57.06%), Query Frame = 2
Query:  179 GLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPELLEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDRKGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEMIKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIASVINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIASEIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAHVNVCNRNLLTPLLSSANLISQIGVEKSLA-FLKXXXXXXADVKLKDKKKQTILHLLIASGHIETIELL------FQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLRKICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIRNEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDIGMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENTFHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNEDIANELLNRGLEVISDTNSVNKSL-TKYHFFMLDAGPYDSASVNSRYTEFMTIAKYRKEKLILHPLSNMLLLNKW 2173
            G ++ L+ V        ++     N  +LLH A +  + ++L F+L  KPNIN  + K    + LA + G+ E + L+CKQK + ID  D KGQT + ++CR    +++K+LL  GA+  K E D +  +HHP+R N LEMI +L        VK+NNG +PI +AA  GY E F + I     + IN+ + ++  D +G  C   A++ K   II  CL +  DIN  Q +GK   H AS I +  +   +    ININ  DN+L+S LH  I N  L + + LL   A++N+CN++  TP+L +   IS +   K+L+  +KLL+   AD+ ++D   +TI H L+    IE I+++       + I E ++  L+NS D     PLH A S    +IC  L+  GAN  +   N+ LP+H A  KGHL+IVK L++ + +    R+ +E++ I +A ++G+Y IF+FL     +  +KDE G N LM+A + G + +++ +L K+ N+ + +  + T LHQAA  G  ++V+ L + GA + +N F Q+PL +A+ N   N  K FLND+NW+N M +R   G +H+  +I  NED+  ELL++ + + + +N ++ +   +Y F ++DAGP D AS++ RY    ++ +Y++ KL+ HPLS  LL  KW
Sbjct:   17 GYLNYLEMVPKGFLKDSLNVTDERNGLSLLHYAVLENHLDILSFLLEFKPNINIIALKKVRPIHLASQKGHVEIIELLCKQKSLYIDATDDKGQTALHISCRRGHKEVLKVLLQNGASVHKLESDEISVMHHPVRRNDLEMINILFLYNAPLNVKNNNGQTPIMIAAIEGYAELFSILILKFKENGINVKNALDEKDNDGQCCLSYAVQNKNLDIIKICLDFYVDINTKQADGKTIFHTASIINYPILFKLMKSRDININVGDNDLNSPLHHAIINNKLDMVKVLLKFGANINLCNKDFQTPILLACMEISAL---KNLSGIIKLLIIEKADLNIRDYDMKTIFHYLVVKEKIEMIKVIIYWITYLKNISESQRIELINSQDIVDKSPLHYAVSIGNLEICQVLLEAGANPNIFAANDCLPLHIAAEKGHLDIVKLLLNSSRKSECFRDSNESSAIHIAAENGNYEIFKFLIGIGKDCLAKDEFGRNTLMFAARSGCLPIIEYLLTKETNVNLHDQMKVTALHQAAAEGHLQVVQCLWTSGAILSDNMFGQSPLDIAISNNQENVVKFFLNDDNWQNVMAYRHDNGSSHIENLIKSNEDLTLELLDKCI-IENTSNKMDPNYEVQYRFSLIDAGPDDPASISERYHALKSMTEYKRLKLLRHPLSAKLLKIKW 685          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPA16.794e-4823.49transient receptor potential cation channel subfam... [more]
TRPA11.883e-4222.37transient receptor potential cation channel subfam... [more]
ANK24.686e-4227.25ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK27.639e-4226.37ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK27.643e-4226.37ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa-11.820e-4620.98Transient receptor potential cation channel subfam... [more]
trpa-12.052e-4620.98Transient receptor potential cation channel subfam... [more]
unc-444.270e-4026.25AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.270e-4026.25AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.484e-3926.25AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TrpA15.849e-5122.46gene:FBgn0035934 transcript:FBtr0331823[more]
TrpA16.284e-5122.46gene:FBgn0035934 transcript:FBtr0331825[more]
TrpA15.315e-5022.23gene:FBgn0035934 transcript:FBtr0331824[more]
TrpA15.477e-5022.23gene:FBgn0035934 transcript:FBtr0331826[more]
TrpA15.966e-5022.63gene:FBgn0035934 transcript:FBtr0331827[more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1b1.152e-5125.10transient receptor potential cation channel, subfa... [more]
trpa1b1.152e-5125.10transient receptor potential cation channel, subfa... [more]
trpa1b9.068e-4924.88transient receptor potential cation channel, subfa... [more]
trpa1a6.814e-4624.10transient receptor potential cation channel, subfa... [more]
ank2b2.727e-3825.45ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa14.566e-5725.48transient receptor potential cation channel, subfa... [more]
trpa11.965e-5625.91transient receptor potential cation channel, subfa... [more]
trpa12.288e-5625.62transient receptor potential cation channel, subfa... [more]
trpa18.218e-5524.90transient receptor potential cation channel, subfa... [more]
trpa14.335e-5325.65transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpa17.183e-4823.61transient receptor potential cation channel, subfa... [more]
Trpa16.694e-4323.24transient receptor potential cation channel, subfa... [more]
Ank29.739e-4226.56ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank23.329e-3925.69ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank23.762e-3825.32ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z020|TRPA1_DROME6.299e-5022.46Transient receptor potential cation channel subfam... [more]
sp|O75762|TRPA1_HUMAN3.263e-4723.49Transient receptor potential cation channel subfam... [more]
sp|Q8BLA8|TRPA1_MOUSE5.025e-4723.61Transient receptor potential cation channel subfam... [more]
sp|Q6RI86|TRPA1_RAT1.589e-4624.02Transient receptor potential cation channel subfam... [more]
sp|Q18297|TRPA1_CAEEL2.315e-4520.98Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FPG61.238e-10328.22ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267E8995.725e-10328.12ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267G9R92.812e-9928.10ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267H4S21.263e-9827.99ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267EGL52.897e-9827.88ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1b1.414e-4725.10transient receptor potential cation channel subfam... [more]
trpa1b1.414e-4725.10transient receptor potential cation channel subfam... [more]
trpa1b1.746e-4724.95transient receptor potential cation channel subfam... [more]
trpa1a1.420e-4524.29transient receptor potential cation channel subfam... [more]
trpa1a9.715e-4323.76transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.13.685e-3826.49pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007446.17.776e-3726.22pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000093.11.744e-3626.69pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007449.11.229e-3127.59pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000002048.11.498e-2623.37pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR12.509e-1127.11Palmitoyl transferase involved in protein palmitoy... [more]
AKR22.899e-1024.03Ankyrin repeat-containing protein; member of a fam... [more]
NAS61.853e-925.79Evolutionarily conserved 19S regulatory particle a... [more]
GDE14.197e-828.77Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
AVO27.076e-730.30Component of a complex containing the Tor2p kinase... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO273543.458e-3023.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391122.976e-1926.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331801.460e-1723.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411031.137e-1428.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391133.753e-1427.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1b7.333e-5124.62transient receptor potential cation channel subfam... [more]
ank1b1.063e-3725.92ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000031565.16.752e-3725.04ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000039458.12.874e-3625.04ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1a1.280e-2924.02ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
back to top
BLAST of Transient receptor potential cation channel subfamily A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070631.14.159e-1793.98SMESG000070631.1[more]
SMESG000070631.18.391e-1999.54SMESG000070631.1[more]
SMESG000078033.11.228e-16334.20SMESG000078033.1[more]
SMESG000078033.11.088e-13334.96SMESG000078033.1[more]
SMESG000078036.12.030e-12535.66SMESG000078036.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022407 ID=SMED30022407|Name=Transient receptor potential cation channel subfamily A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3197bp
AATGACAGAAGTTGAAGTTGACAGTAATTTATTAACTCATAAACATTTCC
ATTTGTATCCGTTCTTTAAATTTTCTTCGAGATCTTTCTCTTCTAGTAAA
GACAAAGAAAAAGAAAAAATTCTTAAATCTTTTCAAAGGCATCAGGTGCT
TCTTCAGTTGTTACATGCCGTTCAAAATGGATTGATGGATAACCTGAAAA
CGGTGGAACCTAAAATCTGGGTTCAATACATTGATGAAAACCATCCGAAT
AATACTTTTAACTTGTTGCACGAAGCGGCAATTTCAAAAAATCCAGAATT
GCTTGAGTTTATTCTATCAAAAAAACCAAATATTAATAAGAAATCATGTA
AAGGTAGCACCGCACTTCTATTGGCTGTGAAATCTGGAAATGCGGAATGC
GTCAGGCTGATTTGTAAGCAAAAAGGAATGGAAATTGACGGCCAGGACAG
AAAAGGACAAACTCCTATAGATTTAGCATGTCGCCTAAATATGATAGATA
TTGTCAAGATCCTATTATATTACGGAGCGAACCCTATGAAAAGTGAATAT
GATGGAATGTGCTGCTTGCACCACCCGATTCGGTCGAATCATTTGGAAAT
GATCAAACTTCTGTTACACGCAAAATGTTCACCGGAAGTCAAAGACAACA
ATGGAATATCTCCAATTGCTTTGGCAGCTAGTCTAGGATATTTAGAAGCA
TTTTATTTGTGTATTCAATCATTAATGAATTCTAAGATCAACATAGCGTC
AGTTATAAACAGCACAGACTGCGAAGGATATTCTTGCTTTCTCAATGCTA
TTAGATATAAACAAAGAACGATTATTTTAGAATGTTTAAAATATGGTGCC
GACATAAATCTAGCACAAAATGAAGGCAAAAATGCTTTGCACATTGCTTC
AGAAATTGGATGGAGTGAAATAATTCCAAAACTCTGCGACAATGGAATCA
ACATCAACAGTGTTGACAACAATTTGGATTCTGCTCTTCATTTAGGCATT
CACAACGGATCCCTAAGCGTAGCTGAATGTCTTTTGGTCAATCATGCCCA
TGTGAATGTTTGCAACCGGAATTTATTAACACCCCTGTTATCATCAGCTA
ATTTAATATCCCAAATTGGAGTTGAGAAATCTTTAGCGTTTTTAAAATTG
CTGCTAAATAATAATGCCGACGTCAAATTAAAAGATAAGAAAAAACAAAC
CATTCTTCACTTGCTGATTGCGTCTGGCCATATTGAAACAATTGAGTTGC
TTTTTCAGCTTATTAAAGAGGAAGAGAAACAATTTCTGTTAAATTCGTAT
GATGACAATGGAGACTATCCTTTGCATGTTGCATGTTCAAATAATCTTCG
AAAGATTTGTAATTATTTGATATCGGAAGGGGCGAATTTATTGCTAGGGA
ATTACAACGAAAGTCTACCAATACACGAGGCAACAAGAAAAGGACACTTG
GAAATCGTAAAAGATTTGATAGATCTAAATATTCAACAAATTACCATAAG
AAACGAGGATGAGGCCAATCTGATTATATTGGCTGTTCAATCCGGGCACT
ATAACATATTCGAGTTCCTCTACTTTAAAGATATTGAAATGCATAGCAAG
GATGAAACGGGAAATAACATATTAATGTATGCTTGTCAAGTGGGGGATAT
TGGTATGGTCAAATTAATCCTCAAAAAAGATTTCAATCTTCAAATGAGAA
ACCATCATCAAAGCACTCCATTACATCAGGCAGCTCAGGCTGGTCAAACG
AAAATGGTTGAATATTTACTCAGTATTGGAGCGGAAATGTACGAAAACAC
ATTCCATCAGACCCCTCTTACTCTCGCCCTTGACAACCAACACTGGAACA
CGGCGAAAGTGTTTCTCAACGATAACAATTGGAAGAACACAATGGAATTC
AGATTTAAAACTGGGAAAACTCACATGGGATATATAATAATGAAAAATGA
AGATATTGCCAATGAATTATTGAATCGAGGTTTAGAGGTTATTTCTGATA
CAAATTCAGTTAATAAATCTTTGACAAAATACCATTTTTTTATGCTTGAT
GCTGGACCTTATGATTCAGCTAGTGTAAATTCTCGATACACTGAATTTAT
GACTATCGCAAAGTACAGAAAAGAAAAGCTTATTTTACATCCTCTTTCAA
ACATGTTATTATTAAACAAATGGGAAAGATTTGGATCGTTTTTTTGGATG
ACTGATTTAATTACTTTCCTCGCTTATTTGGGATTTTTTACTTTTATGAT
TTTTCATTATATGCCACCAATAGCCGATAGCCCTGACTACGATAATCAAG
GATGTCCAGTTGACAATTCAACTGATAACAAATTAAAATCATTAACAGAT
TCTGAAATCACAATGAATTCAATCATGTCCATGTTTGGGTTTCTAAGGCT
TATCAATGAATCTCTCAAATTTCTTAGTCAGAAATTGCAATACTTTAAAA
GAGGATCAAACTATGTAGTTTTACTCATGTACTCTTCGGCAATATTTTTT
ACTGCAAAAGTTAAAGACCCTATGTGTACAATACAGTGGTCATTTGGTAC
AATAGCGATCATTTTACTGTGGAAAAATGTAATGTTTTATCTCCAAACCA
TTCCAAATTTTGGCATTCCAATTTTGATGTTCAAAAATGTTGTTTCGAGC
GTGATAAAGATAATATTATTGTTTCTGGGACTGATGATAGGATACGCAAT
CGCATTTTATATCGTAAATCGGAATCAAACCCCTTTTCAAAATTTTTGGT
TTTCATTTGCAAAACTCTATGACATGCTTATCGGAGAATTGGATTATGTT
TCATATTTCCTTGATCCAGGATTTAAGATTTTTACTGCAATGAAACTAAT
TTTAGTTACTTTATTTTCAATACTGATCTCTATATCATTAATAAATTTGA
TGGTCGGCATTGCTGTAGGTGACATTGATAGAATGATGAACGATGCTAAA
ATTTCGATGAAAATTTTACAAATCACTTATTTGTCAGAAACAGAATCTAT
CCTACCAAGAGCACTGCAAGCAAAATTTTATGAACCAGTTTTTGTATATA
AACAAATGAGAAGATCTGTATTTCAAAGATTTTTCTCTGAATTAGATAGT
GGAAATCAACAAATTGAATCCGCTTCCGAAAATACATTTTTCTGAATTAA
ATATTAGGAAACTATGAATTTTTATTCTGACTGTTCTCTCAGCTGGT
back to top

protein sequence of SMED30022407-orf-1

>SMED30022407-orf-1 ID=SMED30022407-orf-1|Name=SMED30022407-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1048bp
MTEVEVDSNLLTHKHFHLYPFFKFSSRSFSSSKDKEKEKILKSFQRHQVL
LQLLHAVQNGLMDNLKTVEPKIWVQYIDENHPNNTFNLLHEAAISKNPEL
LEFILSKKPNINKKSCKGSTALLLAVKSGNAECVRLICKQKGMEIDGQDR
KGQTPIDLACRLNMIDIVKILLYYGANPMKSEYDGMCCLHHPIRSNHLEM
IKLLLHAKCSPEVKDNNGISPIALAASLGYLEAFYLCIQSLMNSKINIAS
VINSTDCEGYSCFLNAIRYKQRTIILECLKYGADINLAQNEGKNALHIAS
EIGWSEIIPKLCDNGININSVDNNLDSALHLGIHNGSLSVAECLLVNHAH
VNVCNRNLLTPLLSSANLISQIGVEKSLAFLKLLLNNNADVKLKDKKKQT
ILHLLIASGHIETIELLFQLIKEEEKQFLLNSYDDNGDYPLHVACSNNLR
KICNYLISEGANLLLGNYNESLPIHEATRKGHLEIVKDLIDLNIQQITIR
NEDEANLIILAVQSGHYNIFEFLYFKDIEMHSKDETGNNILMYACQVGDI
GMVKLILKKDFNLQMRNHHQSTPLHQAAQAGQTKMVEYLLSIGAEMYENT
FHQTPLTLALDNQHWNTAKVFLNDNNWKNTMEFRFKTGKTHMGYIIMKNE
DIANELLNRGLEVISDTNSVNKSLTKYHFFMLDAGPYDSASVNSRYTEFM
TIAKYRKEKLILHPLSNMLLLNKWERFGSFFWMTDLITFLAYLGFFTFMI
FHYMPPIADSPDYDNQGCPVDNSTDNKLKSLTDSEITMNSIMSMFGFLRL
INESLKFLSQKLQYFKRGSNYVVLLMYSSAIFFTAKVKDPMCTIQWSFGT
IAIILLWKNVMFYLQTIPNFGIPILMFKNVVSSVIKIILLFLGLMIGYAI
AFYIVNRNQTPFQNFWFSFAKLYDMLIGELDYVSYFLDPGFKIFTAMKLI
LVTLFSILISISLINLMVGIAVGDIDRMMNDAKISMKILQITYLSETESI
LPRALQAKFYEPVFVYKQMRRSVFQRFFSELDSGNQQIESASENTFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane