Non-SMC condensin II complex subunit G2

Overview
NameNon-SMC condensin II complex subunit G2
Smed IDSMED30022406
Length (bp)406
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022406

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30022406h1SMcG0002272 dd_Smed_v4_83746_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022406h1SMcG0002272 dd_Smed_v4_83746_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022406h1SMcG0002272 dd_Smed_v4_83746_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022406h1SMcG0002272 dd_83746dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx tipSMED30022406h1SMcG0002272 dd_83746dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 60.077 bits (144), Expect = 7.431e-12
Identity = 33/82 (40.24%), Postives = 47/82 (57.32%), Query Frame = 3
Query:   42 AYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDN 287
            A QSST D      AE AVDG T   +  GSC+HT+     WW+VDL   + ++ + I NR D   +R+ GA +++ DS +N
Sbjct:   32 AVQSSTGDPNG--NAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLEN 111          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 60.077 bits (144), Expect = 2.144e-11
Identity = 33/82 (40.24%), Postives = 47/82 (57.32%), Query Frame = 3
Query:   42 AYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDN 287
            A QSST D      AE AVDG T   +  GSC+HT+     WW+VDL   + ++ + I NR D   +R+ GA +++ DS +N
Sbjct:   32 AVQSSTGDPNG--NAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLEN 111          

HSP 2 Score: 46.2098 bits (108), Expect = 1.715e-6
Identity = 26/61 (42.62%), Postives = 33/61 (54.10%), Query Frame = 3
Query:   42 AYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNR 224
            A QSST+ +    G   AVDG T   + +GSCSHT      WW+VDL +   I  + I NR
Sbjct:  175 AIQSSTWPHDGDAGN--AVDGSTESEYQEGSCSHTLGETNPWWRVDLGRVFSIRRVSITNR 233          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 60.077 bits (144), Expect = 3.183e-11
Identity = 34/88 (38.64%), Postives = 49/88 (55.68%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDN 287
            L+    A QSST D      AE AVDG T   +  GSC+HT+     WW+VDL   + ++ + I NR D   +R+ GA +++ DS +N
Sbjct:   26 LALGAAAVQSSTGDPNG--NAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLEN 111          

HSP 2 Score: 57.3806 bits (137), Expect = 3.009e-10
Identity = 47/127 (37.01%), Postives = 64/127 (50.39%), Query Frame = 3
Query:   42 AYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS-SDNVLINCTVIT-EYQPLYNISCI---PWKTRKVQIQMER-NEYLTL 404
            A QSST+ +    G   AVDG T   + +GSCSHT      WW+VDL +   I  + I NR D   +RL GA +++ +S  +N   N  V T E+ P  N       P + R + I +   N YLTL
Sbjct:  174 AIQSSTWPHDGDAGN--AVDGSTESEYQEGSCSHTLGETNPWWRVDLGRVFSIRRVSITNRGDCCEERLNGAEIRIGNSLENNGNSNHLVATVEHIPAGNTETFEFQPVQGRFLNIVLPGVNVYLTL 298          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 56.225 bits (134), Expect = 6.763e-10
Identity = 38/113 (33.63%), Postives = 61/113 (53.98%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLI---NCTVITEYQPLYNIS--CIPWKTRKVQIQME-RNEYLTL 404
            A  A DG  +G++  GSC+HT+  +  WW++DLLK   + +++I N +D   +RL GA +++ D+ DN       C  I      ++ S  C   + R V + +  R EYLTL
Sbjct:  196 ASNANDGNKDGVYTHGSCTHTHKTLNPWWRLDLLKRHKVFSVVITNTLDNLPERLNGAEIRIGDNLDNNGNNNPRCATIASIPAGFSSSFDCDGMEGRYVNVVIPGREEYLTL 308          

HSP 2 Score: 45.8246 bits (107), Expect = 3.188e-6
Identity = 24/62 (38.71%), Postives = 34/62 (54.84%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQL 269
            A  A+DG  +  F  GSC+ T      WW++DLL   ++ +I I NR D   +RL GA V +
Sbjct:   50 ASNAIDGNRDPDFYHGSCTATEVQDDPWWRLDLLDTYVVKSITITNRKDCCPERLDGAEVHI 111          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 56.225 bits (134), Expect = 6.812e-10
Identity = 38/113 (33.63%), Postives = 61/113 (53.98%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLI---NCTVITEYQPLYNIS--CIPWKTRKVQIQME-RNEYLTL 404
            A  A DG  +G++  GSC+HT+  +  WW++DLLK   + +++I N +D   +RL GA +++ D+ DN       C  I      ++ S  C   + R V + +  R EYLTL
Sbjct:  191 ASNANDGNKDGVYTHGSCTHTHKTLNPWWRLDLLKRHKVFSVVITNTLDNLPERLNGAEIRIGDNLDNNGNNNPRCATIASIPAGFSSSFDCDGMEGRYVNVVIPGREEYLTL 303          

HSP 2 Score: 45.8246 bits (107), Expect = 2.770e-6
Identity = 24/62 (38.71%), Postives = 34/62 (54.84%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQL 269
            A  A+DG  +  F  GSC+ T      WW++DLL   ++ +I I NR D   +RL GA V +
Sbjct:   45 ASNAIDGNRDPDFYHGSCTATEVQDDPWWRLDLLDTYVVKSITITNRKDCCPERLDGAEVHI 106          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 84.3445 bits (207), Expect = 1.391e-19
Identity = 56/131 (42.75%), Postives = 75/131 (57.25%), Query Frame = 3
Query:   21 SLSRLKPAYQSSTY-DYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            +L+RL    QSSTY   YN   A  AVDG  N     GSCSHTN++ P+WW++DL K   +  ++I NR D   +RL GA V++ +S+DN    C  IT+  Q    + C   K R V + +  RNEYLTL
Sbjct:  113 NLARLGDVKQSSTYRPEYN---AATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTL 240          

HSP 2 Score: 58.5362 bits (140), Expect = 1.630e-10
Identity = 47/132 (35.61%), Postives = 72/132 (54.55%), Query Frame = 3
Query:   21 SLSRLKPAYQSSTY-DYYNITGAELAVDG-KTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQL-LDSSDNVLINCTVITEYQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            +L++   A QSSTY   YN   A  A+DG K   IF    CSHTN + P+WW++DL K+  I +++I NR D   +RL GA +++ +    N  +  TV    +P   ++C     + + + +  R EYLTL
Sbjct:  257 NLAKSGRARQSSTYRPEYN---AAAAIDGDKGTNIFQH-PCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINSPVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTL 384          

HSP 3 Score: 54.299 bits (129), Expect = 5.904e-9
Identity = 32/92 (34.78%), Postives = 52/92 (56.52%), Query Frame = 3
Query:  135 CSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINC-TVITEYQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            C+HT+ + P+WW++DL K   +  I+I NR D   +RL+GA +++ DS+DN    C T+    Q    + C   + R V + +  R E L+L
Sbjct:    6 CTHTDYDNPAWWQLDLKKRYKVDTIVIVNRGDCCSERLLGAEIRVGDSADNNNPVCDTIKVGSQGTITLCCEGLEGRYVSVVIPGREENLSL 97          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 83.1889 bits (204), Expect = 1.692e-19
Identity = 55/130 (42.31%), Postives = 74/130 (56.92%), Query Frame = 3
Query:   24 LSRLKPAYQSSTY-DYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            L+RL    QSSTY   YN   A  AVDG  N     GSCSHTN++ P+WW++DL K   +  ++I NR D   +RL GA +++ DS++N    C  IT+  Q    + C   K R V + +  RNEYLTL
Sbjct:   27 LARLGDVRQSSTYRPEYN---AATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYKVETVVIVNRGDCCWERLRGAVIRVGDSANNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTL 153          

HSP 2 Score: 58.5362 bits (140), Expect = 1.458e-10
Identity = 47/131 (35.88%), Postives = 71/131 (54.20%), Query Frame = 3
Query:   24 LSRLKPAYQSSTY-DYYNITGAELAVDG-KTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQL-LDSSDNVLINCTVITEYQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            L++   A QSSTY   YN   A  A+DG K   IF    CSHTN + P+WW++DL K+  I +++I NR D   +RL GA +++ +    N  +  TV    +P   ++C     + + + +  R EYLTL
Sbjct:  171 LAKSGRARQSSTYRPEYN---AAAAIDGDKGTNIFQH-PCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINSPVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTL 297          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: ENSXETT00000033868.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:133949885:134039403:-1 gene:ENSXETG00000007052.1 transcript:ENSXETT00000033868.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 2.047e-19
Identity = 49/129 (37.98%), Postives = 73/129 (56.59%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            L+R   A QSS Y + ++  AE A+DG T    N   C+HTN +   WW++DL K   + ++++ NR D   QRL+GA +++ DS+DN    C  IT+  Q    +SC   + R V + +  R EYLTL
Sbjct:  176 LARSGKARQSSDYRHPSVLMAERAIDGITETDLNKSPCTHTNRDYQPWWQLDLDKRYQVKSVIVVNRRDCCSQRLLGAQIRVGDSADNNNPVCGTITDVSQASITVSCHGLEGRYVSVVIPGREEYLTL 304          

HSP 2 Score: 58.9214 bits (141), Expect = 1.000e-10
Identity = 43/123 (34.96%), Postives = 58/123 (47.15%), Query Frame = 3
Query:   42 AYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            A QSS Y       A  A+DG          C  TN N   WW++DL K   I  ++I NR D   +RL GA +++ +S DN    C  IT+  + L  + C     R V + +  R EYLTL
Sbjct:   34 AQQSSVYSPAPQFSAATAIDGIEETNIYKSPCVLTNRNHEPWWRLDLKKRYKIRTVVIVNRGDCCSERLKGAQIRVGNSPDNNNPVCATITDVSRALITVFCHGMVGRYVSVVIPGRAEYLTL 156          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: ENSXETT00000056156.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:132580024:132587369:-1 gene:ENSXETG00000017677.1 transcript:ENSXETT00000056156.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.984e-18
Identity = 52/130 (40.00%), Postives = 76/130 (58.46%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITE--YQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            ++RL    QSSTY+     GAE AVDG      +   C+HT N+ P+WW++DL K  II +++I NR D   +RL+GA +++ DS DN    C  IT+  + P+  +SC   + R V + +  R EYLTL
Sbjct:  295 VARLGDVRQSSTYEPQ--YGAETAVDGVKETDISIHPCTHTMNDNPAWWRLDLKKRFIIESVVIVNRGDCCSERLLGAEIRVGDSPDNNNPVCGTITDVSHSPI-TLSCNGMEGRYVSVVIPGREEYLTL 421          

HSP 2 Score: 71.2478 bits (173), Expect = 7.209e-15
Identity = 49/129 (37.98%), Postives = 71/129 (55.04%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            ++R     QSSTYD     GA  A+DG T+       C+HT+ + P+WW+++L K   I  I+I NR D   +RL+GA V++ DS+DN    C  IT+  Q    +SC   + R V + +  R EYL L
Sbjct:  151 VARSGEVKQSSTYDQQYEAGA--AIDGFTDTDILVHPCTHTDYDNPAWWQLNLKKRYKIGTIVIVNRGDCCSERLLGAEVRVGDSADNNNPICGTITKVSQATITLSCNGMEGRYVSVVIPGREEYLQL 277          

HSP 3 Score: 63.1586 bits (152), Expect = 3.853e-12
Identity = 44/121 (36.36%), Postives = 66/121 (54.55%), Query Frame = 3
Query:   48 QSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            QSSTY+     GA  A+DG T+       C+HT+ + P+WW+++L K   +  I+I NR D   +RL+GA +++ DS DN    C  I    Q    +SC   + R V + +  R EYL+L
Sbjct:    9 QSSTYEQQYEAGA--AIDGFTDTDMLVHPCTHTDYDNPAWWQLNLKKRYKVDTIVIVNRRDCCSERLLGAQIRVGDSEDNNNPVCGAINNISQANITLSCNGIEGRYVSVVIPGREEYLSL 127          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Match: ENSXETT00000056155.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:132574908:132586876:-1 gene:ENSXETG00000017677.1 transcript:ENSXETT00000056155.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 2.150e-18
Identity = 52/130 (40.00%), Postives = 76/130 (58.46%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITE--YQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            ++RL    QSSTY+     GAE AVDG      +   C+HT N+ P+WW++DL K  II +++I NR D   +RL+GA +++ DS DN    C  IT+  + P+  +SC   + R V + +  R EYLTL
Sbjct:  322 VARLGDVRQSSTYEPQ--YGAETAVDGVKETDISIHPCTHTMNDNPAWWRLDLKKRFIIESVVIVNRGDCCSERLLGAEIRVGDSPDNNNPVCGTITDVSHSPI-TLSCNGMEGRYVSVVIPGREEYLTL 448          

HSP 2 Score: 70.0922 bits (170), Expect = 1.844e-14
Identity = 48/121 (39.67%), Postives = 68/121 (56.20%), Query Frame = 3
Query:   48 QSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            QSSTYD     GA  A+DG T+       C+HT+ + P+WW+++L K   I  I+I NR D   +RL+GA V++ DS+DN    C  IT+  Q    +SC   + R V + +  R EYL L
Sbjct:  186 QSSTYDQQYEAGA--AIDGFTDTDILVHPCTHTDYDNPAWWQLNLKKRYKIGTIVIVNRGDCCSERLLGAEVRVGDSADNNNPICGTITKVSQATITLSCNGMEGRYVSVVIPGREEYLQL 304          

HSP 3 Score: 69.3218 bits (168), Expect = 3.141e-14
Identity = 46/129 (35.66%), Postives = 71/129 (55.04%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINC-TVITEYQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            ++RL    QSSTY+ +    AE A+DG      +   C+HT  + P+WW++DL K   + +++I NR D   +RLIGA +++ DS+DN    C T+    +    I C   + R V + +  R EYLTL
Sbjct:  465 VARLGDVRQSSTYEPH--YSAETAIDGIIETDISIHPCTHTFEDNPAWWRLDLKKVYKVDSVVIVNRRDCCSERLIGAQIRVGDSADNNNPVCGTIFDVSKATITILCNGLEGRYVSVVIPGREEYLTL 591          

HSP 4 Score: 64.6994 bits (156), Expect = 1.479e-12
Identity = 45/129 (34.88%), Postives = 69/129 (53.49%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            ++R     QSSTY+     GA  A+DG T+       C+HT+ + P+WW+++L K   +  I+I NR D   +RL+GA +++ DS DN    C  I    Q    +SC   + R V + +  R EYL+L
Sbjct:   42 VARSGEVKQSSTYEQQYEAGA--AIDGFTDTDMLVHPCTHTDYDNPAWWQLNLKKRYKVDTIVIVNRRDCCSERLLGAQIRVGDSEDNNNPVCGAINNISQANITLSCNGIEGRYVSVVIPGREEYLSL 168          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I931|FUCL1_ANGJA (Fucolectin-1 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.701e-11
Identity = 40/111 (36.04%), Postives = 59/111 (53.15%), Query Frame = 3
Query:   90 LAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN---CTVI--TEYQPLYNISCI-PWKTRKVQIQMERNEYLTL 404
             A+DG  +  F+ GSCSHT N+   WW+VDLL+   I+++ I NR D   +R+ GA + + +S +N  IN   C+VI   E        C  P   R V + + + E L L
Sbjct:   56 FAIDGNRDSDFSHGSCSHTTNSPNPWWRVDLLQLYTITSVTITNRGDCCGERISGARILIGNSLENNGINNPACSVIGSMETGETRTFHCPQPMIGRYVTVYLPKTEVLQL 166          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I925|FUCL7_ANGJA (Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.040e-10
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 3
Query:   15 QDSLSRLKPAYQSSTY--DYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN---CTVI 311
            Q++++    A QS+    D+  I  A  A+DG  + +F  GSC+HT  + P WW+VDLL+   I+++ I NR D   +R+ GA + +    +N  IN   C+VI
Sbjct:   40 QENVALRGRATQSAQLRGDHSGIAHASNAIDGNRDSVFYHGSCTHTEADKP-WWRVDLLQVYTITSVTITNRGDCCEERISGARILIGKHLENNGINNPQCSVI 142          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I927|FUCL5_ANGJA (Fucolectin-5 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.051e-10
Identity = 37/110 (33.64%), Postives = 59/110 (53.64%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN---CT---VITEYQPLYNISCIPWKTRKVQIQMERNEYLTL 404
            A+DG  +   + GSCSHT N    WW+VDLL+   I+++ I NR D   +R+ GA++ + +S +N  IN   C+   ++T  +        P   R V + + + EYL L
Sbjct:   68 AIDGNRDSDSSHGSCSHTTNGPNPWWRVDLLQVYTIASVTITNRGDCCGERITGAHILIGNSLENNGINNPQCSTVGIMTAGETRTFHCSRPMIGRYVTVYLPKTEYLQL 177          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I926|FUCL6_ANGJA (Fucolectin-6 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.052e-9
Identity = 37/112 (33.04%), Postives = 59/112 (52.68%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN--CT---VITEYQPLYNISCIPWKTRKVQIQMERNEYLTL 404
            A  A+DG  +  F  GSC+HT+     WW+VDLL+E  I+++ I NR D   +R+ GA  +++   +N L N  C+   ++T  +        P   R V + + + EYL L
Sbjct:   65 ASNAIDGNQDSYFYHGSCTHTSGGANPWWRVDLLQEYKITSVTITNRGDCCGERITGA--RIIIGKNNGLNNPECSTVGIMTAGETKTFRCSHPMIGRYVTVYLPKTEYLHL 174          
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Match: sp|Q9I928|FUCL4_ANGJA (Fucolectin-4 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.099e-8
Identity = 31/86 (36.05%), Postives = 51/86 (59.30%), Query Frame = 3
Query:   63 DYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN---CTVI 311
            ++  +  A  A+DG  +  ++ GSC+HT    P WW+VDLL+   I+++ I NR D   +R+ GA + + +S +N  IN   C+VI
Sbjct:   49 EHAALAHASNAIDGNRDSNYHHGSCTHTEGANP-WWRVDLLQVYTIASVTITNRGDCCGERISGARILIGNSLENNGINNPQCSVI 133          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A0A5G3LFH4 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=LOC100127564 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.184e-16
Identity = 56/131 (42.75%), Postives = 75/131 (57.25%), Query Frame = 3
Query:   21 SLSRLKPAYQSSTY-DYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            +L+RL    QSSTY   YN   A  AVDG  N     GSCSHTN++ P+WW++DL K   +  ++I NR D   +RL GA V++ +S+DN    C  IT+  Q    + C   K R V + +  RNEYLTL
Sbjct:  113 NLARLGDVKQSSTYRPEYN---AATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTL 240          

HSP 2 Score: 58.5362 bits (140), Expect = 2.560e-7
Identity = 47/132 (35.61%), Postives = 72/132 (54.55%), Query Frame = 3
Query:   21 SLSRLKPAYQSSTY-DYYNITGAELAVDG-KTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQL-LDSSDNVLINCTVITEYQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            +L++   A QSSTY   YN   A  A+DG K   IF    CSHTN + P+WW++DL K+  I +++I NR D   +RL GA +++ +    N  +  TV    +P   ++C     + + + +  R EYLTL
Sbjct:  257 NLAKSGRARQSSTYRPEYN---AAAAIDGDKGTNIFQH-PCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINSPVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTL 384          

HSP 3 Score: 54.299 bits (129), Expect = 9.270e-6
Identity = 32/92 (34.78%), Postives = 52/92 (56.52%), Query Frame = 3
Query:  135 CSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINC-TVITEYQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            C+HT+ + P+WW++DL K   +  I+I NR D   +RL+GA +++ DS+DN    C T+    Q    + C   + R V + +  R E L+L
Sbjct:    6 CTHTDYDNPAWWQLDLKKRYKVDTIVIVNRGDCCSERLLGAEIRVGDSADNNNPVCDTIKVGSQGTITLCCEGLEGRYVSVVIPGREENLSL 97          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A0A5G3LDN6 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=LOC100127564 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.656e-16
Identity = 55/130 (42.31%), Postives = 74/130 (56.92%), Query Frame = 3
Query:   24 LSRLKPAYQSSTY-DYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            L+RL    QSSTY   YN   A  AVDG  N     GSCSHTN++ P+WW++DL K   +  ++I NR D   +RL GA +++ DS++N    C  IT+  Q    + C   K R V + +  RNEYLTL
Sbjct:   27 LARLGDVRQSSTYRPEYN---AATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYKVETVVIVNRGDCCWERLRGAVIRVGDSANNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTL 153          

HSP 2 Score: 58.5362 bits (140), Expect = 2.289e-7
Identity = 47/131 (35.88%), Postives = 71/131 (54.20%), Query Frame = 3
Query:   24 LSRLKPAYQSSTY-DYYNITGAELAVDG-KTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQL-LDSSDNVLINCTVITEYQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            L++   A QSSTY   YN   A  A+DG K   IF    CSHTN + P+WW++DL K+  I +++I NR D   +RL GA +++ +    N  +  TV    +P   ++C     + + + +  R EYLTL
Sbjct:  171 LAKSGRARQSSTYRPEYN---AAAAIDGDKGTNIFQH-PCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINSPVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTL 297          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A0A5G3HRL1 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 3.215e-16
Identity = 49/129 (37.98%), Postives = 73/129 (56.59%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            L+R   A QSS Y + ++  AE A+DG T    N   C+HTN +   WW++DL K   + ++++ NR D   QRL+GA +++ DS+DN    C  IT+  Q    +SC   + R V + +  R EYLTL
Sbjct:  176 LARSGKARQSSDYRHPSVLMAERAIDGITETDLNKSPCTHTNRDYQPWWQLDLDKRYQVKSVIVVNRRDCCSQRLLGAQIRVGDSADNNNPVCGTITDVSQASITVSCHGLEGRYVSVVIPGREEYLTL 304          

HSP 2 Score: 58.9214 bits (141), Expect = 1.570e-7
Identity = 43/123 (34.96%), Postives = 58/123 (47.15%), Query Frame = 3
Query:   42 AYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            A QSS Y       A  A+DG          C  TN N   WW++DL K   I  ++I NR D   +RL GA +++ +S DN    C  IT+  + L  + C     R V + +  R EYLTL
Sbjct:   34 AQQSSVYSPAPQFSAATAIDGIEETNIYKSPCVLTNRNHEPWWRLDLKKRYKIRTVVIVNRGDCCSERLKGAQIRVGNSPDNNNPVCATITDVSRALITVFCHGMVGRYVSVVIPGRAEYLTL 156          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A9UMT3 (FTP domain-containing protein OS=Xenopus tropicalis OX=8364 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.092e-15
Identity = 49/135 (36.30%), Postives = 77/135 (57.04%), Query Frame = 3
Query:    6 VQCQDSLSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            ++ +D+++RL  A QSSTY       A  A+DG T+    +GSCS T N+ P+WW++DL K   +  ++I NR D   +RL+GA V++ DS+DN    C  +T+  +    +SC   + R V + +  R E L L
Sbjct:   21 IKLKDNIARLGEATQSSTYRLEYKAAA--AIDGNTDSNMMEGSCSLTGNDNPAWWQLDLKKRYKVDTVVIVNRGDCCSERLLGAKVRVGDSADNNNPVCGTVTDVSEETIVVSCHGREGRYVSVVIPGREETLQL 153          
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Match: A0A5G3LDP0 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.116e-15
Identity = 52/130 (40.00%), Postives = 76/130 (58.46%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITE--YQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            ++RL    QSSTY+     GAE AVDG      +   C+HT N+ P+WW++DL K  II +++I NR D   +RL+GA +++ DS DN    C  IT+  + P+  +SC   + R V + +  R EYLTL
Sbjct:  295 VARLGDVRQSSTYEPQ--YGAETAVDGVKETDISIHPCTHTMNDNPAWWRLDLKKRFIIESVVIVNRGDCCSERLLGAEIRVGDSPDNNNPVCGTITDVSHSPI-TLSCNGMEGRYVSVVIPGREEYLTL 421          

HSP 2 Score: 71.2478 bits (173), Expect = 1.132e-11
Identity = 49/129 (37.98%), Postives = 71/129 (55.04%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            ++R     QSSTYD     GA  A+DG T+       C+HT+ + P+WW+++L K   I  I+I NR D   +RL+GA V++ DS+DN    C  IT+  Q    +SC   + R V + +  R EYL L
Sbjct:  151 VARSGEVKQSSTYDQQYEAGA--AIDGFTDTDILVHPCTHTDYDNPAWWQLNLKKRYKIGTIVIVNRGDCCSERLLGAEVRVGDSADNNNPICGTITKVSQATITLSCNGMEGRYVSVVIPGREEYLQL 277          

HSP 3 Score: 63.1586 bits (152), Expect = 6.050e-9
Identity = 44/121 (36.36%), Postives = 66/121 (54.55%), Query Frame = 3
Query:   48 QSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEY-QPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            QSSTY+     GA  A+DG T+       C+HT+ + P+WW+++L K   +  I+I NR D   +RL+GA +++ DS DN    C  I    Q    +SC   + R V + +  R EYL+L
Sbjct:    9 QSSTYEQQYEAGA--AIDGFTDTDMLVHPCTHTDYDNPAWWQLNLKKRYKVDTIVIVNRRDCCSERLLGAQIRVGDSEDNNNPVCGAINNISQANITLSCNGIEGRYVSVVIPGREEYLSL 127          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000033919.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 73.9442 bits (180), Expect = 2.929e-16
Identity = 44/113 (38.94%), Postives = 65/113 (57.52%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN---CTVIT--EYQPLYNISCIPWKTRKVQIQM-ERNEYLTL 404
            A  A+DG  +G++  GSCSHT+N +  WW++DLLK   + +I + N I+    RL GA +++ DS +N   N   C VI+  +  PL    C   + R V + + ER EYLTL
Sbjct:  197 ASSAIDGNRDGVYAHGSCSHTDNELSPWWRLDLLKPHKVFSITVTNSINAVPLRLNGAEIRIGDSLENNGNNNPRCAVISIDKENPLMTFQCNGMEGRYVNVVIPERKEYLTL 309          

HSP 2 Score: 49.6766 bits (117), Expect = 1.303e-7
Identity = 25/62 (40.32%), Postives = 38/62 (61.29%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS 278
            A+DG T+  ++ GSC+ T      WW+VDLL E  I++I I NR D   +R+ GA + + +S
Sbjct:   54 AIDGNTDSNYDHGSCTATTWQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIGNS 115          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000035987.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 73.9442 bits (180), Expect = 3.112e-16
Identity = 44/113 (38.94%), Postives = 65/113 (57.52%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN---CTVIT--EYQPLYNISCIPWKTRKVQIQM-ERNEYLTL 404
            A  A+DG  +G++  GSCSHT+N +  WW++DLLK   + +I + N I+    RL GA +++ DS +N   N   C VI+  +  PL    C   + R V + + ER EYLTL
Sbjct:  197 ASSAIDGNRDGVYAHGSCSHTDNELSPWWRLDLLKPHKVFSITVTNSINAVPLRLNGAEIRIGDSLENNGNNNPRCAVISIDKENPLMTFQCNGMEGRYVNVVIPERKEYLTL 309          

HSP 2 Score: 49.6766 bits (117), Expect = 1.291e-7
Identity = 25/62 (40.32%), Postives = 38/62 (61.29%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS 278
            A+DG T+  ++ GSC+ T      WW+VDLL E  I++I I NR D   +R+ GA + + +S
Sbjct:   54 AIDGNTDSNYDHGSCTATTWQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIGNS 115          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000051696.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 72.0182 bits (175), Expect = 1.289e-15
Identity = 42/110 (38.18%), Postives = 64/110 (58.18%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN---CTVIT--EYQPLYNISCIPWKTRKVQIQM-ERNEYLTL 404
            A+DG  +G++  GSCSHT +++  WW++DLLK   + +I++ N  D    RL GA +++ DS +N   N   C VI+  +  PL    C   + R V + + ER EYLTL
Sbjct:  200 AIDGNRDGVYAHGSCSHTQDDLSPWWRLDLLKRHKVFSIIVTNTRDSVPDRLNGAEIRIGDSLENNGNNNPRCAVISIDKENPLMTFQCNGMEGRYVNVVIPERKEYLTL 309          

HSP 2 Score: 49.6766 bits (117), Expect = 1.368e-7
Identity = 25/62 (40.32%), Postives = 38/62 (61.29%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS 278
            A+DG T+  ++ GSC+ T      WW+VDLL E  I++I I NR D   +R+ GA + + +S
Sbjct:   54 AIDGNTDSNYDHGSCTATTWQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIGNS 115          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000042585.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 71.2478 bits (173), Expect = 2.454e-15
Identity = 42/110 (38.18%), Postives = 64/110 (58.18%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLIN---CTVIT--EYQPLYNISCIPWKTRKVQIQM-ERNEYLTL 404
            A+DG  +G++  GSCSHT +++  WW++DLLK   + +I + N  D   +RL GA +++ DS +N   N   C VI+  +  PL    C   + R V + + ER EYLTL
Sbjct:  200 AIDGNQDGVYAHGSCSHTQDDLSPWWRLDLLKRHKVFSITVINTSDNIPERLNGAEIRIGDSLENNGNNNPRCAVISIDKENPLMTFQCNGMEGRYVNVVIPERKEYLTL 309          

HSP 2 Score: 49.6766 bits (117), Expect = 1.303e-7
Identity = 25/62 (40.32%), Postives = 38/62 (61.29%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS 278
            A+DG T+  ++ GSC+ T      WW+VDLL E  I++I I NR D   +R+ GA + + +S
Sbjct:   54 AIDGNTDSNYDHGSCTATTWQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIGNS 115          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Match: ENSAMXT00000008051.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:49634:61503:-1 gene:ENSAMXG00000007830.2 transcript:ENSAMXT00000008051.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 5.127e-14
Identity = 49/128 (38.28%), Postives = 67/128 (52.34%), Query Frame = 3
Query:   42 AYQSSTYDYYNITGAEL-AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLI---NCTVITE--YQPLYNISCIPWKTRKVQIQME-RNEYLTL 404
            A QSS Y     TG  + A+DG  +G +  GSC+HT  ++  WWK+DL K   +S+I I NR D   +RL GA +++ D+  +  I    C VI+     P     C   K R V I +  R EYLTL
Sbjct:  479 ASQSSNYG----TGCAIKAIDGNRDGNYFSGSCTHTKYDLSPWWKLDLQKTHKVSSITITNRQDAVPERLNGAVIRIGDNPAHNGIQNPKCGVISSIGKNPSVTFQCNGMKGRYVTIMIPGRKEYLTL 602          

HSP 2 Score: 56.225 bits (134), Expect = 8.606e-10
Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDN 287
            A+DGKT   ++ GSC+HT      WW++DLLKE  I +I I NR D   +R+ GA +++ +S  N
Sbjct:  348 AIDGKTTSEYSQGSCTHTETQDNPWWRLDLLKEYNIYSITITNRGDCCSERINGAEIRVGNSLSN 412          

HSP 3 Score: 55.4546 bits (132), Expect = 1.316e-9
Identity = 25/65 (38.46%), Postives = 41/65 (63.08%), Query Frame = 3
Query:   93 AVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDN 287
            A+DGKT   ++ GSC+HT      WW++DL  E I++++ + NR D   +RL GA +++ +S  N
Sbjct:   51 AIDGKTTSEYSQGSCTHTETQDNPWWRLDLQDEYIVTSVTVTNRGDCCSERLNGAEIRIGNSLSN 115          

HSP 4 Score: 48.9062 bits (115), Expect = 2.920e-7
Identity = 30/90 (33.33%), Postives = 46/90 (51.11%), Query Frame = 3
Query:    9 QCQDSLSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS 278
            Q ++   R K    S  +D +       A+D   +  ++ GSC+HT      WW+VDLL E  I++I+I NR D    RL GA + + +S
Sbjct:  173 QVKNLAPRGKATQSSLAFDGH----PSKAIDKNKDTNYHQGSCTHTVIQQNPWWRVDLLDEFTITSIVITNRGDCCAGRLEGAEIHVGNS 258          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO35302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU7])

HSP 1 Score: 63.929 bits (154), Expect = 3.384e-13
Identity = 38/90 (42.22%), Postives = 53/90 (58.89%), Query Frame = 3
Query:   21 SLSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS-SDN 287
            +L+  KP  Q S    Y    A  AVDG T+GIF+ GSC+HTN +   WW+VDL     +S + + NR+  + QRL  A V++ DS +DN
Sbjct:  126 NLALKKPTTQIS---LYGAGYASRAVDGNTDGIFSRGSCTHTNAHTNPWWRVDLGTTQPVSEVFLVNRV-TDSQRLQNAEVRVGDSLTDN 211          

HSP 2 Score: 50.447 bits (119), Expect = 1.943e-8
Identity = 25/63 (39.68%), Postives = 36/63 (57.14%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDG-SCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQL 269
            A  AVDG T+G FN G SC+HT+ +   WW+VDL     +S + + NR+     RL    V++
Sbjct:    1 ASRAVDGNTDGDFNRGRSCTHTDAHTNPWWRVDLGTTQPVSEVFLVNRLGDLANRLFNVEVRV 63          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO33194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX9])

HSP 1 Score: 53.1434 bits (126), Expect = 3.568e-10
Identity = 33/92 (35.87%), Postives = 47/92 (51.09%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS-----SDNVLINCTVITEYQPLYNISC 344
            AE AVDG  +G F+D SC+ T      WW+VDL K  +I  + I NR D   +RL    +++ DS     +DN     + I  +    +ISC
Sbjct:    1 AEHAVDGNRSGRFSDLSCTETKVQSNPWWRVDLQKSYVILRLFIVNRADCCGERLDNFEIRIGDSLENNGTDNPSCGSSYIIPHGGSKSISC 92          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO35318 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLV0])

HSP 1 Score: 55.0694 bits (131), Expect = 3.585e-10
Identity = 33/89 (37.08%), Postives = 47/89 (52.81%), Query Frame = 3
Query:   24 LSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS-SDN 287
            L+  K   QS+T    N   A  AVDG T+G +  GSC+HT +    WW+VDL     +S + + NR+     RL    V++ DS +DN
Sbjct:   99 LALSKTTAQSTTL---NSGDASRAVDGNTDGDYFRGSCTHTRDQPSPWWRVDLGTTQPVSEVFLVNRLGDAANRLFNVEVRVGDSLTDN 184          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO25871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDH1])

HSP 1 Score: 52.7582 bits (125), Expect = 6.552e-10
Identity = 33/92 (35.87%), Postives = 46/92 (50.00%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS-----SDNVLINCTVITEYQPLYNISC 344
            AE AVDG  +G F D SC+ T      WW+VDL K  +I  + I NR D   +RL    +++ DS     +DN     + I  +    +ISC
Sbjct:    3 AEHAVDGDRSGRFADLSCTETKVQSNPWWRVDLQKSYVILRLFIVNRADCCGERLDNFEIRIGDSLENNGTDNPSCGSSYIIPHGGSKSISC 94          
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Match: EDO36041 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS4])

HSP 1 Score: 52.373 bits (124), Expect = 9.919e-10
Identity = 34/105 (32.38%), Postives = 54/105 (51.43%), Query Frame = 3
Query:   84 AELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDS-SDNVLIN--CTVITEYQPLYNIS--CIPWKT-RKVQIQM 380
            A  AVDG T+G +  GSC+HT +    WW+VDL     +S + + NR+     +L    V++ DS +DN   N  C  +     L  +S  C P ++ R V +++
Sbjct:    3 ASRAVDGNTDGDYGRGSCTHTRDQPNPWWRVDLGTTQPVSEVFLVNRLGDAANKLNNVEVRVGDSLTDNGNTNPRCGDMFSMATLQKLSIYCKPRRSGRYVNVRL 107          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000014428.1 (SMESG000014428.1)

HSP 1 Score: 90.1225 bits (222), Expect = 9.244e-24
Identity = 53/133 (39.85%), Postives = 73/133 (54.89%), Query Frame = 3
Query:    6 VQCQDSLSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEYQPLYNISCIPWKTRKVQIQMERNEYLTL 404
            V C   LS+ KPA QSS  DY +   A  AVDG      N   CSHTN +   WW VDL     I++++I+NR      RL+GA V++LDS+  V+  C  +     ++ + C   +  KV+I+M R EYLTL
Sbjct:   14 VNCDVMLSQGKPASQSS--DYLSFV-ASYAVDGNVGQSLNKDKCSHTNKDSQPWWMVDLQGSYAITSVIIFNRNSFVSNRLVGAIVEVLDSNGLVVSRCGEVKTDDSVHLLHCQKSRGSKVRIRMTRPEYLTL 143          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000014421.1 (SMESG000014421.1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.293e-23
Identity = 55/137 (40.15%), Postives = 78/137 (56.93%), Query Frame = 3
Query:    6 VQCQDSLSRLKPAYQSSTYDYYNITGAELAVDG-KTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEYQPLYNISC---IPWKTRKVQIQMERNEYLTL 404
            V C++  S  +P+YQSS    Y    A+LAVDG     +  DG CS T+N    WW V+L  E  IS ++I+NR+D    R++GA V +LD  +  +  C +IT+Y P+  + C         KV+I+MER EYLTL
Sbjct:   35 VNCEELWSEGRPSYQSSQVGNYM---AKLAVDGNHGQNLLKDG-CSQTSNENRPWWMVNLENEIRISMVMIFNRVDDYQDRIVGAIVDVLDKENKFVGTCGIITKYDPISLMWCNNGTGILGSKVRIRMERQEYLTL 167          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000014441.1 (SMESG000014441.1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.004e-23
Identity = 53/136 (38.97%), Postives = 76/136 (55.88%), Query Frame = 3
Query:    6 VQCQDSLSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEYQPLYNISC---IPWKTRKVQIQMERNEYLTL 404
            + C+  LSR KPAYQSS Y+ Y+   A  AVDG          CS T+N+   WW V+L  EA I+ + I+NR D   +R+ GA V++LD +D V   C ++     + N+ C         KV++++ER EYLTL
Sbjct:   14 IYCELLLSRGKPAYQSSVYEDYH---AGYAVDGNNGQHLEKHKCSQTSNDNRPWWMVNLTVEAKITLVTIFNRQDQFSERIEGAVVEVLDKNDEVTGLCGIVMADNSVINLWCNQRAGIFGSKVRVKLERQEYLTL 146          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000014425.1 (SMESG000014425.1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.847e-22
Identity = 50/137 (36.50%), Postives = 75/137 (54.74%), Query Frame = 3
Query:    6 VQCQDSLSRLKPAYQSSTYDYYNITGAELAVDG-KTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEYQPLYNISC---IPWKTRKVQIQMERNEYLTL 404
            V C    S+ +P YQSS ++ Y    +  AVDG K   +  DG CS T+N+   WW VDL  E  I  ++++NR+D    R++GA + +LD  +  +  C +I  Y P+  + C         KV+I++ER EYLTL
Sbjct:   14 VNCLKLWSQGRPTYQSSQFENYK---SSYAVDGNKGQNLLKDG-CSQTSNDYRPWWMVDLENEIQIGRVIVFNRVDAYQNRIVGAIIDILDKENKFVGTCGMINAYDPISVVWCNESHGMLGSKVRIRIERQEYLTL 146          
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Match: SMESG000014445.1 (SMESG000014445.1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.863e-22
Identity = 53/131 (40.46%), Postives = 70/131 (53.44%), Query Frame = 3
Query:   12 CQDSLSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNNNVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINCTVITEYQPLYNISCIPWKTRKVQIQMERNEYLTL 404
            C   LS+ KPA QSS  DY +   A  AVDG      N   CSHTN +   WW VDL     I+++ I+NR      RL+GA V++LDS+  V+  C  I     ++ + C      KV+I+M R EYLTL
Sbjct:   16 CDVMLSQGKPASQSS--DYLSFV-ASYAVDGNLGQSLNKDKCSHTNKDSQPWWMVDLQGSYTITSVTIFNRNSFVSNRLVGAIVEVLDSNGVVVSRCGKIKTDDSVHILRCKKRIGSKVRIRMARPEYLTL 143          
The following BLAST results are available for this feature:
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-359m17.27.431e-1240.24si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.22.144e-1140.24si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.23.183e-1138.64si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch211-215k15.46.763e-1033.63si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch211-215k15.46.812e-1033.63si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fucolectin1.391e-1942.75x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin1.692e-1942.31x-epilectin [Source:NCBI gene;Acc:100144955][more]
ENSXETT00000033868.12.047e-1937.98pep primary_assembly:Xenopus_tropicalis_v9.1:6:133... [more]
ENSXETT00000056156.11.984e-1840.00pep primary_assembly:Xenopus_tropicalis_v9.1:6:132... [more]
ENSXETT00000056155.12.150e-1840.00pep primary_assembly:Xenopus_tropicalis_v9.1:6:132... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I931|FUCL1_ANGJA1.701e-1136.04Fucolectin-1 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I925|FUCL7_ANGJA1.040e-1035.58Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I927|FUCL5_ANGJA1.051e-1033.64Fucolectin-5 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I926|FUCL6_ANGJA1.052e-933.04Fucolectin-6 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I928|FUCL4_ANGJA1.099e-836.05Fucolectin-4 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5G3LFH42.184e-1642.75Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A5G3LDN62.656e-1642.31Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A5G3HRL13.215e-1637.98Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A9UMT32.092e-1536.30FTP domain-containing protein OS=Xenopus tropicali... [more]
A0A5G3LDP03.116e-1540.00Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000033919.12.929e-1638.94fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000035987.13.112e-1638.94fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000051696.11.289e-1538.18fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000042585.12.454e-1538.18fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000008051.25.127e-1438.28pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353023.384e-1342.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331943.568e-1035.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353183.585e-1037.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258716.552e-1035.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360419.919e-1032.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-SMC condensin II complex subunit G2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014428.19.244e-2439.85SMESG000014428.1[more]
SMESG000014421.11.293e-2340.15SMESG000014421.1[more]
SMESG000014441.15.004e-2338.97SMESG000014441.1[more]
SMESG000014425.11.847e-2236.50SMESG000014425.1[more]
SMESG000014445.11.863e-2240.46SMESG000014445.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022406 ID=SMED30022406|Name=Non-SMC condensin II complex subunit G2|organism=Schmidtea mediterranea sexual|type=transcript|length=406bp
TTTGTGTCCAATGCCAGGATTCATTATCACGCCTCAAGCCTGCATACCAG
TCAAGCACTTACGATTATTATAATATCACCGGCGCAGAGTTAGCAGTTGA
CGGTAAGACAAATGGGATTTTCAATGATGGAAGTTGCAGTCATACCAATA
ATAACGTTCCATCTTGGTGGAAGGTAGATTTATTAAAGGAAGCTATAATC
TCAAACATTCTCATTTACAATCGGATTGATATGGAGCATCAACGGTTGAT
TGGAGCATACGTTCAGTTATTAGATTCCTCCGACAACGTTCTCATCAACT
GCACTGTGATAACTGAGTATCAACCCCTTTACAATATCTCATGCATTCCA
TGGAAGACTCGTAAGGTGCAAATTCAAATGGAAAGGAATGAGTATTTGAC
CTTGTG
back to top

protein sequence of SMED30022406-orf-1

>SMED30022406-orf-1 ID=SMED30022406-orf-1|Name=SMED30022406-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
CVQCQDSLSRLKPAYQSSTYDYYNITGAELAVDGKTNGIFNDGSCSHTNN
NVPSWWKVDLLKEAIISNILIYNRIDMEHQRLIGAYVQLLDSSDNVLINC
TVITEYQPLYNISCIPWKTRKVQIQMERNEYLTL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002074pharynx tip
Vocabulary: INTERPRO
TermDefinition
IPR006585FTP1
IPR008979Galactose-bd-like_sf
IPR000421FA58C
Vocabulary: biological process
TermDefinition
GO:0001868regulation of complement activation, lectin pathway
GO:0010185regulation of cellular defense response
GO:0045088regulation of innate immune response
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0030246carbohydrate binding
GO:0042806fucose binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006585Fucolectin tachylectin-4 pentraxin-1SMARTSM00607ftpcoord: 5..134
e-value: 3.8E-4
score: 7.0
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 16..86
e-value: 9.7E-7
score: 29.0
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 3..134
e-value: 6.5E-30
score: 106.0
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 7..133
NoneNo IPR availablePANTHERPTHR45713FAMILY NOT NAMEDcoord: 11..134