5'-tyrosyl-DNA phosphodiesterase

Overview
Name5'-tyrosyl-DNA phosphodiesterase
Smed IDSMED30022404
Length (bp)1131
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5'-tyrosyl-DNA phosphodiesterase (SMED30022404) t-SNE clustered cells

Violin plots show distribution of expression levels for 5'-tyrosyl-DNA phosphodiesterase (SMED30022404) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5'-tyrosyl-DNA phosphodiesterase (SMED30022404) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5'-tyrosyl-DNA phosphodiesterase (SMED30022404) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022404

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022404SMESG000024529.1 SmedASXL_014298SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30022404SMESG000024529.1 dd_Smed_v4_12962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30022404SMESG000024529.1 dd_Smed_v4_12962_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022404SMESG000024529.1 SMED30022404smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30022404SMESG000024529.1 SMED_30137_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30022404SMESG000024529.1 SMED_30137_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Human
Match: TDP2 (tyrosyl-DNA phosphodiesterase 2 [Source:HGNC Symbol;Acc:HGNC:17768])

HSP 1 Score: 122.094 bits (305), Expect = 1.085e-33
Identity = 69/169 (40.83%), Postives = 102/169 (60.36%), Query Frame = 1
Query:  550 KRFQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIM 1050
            K  ++  F +T M R+L+ + V ++   + LMTSHLESTR +++ RM QLK   ++M++  +S   IFAGD NLRD+E+ + G LP +I DVWE  GK    ++TWD +   N+N         RFDR++F  +  A   +I P    L GL+K+  G RFPSDHW ++
Sbjct:  134 KSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ--MNSNLGITAACKLRFDRIFF--RAAAEEGHIIPRSLDLLGLEKLDCG-RFPSDHWGLL 297          

HSP 2 Score: 41.9726 bits (97), Expect = 1.085e-33
Identity = 21/87 (24.14%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  210 PCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            P    +  N   F +++WN++GL+  +L +R   V   +     +++FLQE++    + ++K+    + I T ++ G Y+  I+++K
Sbjct:   44 PSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKR-SSNYEIITGHEEG-YFTAIMLKK 128          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Human
Match: TDP2 (tyrosyl-DNA phosphodiesterase 2 [Source:HGNC Symbol;Acc:HGNC:17768])

HSP 1 Score: 122.094 bits (305), Expect = 1.287e-33
Identity = 69/169 (40.83%), Postives = 102/169 (60.36%), Query Frame = 1
Query:  550 KRFQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIM 1050
            K  ++  F +T M R+L+ + V ++   + LMTSHLESTR +++ RM QLK   ++M++  +S   IFAGD NLRD+E+ + G LP +I DVWE  GK    ++TWD +   N+N         RFDR++F  +  A   +I P    L GL+K+  G RFPSDHW ++
Sbjct:  192 KSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ--MNSNLGITAACKLRFDRIFF--RAAAEEGHIIPRSLDLLGLEKLDCG-RFPSDHWGLL 355          

HSP 2 Score: 41.5874 bits (96), Expect = 1.287e-33
Identity = 21/87 (24.14%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  210 PCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            P    +  N   F +++WN++GL+  +L +R   V   +     +++FLQE++    + ++K+    + I T ++ G Y+  I+++K
Sbjct:  102 PSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKR-SSNYEIITGHEEG-YFTAIMLKK 186          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Celegans
Match: tdpt-1 (5'-tyrosyl-DNA phosphodiesterase [Source:UniProtKB/Swiss-Prot;Acc:Q9XWG3])

HSP 1 Score: 96.6709 bits (239), Expect = 9.698e-31
Identity = 67/180 (37.22%), Postives = 92/180 (51.11%), Query Frame = 1
Query:  550 KRFQVEK-----FDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLK---SAFREM--KKDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFF 1059
            K F VEK     F N+ M R L  L   I  + + L+ +HLESTR++   R AQ        RE+  +       F GDLNLRD+E+ ++   P  + D WEA G   + +FTWD  +N   N+   +G   RFDR+Y+          +  V F LEG Q+I+  + FPSDHWAI   F
Sbjct:  193 KMFDVEKHDVIHFQNSGMYRTLQILEGSIGGLKVFLLNTHLESTREHRPQRCAQFGFCMDKVREIIAQNPGALVFFGGDLNLRDEEVSRV---PDGVKDAWEAAGSDNKTKFTWDTFKN--DNKQGFHGAKMRFDRLYWSGP-------LDKVKFTLEGRQRIRSCLCFPSDHWAINATF 360          

HSP 2 Score: 55.8398 bits (133), Expect = 9.698e-31
Identity = 42/155 (27.10%), Postives = 72/155 (46.45%), Query Frame = 3
Query:   63 QKRIDDFVESTNTDVALAMYYLGENKYNLKVALEKFELDDHILINGFNVPCSQ------------IRTNNLKEFRI--LSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRKHPDIQ 485
            ++++ +F   T TD A A   L +  ++LK AL+ F           +                 +   +LK F +  +SWN++GL+ + L  R  +V   + N   +I+FLQE+V+ +   I K L   + I+ +N    YY  ILV K  D++
Sbjct:   46 EQKLHEFAIITATDEAFAQSILQDVDWDLKKALDVF-YGSEAFAEARSAAVMGASSSMASSGAAVMTAEDLKGFEVSVMSWNIDGLDGRSLLTRMKAVAHIVKNVNPDILFLQEVVDRDLAPIDK-LQSLYKIYYSNKGCQYYTAILVSKMFDVE 198          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Zebrafish
Match: tdp2a (tyrosyl-DNA phosphodiesterase 2a [Source:ZFIN;Acc:ZDB-GENE-110218-1])

HSP 1 Score: 110.923 bits (276), Expect = 8.696e-33
Identity = 67/173 (38.73%), Postives = 95/173 (54.91%), Query Frame = 1
Query:  547 CKRFQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSD--FSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFF 1059
            C +  + K+  T   R+L+   V  +   + +MTSHLES +  S  R+ QL   ++ MK+  +    IF GD NLRD E+K++G LP  I DVWE  G+  E R+TWD   + N N + PN    RFDR++   K  A G  ++P    L GL+K+K    F SDHW I+  F
Sbjct:  270 CIQSNIVKYPTTEQGRNLLIANVSFSGHPLCIMTSHLESCKTGSQERLNQLWRVWKWMKETPEDHTVIFGGDTNLRDWEVKKLGGLPDGISDVWEMLGQPEESRYTWD--TSINDNNDIPNPIRLRFDRLFL--KGAANGAQLRPESMTLIGLEKLKCDY-FISDHWGILCTF 437          

HSP 2 Score: 49.2914 bits (116), Expect = 8.696e-33
Identity = 28/85 (32.94%), Postives = 52/85 (61.18%), Query Frame = 3
Query:  216 SQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            +  R+N+L    +LSWN++GL+ ++++ R   ++  +   +A++V LQELV     +I K + K+      ++ G Y+CGIL+RK
Sbjct:  186 ASARSNHLT---VLSWNIDGLDDENVRDRVKGLLSHLGKYRADVVLLQELVPPC-VKILKNVIKDDQFLEGSEDG-YFCGILLRK 265          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Zebrafish
Match: tdp2b (tyrosyl-DNA phosphodiesterase 2b [Source:NCBI gene;Acc:553516])

HSP 1 Score: 117.472 bits (293), Expect = 1.045e-32
Identity = 65/167 (38.92%), Postives = 93/167 (55.69%), Query Frame = 1
Query:  571 FDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            F  T M R+L+   V  +   + LMTSHLES ++ S  R  QL+   +++K+  +    IFAGD NLRD E+  +G LP  +CDVWE  GK+   R+TWD K   N+N+  P     RFDR++  S + A    + P    L G++K+  G R+ SDHW I   F+ 
Sbjct:  222 FPTTQMMRNLLIAQVTFSGQKLYLMTSHLESCKNQSQERTKQLRVVLQKIKEAPEDAIVIFAGDTNLRDAEVANVGGLPAGVCDVWEQLGKQEHCRYTWDTKA--NSNKTVPYVSRCRFDRIFLRSAKTAPP--VTPDHMALIGMEKLDCG-RYTSDHWGIYCTFNT 383          

HSP 2 Score: 42.743 bits (99), Expect = 1.045e-32
Identity = 50/207 (24.15%), Postives = 85/207 (41.06%), Query Frame = 3
Query:   15 MMSDNESDNDLPK--EVYQKRIDDFVESTNTDVALAMYYLGENKYNLKVAL----------------EKFEL------DDHILINGF-------NVPCSQIR--------TNNLKE----------------FRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            ++S N++D  +    E   +  D F   + +D A+A  YL EN+++++ AL                EK E+      DD    +G        N  C  +         T N KE                  I+SWN++GL+  +L  R   +   +     ++VFLQEL+      ++K+    +  F  +D G Y+ GI++RK
Sbjct:    5 VLSGNQTDQQMSALGESRTRLCDQFAFVSGSDSAVAQCYLAENEWDMERALNSFFEAHMDSVFDEEAEKTEVTGNKRKDDTAEASGTKKKLKTDNADCIDLTAEEPTCSITVNSKENQAENGTAKSEVEDSKLSIISWNVDGLDTLNLADRARGLCSYLALYTPDVVFLQELIPAYVQYLKKR-AVSYLFFEGSDDG-YFTGIMLRK 209          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Zebrafish
Match: tdp2b (tyrosyl-DNA phosphodiesterase 2b [Source:NCBI gene;Acc:553516])

HSP 1 Score: 115.161 bits (287), Expect = 1.371e-31
Identity = 65/163 (39.88%), Postives = 92/163 (56.44%), Query Frame = 1
Query:  571 FDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYS--KRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAI 1047
            F  T M R+L+   V  +   + LMTSHLES ++ S  R  QL+   +++K+  +    IFAGD NLRD E+  +G LP  +CDVWE  GK+   R+TWD K   N+N+  P     RFDR++  S   RPA    + P    L G++K+  G R+ SDHW +
Sbjct:  226 FPTTQMMRNLLIAQVTFSGQKLYLMTSHLESCKNQSQERTKQLRVVLQKIKEAPEDAIVIFAGDTNLRDAEVANVGGLPAGVCDVWEQLGKQEHCRYTWDTKA--NSNKTVPYVSRCRFDRIFLRSAKTRPA----VTPDHMALIGMEKLDCG-RYTSDHWVL 381          

HSP 2 Score: 40.817 bits (94), Expect = 1.371e-31
Identity = 23/76 (30.26%), Postives = 43/76 (56.58%), Query Frame = 3
Query:  243 EFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            +  I+SWN++GL+  +L +R   +   +     ++VFLQEL+      ++K+    +  F  +D G Y+ GI++RK
Sbjct:  140 KLSIISWNVDGLDTLNLAERARGLCSYLALYTPDVVFLQELIPAYVQYLKKR-AVSYLFFEGSDDG-YFTGIMLRK 213          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Xenopus
Match: hpdl (4-hydroxyphenylpyruvate dioxygenase like [Source:Xenbase;Acc:XB-GENE-948483])

HSP 1 Score: 119.013 bits (297), Expect = 3.636e-32
Identity = 67/171 (39.18%), Postives = 98/171 (57.31%), Query Frame = 1
Query:  559 QVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFS--IFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            ++  + +T M R+L+   V I+  +I LMTSHLEST+D+S  R+ QL    ++M      +  IF GD NLRD+E+ +IG +P +I DVW+  GK    R+TWD K   N N   P     RFDR++F + +   G  + P    L G +K+  G RFPSDHW ++  F +
Sbjct:  202 EIVPYPSTVMMRNLLVANVNISGNSICLMTSHLESTKDHSKERLKQLDIVLKKMMDAPPLATVIFGGDTNLRDQEVAKIGGMPNNILDVWDFLGKPEHCRYTWDTK--VNKNLRAPYICRLRFDRIFFRASQ--EGSQVIPQSLYLAGTEKLDCG-RFPSDHWGLLCDFAI 367          

HSP 2 Score: 39.6614 bits (91), Expect = 3.636e-32
Identity = 20/85 (23.53%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  216 SQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            S ++  +   F  L+WN++GL+  ++ +R   V   +     ++VFLQE++      ++K+    + I T N+   Y+  ++++K
Sbjct:  111 STVKQEDESHFSFLTWNIDGLDESNVAERARGVCSYLALYSPDVVFLQEVIPPYYEYLKKR-AVSYTIITGNE-DEYFTAMMLKK 193          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Mouse
Match: Tdp2 (tyrosyl-DNA phosphodiesterase 2 [Source:MGI Symbol;Acc:MGI:1860486])

HSP 1 Score: 124.405 bits (311), Expect = 8.167e-35
Identity = 70/174 (40.23%), Postives = 103/174 (59.20%), Query Frame = 1
Query:  550 KRFQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            K  ++  F NT M R+L+ + V +      LMTSHLESTR++S+ R+ QLK+   +M++  DS   IFAGD NLRD+E+ + G LP ++ D WE  GK    ++TWD K   N N   P  +  RFDR++F ++      ++ P    L GL+K+  G RFPSDHW ++   +V
Sbjct:  202 KSQEIIPFPNTKMMRNLLCVNVSLGGNEFCLMTSHLESTREHSAERIRQLKTVLGKMQEAPDSTTVIFAGDTNLRDQEVIKCGGLPDNVFDAWEFLGKPKHCQYTWDTKA--NNNLRIPAAYKHRFDRIFFRAEE----GHLIPQSLDLVGLEKLDCG-RFPSDHWGLLCTLNV 368          

HSP 2 Score: 42.3578 bits (98), Expect = 8.167e-35
Identity = 21/72 (29.17%), Postives = 41/72 (56.94%), Query Frame = 3
Query:  255 LSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            ++WN++GL+  +L +R   V   +     ++VFLQE++      ++K+    + I T N+ G Y+  IL++K
Sbjct:  127 ITWNIDGLDGCNLPERARGVCSCLALYSPDVVFLQEVIPPYCAYLKKR-AASYTIITGNEEG-YFTAILLKK 196          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q3T1H5|TYDP2_RAT (Tyrosyl-DNA phosphodiesterase 2 OS=Rattus norvegicus OX=10116 GN=Tdp2 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.626e-36
Identity = 70/171 (40.94%), Postives = 102/171 (59.65%), Query Frame = 1
Query:  559 QVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            ++  F NT M R+L+ + V +      LMTSHLESTR +S+ R+ QLK+ F++M++  DS   IFAGD NLRD+E+ + G LP ++ D WE  GK    R+TWD K   N N   P     RFDR++F ++      ++ P    L GL+++  G RFPSDHW ++   +V
Sbjct:  201 EIIPFPNTKMMRNLLCVNVSLGGNEFCLMTSHLESTRKHSAERINQLKTVFQKMQEATDSTTVIFAGDTNLRDQEVIKCGGLPDNVFDAWEFLGKPKHCRYTWDTKA--NDNLRIPAACKHRFDRIFFRAEE----GHLIPQSLDLIGLERLDCG-RFPSDHWGLLCTLNV 364          

HSP 2 Score: 49.6766 bits (117), Expect = 2.626e-36
Identity = 40/167 (23.95%), Postives = 71/167 (42.51%), Query Frame = 3
Query:   54 EVYQKRIDD--FVESTNTDVALAMYYLGENKYNLKVALEKF-ELDDHILINGFNVPCSQ-------------------------IRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            +V ++R+    F   T+ D  +A  +L EN +  K AL  F E  ++ L      P S                              +      ++WN++GL+  +L +R   V   +     ++VFLQE++      +RK+  + +NI T N+ G Y+  IL++K
Sbjct:   28 QVKRRRLQSLGFALVTSCDTTVASTFLSENNWQTKKALSAFFEQPENDLARPHQPPTSSKSEDYVDLTNEDANDTTILETSPSGTPLEDSSTISFITWNIDGLDGCNLPERARGVCSCLALYSPDVVFLQEVIPSYCAYLRKR-ARTYNIITGNEEG-YFTAILLKK 192          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. UniProt/SwissProt
Match: sp|F1NW29|TYDP2_CHICK (Tyrosyl-DNA phosphodiesterase 2 OS=Gallus gallus OX=9031 GN=TDP2 PE=3 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 1.712e-35
Identity = 76/172 (44.19%), Postives = 105/172 (61.05%), Query Frame = 1
Query:  559 QVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFS--IFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAA-GKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            ++ +F  T+M R+L+ + V I+   + LMTSHLESTRD+S  RM QL+    +M+++S  +  IF GD NLRD E+ ++G LP +I D+WE  GK    R+TWD     N N    +    RFDR+YF   RPAA G +I P    L GL+K+  G RFPSDHW ++  F V
Sbjct:  202 EIIRFPTTSMMRNLLVVHVNISGNELCLMTSHLESTRDHSKERMKQLQIVLNKMQEESQSTTVIFGGDTNLRDSEVAKLGGLPKNITDIWEFLGKPQHCRYTWDTSS--NTNLRIESKCKLRFDRLYF---RPAAEGGHIIPRNMDLIGLEKLDCG-RFPSDHWGLLCRFDV 367          

HSP 2 Score: 39.6614 bits (91), Expect = 1.712e-35
Identity = 22/83 (26.51%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  246 FRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRKHPDIQTRK 494
            F +++WN++GL+  +L++R   V   +     ++VFLQE++      ++++ G  + I   N  G Y+  +L++K P ++  K
Sbjct:  121 FSLITWNIDGLDLGNLQERARGVCSYLALYSPDVVFLQEVIPPYLCILQRRAGG-YTIIPGNVDG-YFTAMLLKK-PRVKVLK 200          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q9JJX7|TYDP2_MOUSE (Tyrosyl-DNA phosphodiesterase 2 OS=Mus musculus OX=10090 GN=Tdp2 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 4.895e-34
Identity = 70/174 (40.23%), Postives = 103/174 (59.20%), Query Frame = 1
Query:  550 KRFQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            K  ++  F NT M R+L+ + V +      LMTSHLESTR++S+ R+ QLK+   +M++  DS   IFAGD NLRD+E+ + G LP ++ D WE  GK    ++TWD K   N N   P  +  RFDR++F ++      ++ P    L GL+K+  G RFPSDHW ++   +V
Sbjct:  202 KSQEIIPFPNTKMMRNLLCVNVSLGGNEFCLMTSHLESTREHSAERIRQLKTVLGKMQEAPDSTTVIFAGDTNLRDQEVIKCGGLPDNVFDAWEFLGKPKHCQYTWDTKA--NNNLRIPAAYKHRFDRIFFRAEE----GHLIPQSLDLVGLEKLDCG-RFPSDHWGLLCTLNV 368          

HSP 2 Score: 42.3578 bits (98), Expect = 4.895e-34
Identity = 21/72 (29.17%), Postives = 41/72 (56.94%), Query Frame = 3
Query:  255 LSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            ++WN++GL+  +L +R   V   +     ++VFLQE++      ++K+    + I T N+ G Y+  IL++K
Sbjct:  127 ITWNIDGLDGCNLPERARGVCSCLALYSPDVVFLQEVIPPYCAYLKKR-AASYTIITGNEEG-YFTAILLKK 196          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. UniProt/SwissProt
Match: sp|A7YWI9|TYDP2_BOVIN (Tyrosyl-DNA phosphodiesterase 2 OS=Bos taurus OX=9913 GN=TDP2 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.004e-33
Identity = 73/176 (41.48%), Postives = 101/176 (57.39%), Query Frame = 1
Query:  550 KRFQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNAN--QNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            K  ++  F NT M R+L+ + V ++   + LMTSHLESTR ++  RM Q K    +M++   S   IFAGD NLRD+E+ + G LP +I DVWE  GK    ++TWD + N N     NC      RFDR++F  +  A G +I P    L GL+K+  G RFPSDHW ++    V
Sbjct:  194 KSQEIIPFPNTQMMRNLLCVHVSVSGNELCLMTSHLESTRGHAKERMNQFKMVLEKMQEAPGSATVIFAGDTNLRDQEVTKCGGLPNNILDVWEFLGKPKHCQYTWDTQMNSNLGIAANCK----LRFDRIFF--RAAAEGGHIIPQSLDLLGLEKLDCG-RFPSDHWGLLCTLDV 362          

HSP 2 Score: 41.9726 bits (97), Expect = 1.004e-33
Identity = 32/160 (20.00%), Postives = 65/160 (40.62%), Query Frame = 3
Query:   78 DFVESTNTDVALAMYYLGENKYNLKVALEKF-----------------------------ELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            +F    + D A+A  YL EN + ++ AL  +                             E +D I           ++  +   F  ++WN++GL+  +L +R   V   +     +++FLQE++      ++K+    + I T  + G Y+  I+++K
Sbjct:   31 EFASVASCDAAVAQCYLAENDWEMERALNSYFEPAVEESASESRPESLSEPGSCVDLTKEETNDSISSKTSTSEDKSVQQEDGSVFSFITWNIDGLDMNNLLERARGVCSYLTLYSPDVIFLQEVIPPYYAYLKKK-ASSYKIITGREEG-YFTAIMLKK 188          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. UniProt/SwissProt
Match: sp|O95551|TYDP2_HUMAN (Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=TDP2 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 5.592e-33
Identity = 69/169 (40.83%), Postives = 102/169 (60.36%), Query Frame = 1
Query:  550 KRFQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIM 1050
            K  ++  F +T M R+L+ + V ++   + LMTSHLESTR +++ RM QLK   ++M++  +S   IFAGD NLRD+E+ + G LP +I DVWE  GK    ++TWD +   N+N         RFDR++F  +  A   +I P    L GL+K+  G RFPSDHW ++
Sbjct:  192 KSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ--MNSNLGITAACKLRFDRIFF--RAAAEEGHIIPRSLDLLGLEKLDCG-RFPSDHWGLL 355          

HSP 2 Score: 41.5874 bits (96), Expect = 5.592e-33
Identity = 21/87 (24.14%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  210 PCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            P    +  N   F +++WN++GL+  +L +R   V   +     +++FLQE++    + ++K+    + I T ++ G Y+  I+++K
Sbjct:  102 PSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKR-SSNYEIITGHEEG-YFTAIMLKK 186          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. TrEMBL
Match: R7T4X8 (Endo/exonuclease/phosphatase domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_219632 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.886e-51
Identity = 77/163 (47.24%), Postives = 105/163 (64.42%), Query Frame = 1
Query:  571 FDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFF 1059
            F ++ M R+L+++  E+  I + LMTSHLEST+  S+ R+ QL+ AF EM K     IF GDLNLRD EL ++G +P  + D+WE TGKR E ++TWD  RN N N    N    RFDR+Y   K  A  + +KPV+F L GL+++K  +R+PSDHW IM  F
Sbjct:  157 FHSSKMARNLLAVQAEVKGIDLWLMTSHLESTKTSSAERVRQLQKAFAEMHKPQTSVIFGGDLNLRDYELDKVGGMPEGVLDLWEVTGKRPEAKYTWDMSRNDNLNFPYRNA-KCRFDRLYM--KHSAKQRELKPVYFELVGLERVKSCLRYPSDHWGIMTHF 316          

HSP 2 Score: 82.0333 bits (201), Expect = 1.886e-51
Identity = 49/152 (32.24%), Postives = 88/152 (57.89%), Query Frame = 3
Query:   18 MSDNESDNDLPKEV-YQKRIDDFVESTNTDVALAMYYLGENKYNLKVALEKFELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            MSD++ +N LP  +   +R   F E T TD ALAM++L + ++N++ ++E     D+   +G +   S++     +  R++SWN++GL+  +LK RT  V++ I    A++VFLQE+V     E+ + L  E+ +  A+  G++ C +L  K
Sbjct:    1 MSDSDDEN-LPDALECDRRCATFAEITGTDSALAMFFLQDREWNVQKSVE-----DYFGQSGESTEVSKVADAEPQRIRLISWNIDGLDTNNLKARTTQVVDIIKKENAHVVFLQEVV-PTSLELLQDLCPEYLMLNADTFGYFTCIMLHTK 145          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. TrEMBL
Match: A0A4E0R9D6 (Traf and tnf receptor associated protein OS=Fasciola hepatica OX=6192 GN=D915_004083 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.806e-50
Identity = 85/201 (42.29%), Postives = 115/201 (57.21%), Query Frame = 1
Query:  556 FQVEKFDNTTMDRHLVSLVVEINE------------IAIKLMTSHLESTRDYSSLRMAQLKSAFREMK-----------KDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQ---NCPNGFGQ----RFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHVE 1068
            F V  F N+ M RHLVS+ + IN             I++++ T+HLES R+ S+ R  QL  A+  MK           +    SIF GDLNLRDKE++++G +PPDI DVW ATG R E+  TWDP+RN NA++     P  +G     R+DRMY +      G  +KPV FGL GL+K+     FPSDHW I+G F ++
Sbjct:  187 FLVHSFPNSVMGRHLVSIKLNINSAKLTDQPTPSTTISVRIFTAHLESCRESSAERKNQLAYAWTRMKYFGPPSENASNEHPRASIFCGDLNLRDKEVEELGGVPPDITDVWLATGSRLELCATWDPRRNTNASRLVGGGPRRYGSSPIFRYDRMYVH------GAGLKPVDFGLRGLEKVPGAACFPSDHWGILGRFQLD 381          

HSP 2 Score: 78.1814 bits (191), Expect = 1.806e-50
Identity = 54/184 (29.35%), Postives = 97/184 (52.72%), Query Frame = 3
Query:   18 MSDNESDNDLPKEVYQKRIDDFVESTNTDVALAMYYLGENKYNLKVALEKFELD----------DHILI---NGFNVPCSQIRTNNLK--EFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLG-----HYYCGILVRKHPDIQTRKDSFKV 509
            +SD   D++     Y      F E T+T+ ALAM +L +  ++L+ AL  F  +          DHI +   +  +VP + + +N ++   F +LSWN++GL+  ++ +RTD ++  + +   ++V  QE+        R +L K++ IF+  DL      HY+  I+VR+HP I+  ++SF V
Sbjct:   12 LSDTTRDHE-----YLSLCSQFAEITSTNNALAMAFLQDRDWDLERALADFFAEHRTEEPSVQIDHIDLTETSSEDVP-TTLESNAVECTVFNVLSWNVDGLDTSNIVQRTDEIVSRLKSEPFHVVCFQEVTMVTLPMFRTKLEKDYLIFSPTDLPFSDCVHYFVTIMVRRHPAIEVDRNSFLV 189          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. TrEMBL
Match: A0A504ZBR0 (Traf and tnf receptor associated protein OS=Fasciola gigantica OX=46835 GN=FGIG_03204 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.150e-50
Identity = 85/201 (42.29%), Postives = 115/201 (57.21%), Query Frame = 1
Query:  556 FQVEKFDNTTMDRHLVSLVVEINE------------IAIKLMTSHLESTRDYSSLRMAQLKSAFREMK-----------KDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQ---NCPNGFGQ----RFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHVE 1068
            F V  F N+ M RHLVS+ + IN             I++++ T+HLES R+ S+ R  QL  A+  MK           +    SIF GDLNLRDKE++++G +PPDI DVW ATG R E+  TWDP+RN NA++     P  +G     R+DRMY +      G  +KPV FGL GL+K+     FPSDHW I+G F ++
Sbjct:  187 FLVHSFPNSVMGRHLVSIKLNINSAKLTDQPTPSTTISVRIFTAHLESCRESSAERKNQLAYAWTRMKHFGPPSENASNEHPRASIFCGDLNLRDKEVEELGGVPPDITDVWLATGSRLELCATWDPRRNTNASRLVGGGPRRYGSSPIFRYDRMYVH------GAGLKPVDFGLRGLEKVPGAACFPSDHWGILGRFQLD 381          

HSP 2 Score: 77.7962 bits (190), Expect = 2.150e-50
Identity = 51/170 (30.00%), Postives = 91/170 (53.53%), Query Frame = 3
Query:   60 YQKRIDDFVESTNTDVALAMYYLGENKYNLKVALEKFELD----------DHILI---NGFNVPCSQIRTNNLK--EFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLG-----HYYCGILVRKHPDIQTRKDSFKV 509
            Y      F E T+T+ ALAM +L +  ++L+ AL  F  +          DHI +   +  +VP + + +N ++   F +LSWN++GL+  +L +RTD ++  + +   ++V  QE+        R +L K++ IF+  DL      HY+  I++R+HP I+  ++SF V
Sbjct:   21 YLSLCSQFAEITSTNNALAMAFLQDTDWDLERALADFFAEHRTEEHSVQIDHIDLTETSSEDVPIT-LESNAVECTVFNVLSWNVDGLDTSNLVQRTDEIVSRLKSEPFHVVCFQEVTMVTLPMFRTKLEKDYLIFSPTDLPFSDCVHYFVTIMIRRHPAIEVDRNSFLV 189          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. TrEMBL
Match: A0A0R3UF73 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5724 PE=4 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 2.993e-47
Identity = 78/205 (38.05%), Postives = 106/205 (51.71%), Query Frame = 1
Query:  556 FQVEKFDNTTMDRHLVSLVVEINE---------------IAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKD----------SDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPN----------GFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            F+V  F  + M R L++L V I+                I +++ TSHLES  +++  R  QLK A+  M+ +              IF GDLNLRDKE+ Q+G LPP + DVWE  G R E + TWDP+RN N + + P            +G RFDRMY     P     +KPV F L GL+++     FPSDHWAI+G F +
Sbjct:  185 FRVTPFPGSVMQRILLTLDVVIHPHVLLSTNKNAVLCPPIRVRVWTSHLESCANFAKERKNQLKQAWNAMQAEISPNAGNAAAPTCGIFCGDLNLRDKEIHQLGGLPPGMVDVWETCGARPEAKATWDPRRNPNLSLDNPESSFSATPKRAAYGMRFDRMYLLGGGPG---RLKPVDFELRGLERVPGRSHFPSDHWAILGHFDI 386          

HSP 2 Score: 83.5741 bits (205), Expect = 2.993e-47
Identity = 61/181 (33.70%), Postives = 91/181 (50.28%), Query Frame = 3
Query:   30 ESDNDLPKEVYQKRI-DDFVESTNTDVALAMYYLGENKYNLKVALEKFELDDHI----LINGFNVPCSQIRTNN--------------LKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTAND--LGHYYCGILVRKHPDIQTRKDSFKV 509
            E  +DLP      R+   F+E T TD ALAM +L  N ++L+V L +F L  H+         + P   + ++N                 FR+LSWN++GL  K  + RT SV+  I   K ++V LQE+V E+   ++KQL   ++IF   D  L  Y+  I V KHP +    +SF+V
Sbjct:    7 EGVHDLPSADECMRLCATFIEFTETDKALAMLFLQNNSWDLEVILRRFCLKPHVERRDPEQMSSEPVIDLTSDNEDVAEDEMSVDQQHAHLFRLLSWNIDGLSTKSREFRTPSVVSLIKREKFHVVGLQEVVRESLANLKKQLDGLYDIFHPEDIELRDYFPVICVLKHPGLTVVVNSFRV 187          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. TrEMBL
Match: A0A0X3PLD9 (Tyrosyl-DNA phosphodiesterase 2 OS=Schistocephalus solidus OX=70667 GN=TYDP2 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 6.569e-47
Identity = 77/203 (37.93%), Postives = 108/203 (53.20%), Query Frame = 1
Query:  556 FQVEKFDNTTMDRHLVSLVVEIN----------------EIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK----------DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNG---------FGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFF 1059
            F+V  F  + M R L+SL +  +                 I ++L TSHLES  +++  RM QLK +++EM            +  + IF GDLN+RDKE+  +G LP  I DVW++ G R E + TWDP+RN N + + PN          +G RFDRMY      AAG  + P+ F L GL+++     FPSDHWAI+G F
Sbjct:  206 FRVVPFHGSVMQRVLLSLDLHFSPTQLLPTNRKASTASASIRVRLWTSHLESCANFADERMCQLKQSWKEMTDSLLTGNSASLEPFYGIFCGDLNIRDKEITHLGGLPAGIVDVWQSAGGRREAKITWDPRRNPNLSLDHPNSGSGSTYRAQYGMRFDRMY------AAGSGLSPIDFELRGLERVPGRTHFPSDHWAILGHF 402          

HSP 2 Score: 78.9518 bits (193), Expect = 6.569e-47
Identity = 54/187 (28.88%), Postives = 84/187 (44.92%), Query Frame = 3
Query:   33 SDNDLPKEVYQKRIDDFVESTNTDVALAMYYLGENKYNLKVAL--------------------------EKFELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGH--YYCGILVRKHPDIQTRKDSFKV 509
             D+  P     K  + F E T TD ALAM YL +  +NL++AL                          E+    ++++      P     T +   FR+LSWN++GL  K    RT++VI+ I     ++V LQE+V    + + + L   +NIF  +D+    Y+  I V KHP +     SF+V
Sbjct:   22 GDSLPPANECMKLCETFAEFTETDKALAMMYLQQTSWNLELALASFYDGTGDQAPTTTKRPEHANQPRPERLLPPNNVIATAVCAPVCTSDTQHAHLFRVLSWNIDGLSDKSCDFRTEAVIKIIQAEMFHVVCLQEVVRATLSMLERDLSVLYNIFYPSDVTRRDYFPVICVLKHPALCVDPASFRV 208          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Cavefish
Match: tdp2a (tyrosyl-DNA phosphodiesterase 2a [Source:ZFIN;Acc:ZDB-GENE-110218-1])

HSP 1 Score: 108.997 bits (271), Expect = 1.946e-30
Identity = 72/183 (39.34%), Postives = 97/183 (53.01%), Query Frame = 1
Query:  562 VEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKK--DSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHVE*IEKLILSMFMF 1104
            +  F  T M R+LV  +   +   + LMTSHLES +  S  R  QL+  ++ MK+  D    IF GD NLRD E+K++G LP  I DVWE  G   +  +TWD     N N++ P     RFDR+Y  + R   G  ++P    L GL+K+K G RF SDHW I+        E LI+S   F
Sbjct:  124 IVNFPTTEMGRNLV--MANFSGHQLCLMTSHLESLKTSSQERCNQLRRVWKRMKEAPDGQTVIFGGDTNLRDWEVKKLGGLPDGITDVWEMMGSPEDCMYTWDTVT--NNNKDIPFPARLRFDRVYMRTAR--EGAQLRPQSMTLVGLKKLKCG-RFISDHWGILYC-----CEDLIISYIRF 294          

HSP 2 Score: 43.1282 bits (100), Expect = 1.946e-30
Identity = 22/74 (29.73%), Postives = 47/74 (63.51%), Query Frame = 3
Query:  252 ILSWNLEGLEAKDLKKRTDSVIETI-NNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            +L+WN++GL+ +DLK+R  +++    +  +A++V LQEL+     +I +++  ++     +D G Y+  IL+R+
Sbjct:   43 VLTWNIDGLDPEDLKQRVPNLLAFWESEHRADVVLLQELIPPY-LKILQEIMTDYEFLPGSDSG-YFTAILLRR 114          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Cavefish
Match: tdp2b (tyrosyl-DNA phosphodiesterase 2 [Source:NCBI gene;Acc:103042690])

HSP 1 Score: 114.39 bits (285), Expect = 4.963e-30
Identity = 64/172 (37.21%), Postives = 93/172 (54.07%), Query Frame = 1
Query:  550 KRFQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSD--FSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFF 1059
            ++ ++  F  T M R+L+   V      + LMTSH ES +D ++ RM QL    +++K+  D    IF GD NLRD E+ ++G LP  + DVWE  GK+   R+TWD K   N+N+N       RFDR+Y  S +      + P    L G++K+  G R+ SDHW I   F
Sbjct:  211 QKSEIISFPTTQMMRNLLCAQVTFMGKEVCLMTSHFESCKDQATERMKQLGMVLQKIKEAPDNMTVIFGGDTNLRDSEVAKVGGLPAGVIDVWEDLGKQEHCRYTWDTK--MNSNKNVSYVSRCRFDRIYVRSSKTEP--RVSPEHMALVGMEKLDCG-RYTSDHWGIYCTF 377          

HSP 2 Score: 36.5798 bits (83), Expect = 4.963e-30
Identity = 19/76 (25.00%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  243 EFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            +  ++SWN++GL+   L +R   +   +     ++VFLQEL+ +    ++K+    +     N+ G Y+ G++++K
Sbjct:  132 KLSLISWNVDGLDTLGLAERARGLCSYLALYTPDVVFLQELIPQYAQYVKKR-AVSYLFIEGNEEG-YFTGLMLKK 205          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Sea Lamprey
Match: tdp2a (tyrosyl-DNA phosphodiesterase 2a [Source:ZFIN;Acc:ZDB-GENE-110218-1])

HSP 1 Score: 95.5153 bits (236), Expect = 7.245e-23
Identity = 64/181 (35.36%), Postives = 93/181 (51.38%), Query Frame = 1
Query:  559 QVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFS--IFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRP----------AAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            ++  F  +TM RHL+++  E++   + L+TSHLES    S  R+ QL+   R M      +  IF GD NLRDKE++++G LP  + DVWE  G   E R+TWD   N N   + P     RFDR+ F    P          AA     P+     G +++  G +FPSDHW ++  F +
Sbjct:   94 EIFPFPTSTMMRHLLAVKAEVSGRELYLLTSHLESMGPKSEERVRQLRRVLRRMALAPAHAAVIFGGDTNLRDKEVRRMGGLPGGVADVWEELGCPEEARYTWDLSLNDNHQFDPPATPRLRFDRLLFRRVEPRRSSSPAAGSAAVAAFAPLSLRFVGTERLPCG-KFPSDHWGLLAHFQL 273          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Nematostella
Match: EDO38578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCH2])

HSP 1 Score: 92.8189 bits (229), Expect = 7.801e-23
Identity = 62/146 (42.47%), Postives = 82/146 (56.16%), Query Frame = 1
Query:  643 MTSHLESTRDYSSLRMAQLKSAFREMKKDSDFS--IFAGDLNLRDKELKQIGDLPP-DICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQ--RFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            MTSHLEST+D    R  QL+    +MK+    S  +FAGD+NLRDKEL  IG L    I DVWE  G     +FTWD   + N N + P+ +    RFDR++    RP  G  ++PV F L G +++    RFP+DHW I   F +
Sbjct:    1 MTSHLESTKDCFRERQRQLEMVLEKMKEQDPNSMVLFAGDMNLRDKELNGIGGLDSRGILDVWEKVGNDAS-KFTWDV--SANDNLDWPHSYKPKLRFDRVFV---RPGGG--VEPVSFSLVGTKRVPSCGRFPNDHWGIWCEFAI 138          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Nematostella
Match: EDO38577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCH1])

HSP 1 Score: 49.6766 bits (117), Expect = 1.544e-7
Identity = 20/45 (44.44%), Postives = 35/45 (77.78%), Query Frame = 3
Query:  237 LKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVE 371
            L+  + L+WN++GL+ K+L+ RT +VI+ I + K +IV+LQE++E
Sbjct:   89 LRNLKFLTWNVDGLDQKNLRPRTQAVIDLIKSHKPDIVYLQEVIE 133          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Medaka
Match: tdp2b (tyrosyl-DNA phosphodiesterase 2 [Source:NCBI gene;Acc:101166643])

HSP 1 Score: 110.923 bits (276), Expect = 9.991e-34
Identity = 67/174 (38.51%), Postives = 94/174 (54.02%), Query Frame = 1
Query:  559 QVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSD--FSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIK---PVFFGLEGLQKIKLGIRFPSDHWAIMGFFHV 1065
            ++  +  T M R+L+   V      + LMTSHLES + ++  RM QL+   + +K   D    +F GD NLRD E+ ++G LP  +CDVWE  GK+   R+TWD K   N+N+  P     RFDR+Y    RPA  + +    P    L GL+K+  G R+ SDHW I   F V
Sbjct:  192 EIVTYPTTQMMRNLLVAQVIFKGHKLCLMTSHLESCKGHAEERMKQLRMVMQRVKDAPDDVTVLFGGDTNLRDTEVVKVG-LPSGVCDVWEKLGKQEHCRYTWDTKA--NSNKTVPFVSRCRFDRIYL---RPATKEGVPQLCPDHMALVGLEKLDCG-RYTSDHWGIYCSFTV 358          

HSP 2 Score: 52.373 bits (124), Expect = 9.991e-34
Identity = 47/182 (25.82%), Postives = 84/182 (46.15%), Query Frame = 3
Query:   21 SDNESDNDLPKEVYQKRI-DDFVESTNTDVALAMYYLGENKYNLKVAL-------------EKFELD----------------DHILINGFNVPCSQIRT--NNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            SD + D D+  E  + R+ D+F   T TD A+A  YL EN + ++ AL             E FE D                D I + G + P +  ++  ++ K+  ++SWN++GL+  +L +R   +   +     ++VFLQEL+      ++K+      I    +   Y+ G+++RK
Sbjct:    7 SDKQPDTDV--ETQRTRLCDEFATITGTDSAVAQCYLAENDWEMQRALNSFFEADMERVFAEDFEDDSNPTPKKQKTEEQPSADCIDLTG-DSPATSCKSAEDDEKKLSLISWNVDGLDTDNLGERARGLCSYLVLYTPDVVFLQELIPPYVQYLKKRAVSYLVIEGGEEA--YFTGMMLRK 183          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Medaka
Match: ENSORLT00000002062.2 (tyrosyl-DNA phosphodiesterase 2 [Source:NCBI gene;Acc:101169669])

HSP 1 Score: 98.2117 bits (243), Expect = 3.728e-26
Identity = 61/168 (36.31%), Postives = 85/168 (50.60%), Query Frame = 1
Query:  571 FDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMK-KDSDFSI-FAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHVE 1068
            F  + M R+L+   V      + LMTSH ES +D S  RM Q  +  + M     DF++ F GD NLRD E+  + ++P  ICD+WE  G+  + R+TWD   N N      N    RFDR+Y           ++P    L GL+++K G R+ SDHW I   F  E
Sbjct:  110 FRYSRMMRNLLIAQVMFRGQKVCLMTSHFESCKDNSGERMRQFNAVIKRMSMAPDDFTVLFGGDTNLRDYEVATV-EIPVSICDLWEQLGEPEKCRYTWDTWANTNKEMRFKNRL--RFDRVYLRRAVKDGVPRMEPHSMALVGLERLKCG-RYTSDHWGIYCTFSFE 273          

HSP 2 Score: 39.2762 bits (90), Expect = 3.728e-26
Identity = 18/73 (24.66%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  252 ILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            +L+WN++GL+ ++  +R   +   I     ++V LQE+V+     + K+L   +      ++G Y+  +L++K
Sbjct:   26 LLTWNIDGLDGEEQPQRARGLCSYILEYSPDVVLLQEMVQPYIRFMHKRLATNYTFIEGGEIG-YFTTMLLKK 97          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Medaka
Match: ENSORLT00000042966.1 (tyrosyl-DNA phosphodiesterase 2 [Source:NCBI gene;Acc:101169669])

HSP 1 Score: 74.7146 bits (182), Expect = 3.400e-19
Identity = 53/170 (31.18%), Postives = 75/170 (44.12%), Query Frame = 1
Query:  559 QVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHVE 1068
            ++  F  + M R+L+   V      + LMTSH ES +D S  RM Q  +  + M   + F I A  +                ICD+WE  G+  + R+TWD   N N      N    RFDR+Y           ++P    L GL+++K G R+ SDHW I   F  E
Sbjct:  176 KILPFRYSRMMRNLLIAQVMFRGQKVCLMTSHFESCKDNSGERMRQFNAVIKRM---TVFGISATSV----------------ICDLWEQLGEPEKCRYTWDTWANTNKEMRFKNRL--RFDRVYLRRAVKDGVPRMEPHSMALVGLERLKCG-RYTSDHWGIYCTFSFE 323          

HSP 2 Score: 39.6614 bits (91), Expect = 3.400e-19
Identity = 18/73 (24.66%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  252 ILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRK 470
            +L+WN++GL+ ++  +R   +   I     ++V LQE+V+     + K+L   +      ++G Y+  +L++K
Sbjct:   96 LLTWNIDGLDGEEQPQRARGLCSYILEYSPDVVLLQEMVQPYIRFMHKRLATNYTFIEGGEIG-YFTTMLLKK 167          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Planmine SMEST
Match: SMESG000024529.1 (SMESG000024529.1)

HSP 1 Score: 361.303 bits (926), Expect = 0.000e+0
Identity = 170/171 (99.42%), Postives = 171/171 (100.00%), Query Frame = 1
Query:  556 FQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHVE 1068
            F+VEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHVE
Sbjct:  162 FKVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSDHWAIMGFFHVE 332          

HSP 2 Score: 337.035 bits (863), Expect = 0.000e+0
Identity = 164/164 (100.00%), Postives = 164/164 (100.00%), Query Frame = 3
Query:   18 MSDNESDNDLPKEVYQKRIDDFVESTNTDVALAMYYLGENKYNLKVALEKFELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRKHPDIQTRKDSFKV 509
            MSDNESDNDLPKEVYQKRIDDFVESTNTDVALAMYYLGENKYNLKVALEKFELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRKHPDIQTRKDSFKV
Sbjct:    1 MSDNESDNDLPKEVYQKRIDDFVESTNTDVALAMYYLGENKYNLKVALEKFELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRKHPDIQTRKDSFKV 164          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Planmine SMEST
Match: SMESG000036869.1 (SMESG000036869.1)

HSP 1 Score: 122.094 bits (305), Expect = 1.399e-40
Identity = 70/149 (46.98%), Postives = 92/149 (61.74%), Query Frame = 1
Query:  556 FQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQ 1002
             +V KF+ + M R L+S+ V +  + IKLMTSHLES ++YS  R  QL +AF EM  D++FSIFAGD+N+R+ EL+QI   P  I DV E   K      TW+PK N N +Q+     G RFDRMYFYS   +    +KPV F + G Q
Sbjct:  132 LKVIKFEGSQMGRSLLSVTVNVIGLDIKLMTSHLESMKNYSDERKVQLCTAFNEMNNDAEFSIFAGDMNVRNFELQQIHCPPNGIVDVSEYLFKDSNQIPTWEPKENRNISQSLSMIPGMRFDRMYFYS---SVSDTLKPVGFQVLGKQ 277          

HSP 2 Score: 63.5438 bits (153), Expect = 1.399e-40
Identity = 39/123 (31.71%), Postives = 66/123 (53.66%), Query Frame = 3
Query:  123 YLGENKYNLKVALEKFELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGH--YYCGILVRKHPDIQ 485
            YL  +  NL+V+++ F   D      FN    Q +    K F++LSWN++GL+   +  R ++++  I   + + +F QE++   ET  +  LG ++  F   D GH  YYCGIL++K   I+
Sbjct:   17 YLFTHDLNLQVSIDNFFESD------FNHYEPQPK----KSFKVLSWNIDGLDEHLIDIRINAILTMIKENQPDFIFFQEIIPYMETIFQMTLGSQYEFFI--DSGHDPYYCGILIKKSDQIK 127          
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Planmine SMEST
Match: SMESG000036869.1 (SMESG000036869.1)

HSP 1 Score: 122.094 bits (305), Expect = 1.507e-40
Identity = 70/149 (46.98%), Postives = 92/149 (61.74%), Query Frame = 1
Query:  556 FQVEKFDNTTMDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSDFSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNANQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQ 1002
             +V KF+ + M R L+S+ V +  + IKLMTSHLES ++YS  R  QL +AF EM  D++FSIFAGD+N+R+ EL+QI   P  I DV E   K      TW+PK N N +Q+     G RFDRMYFYS   +    +KPV F + G Q
Sbjct:  135 LKVIKFEGSQMGRSLLSVTVNVIGLDIKLMTSHLESMKNYSDERKVQLCTAFNEMNNDAEFSIFAGDMNVRNFELQQIHCPPNGIVDVSEYLFKDSNQIPTWEPKENRNISQSLSMIPGMRFDRMYFYS---SVSDTLKPVGFQVLGKQ 280          

HSP 2 Score: 63.5438 bits (153), Expect = 1.507e-40
Identity = 36/121 (29.75%), Postives = 64/121 (52.89%), Query Frame = 3
Query:  123 YLGENKYNLKVALEKFELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKRTDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYCGILVRKHPDIQ 485
            YL  +  NL+V+++ F   D      FN    Q +    K F++LSWN++GL+   +  R ++++  I   + + +F QE++   ET  +  LG ++  F  +    YYCGIL++K   I+
Sbjct:   20 YLFTHDLNLQVSIDNFFESD------FNHYEPQPK----KSFKVLSWNIDGLDEHLIDIRINAILTMIKENQPDFIFFQEIIPYMETIFQMTLGSQYEFFIDSGHDPYYCGILIKKSDQIK 130          
The following BLAST results are available for this feature:
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TDP21.085e-3340.83tyrosyl-DNA phosphodiesterase 2 [Source:HGNC Symbo... [more]
TDP21.287e-3340.83tyrosyl-DNA phosphodiesterase 2 [Source:HGNC Symbo... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tdpt-19.698e-3137.225'-tyrosyl-DNA phosphodiesterase [Source:UniProtK... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tdp2a8.696e-3338.73tyrosyl-DNA phosphodiesterase 2a [Source:ZFIN;Acc:... [more]
tdp2b1.045e-3238.92tyrosyl-DNA phosphodiesterase 2b [Source:NCBI gene... [more]
tdp2b1.371e-3139.88tyrosyl-DNA phosphodiesterase 2b [Source:NCBI gene... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hpdl3.636e-3239.184-hydroxyphenylpyruvate dioxygenase like [Source:X... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tdp28.167e-3540.23tyrosyl-DNA phosphodiesterase 2 [Source:MGI Symbol... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3T1H5|TYDP2_RAT2.626e-3640.94Tyrosyl-DNA phosphodiesterase 2 OS=Rattus norvegic... [more]
sp|F1NW29|TYDP2_CHICK1.712e-3544.19Tyrosyl-DNA phosphodiesterase 2 OS=Gallus gallus O... [more]
sp|Q9JJX7|TYDP2_MOUSE4.895e-3440.23Tyrosyl-DNA phosphodiesterase 2 OS=Mus musculus OX... [more]
sp|A7YWI9|TYDP2_BOVIN1.004e-3341.48Tyrosyl-DNA phosphodiesterase 2 OS=Bos taurus OX=9... [more]
sp|O95551|TYDP2_HUMAN5.592e-3340.83Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7T4X81.886e-5147.24Endo/exonuclease/phosphatase domain-containing pro... [more]
A0A4E0R9D61.806e-5042.29Traf and tnf receptor associated protein OS=Fascio... [more]
A0A504ZBR02.150e-5042.29Traf and tnf receptor associated protein OS=Fascio... [more]
A0A0R3UF732.993e-4738.05Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PLD96.569e-4737.93Tyrosyl-DNA phosphodiesterase 2 OS=Schistocephalus... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tdp2a1.946e-3039.34tyrosyl-DNA phosphodiesterase 2a [Source:ZFIN;Acc:... [more]
tdp2b4.963e-3037.21tyrosyl-DNA phosphodiesterase 2 [Source:NCBI gene;... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tdp2a7.245e-2335.36tyrosyl-DNA phosphodiesterase 2a [Source:ZFIN;Acc:... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO385787.801e-2342.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385771.544e-744.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tdp2b9.991e-3438.51tyrosyl-DNA phosphodiesterase 2 [Source:NCBI gene;... [more]
ENSORLT00000002062.23.728e-2636.31tyrosyl-DNA phosphodiesterase 2 [Source:NCBI gene;... [more]
ENSORLT00000042966.13.400e-1931.18tyrosyl-DNA phosphodiesterase 2 [Source:NCBI gene;... [more]
back to top
BLAST of 5'-tyrosyl-DNA phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000024529.10.000e+099.42SMESG000024529.1[more]
SMESG000036869.11.399e-4046.98SMESG000036869.1[more]
SMESG000036869.11.507e-4046.98SMESG000036869.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022404 ID=SMED30022404|Name=5'-tyrosyl-DNA phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=1131bp
TATATAAATCTTATATGATGTCAGATAACGAAAGTGATAATGATTTACCA
AAAGAAGTCTACCAAAAACGTATTGATGATTTTGTTGAGTCAACTAATAC
CGATGTAGCTTTAGCAATGTATTACTTGGGTGAAAACAAATACAATTTAA
AAGTGGCACTTGAAAAGTTTGAGCTTGATGATCATATTCTTATTAACGGA
TTCAATGTTCCATGTTCTCAAATAAGGACAAACAATTTGAAGGAATTTCG
AATTTTATCTTGGAACCTTGAAGGTTTAGAAGCCAAAGATTTAAAAAAAC
GAACTGATTCAGTAATAGAAACTATTAATAACTGCAAAGCCAACATCGTT
TTCCTGCAAGAATTAGTCGAAGAAAATGAAACGGAAATTCGTAAACAACT
GGGAAAGGAGTTTAATATATTCACTGCGAATGATTTGGGCCACTATTACT
GTGGAATTCTCGTTAGAAAGCATCCAGATATTCAGACTCGAAAGGATTCA
TTTAAAGTAGCTTTGAAATAATAATTCCGAAGCGTTTGACAATAATTGTA
AACGATTTCAGGTGGAGAAATTCGACAACACAACAATGGATCGCCATCTC
GTGAGTTTGGTTGTGGAAATCAATGAAATCGCCATCAAATTGATGACGTC
ACATCTCGAGAGCACGAGAGATTATTCCAGTTTGAGAATGGCTCAGTTGA
AATCGGCTTTCAGAGAAATGAAAAAAGATTCAGATTTCTCGATATTTGCC
GGAGATTTGAATTTGCGAGATAAAGAACTCAAACAAATCGGTGATTTGCC
CCCGGATATTTGTGACGTGTGGGAAGCTACTGGCAAGCGATATGAAGTCA
GATTTACTTGGGATCCCAAGCGGAATTTCAATGCCAACCAAAATTGTCCA
AATGGCTTCGGTCAAAGATTTGATCGAATGTATTTCTATTCTAAAAGACC
TGCTGCAGGAAAGAATATAAAACCCGTATTTTTCGGATTGGAAGGCCTTC
AAAAAATTAAGCTTGGAATCCGATTTCCCAGCGATCACTGGGCTATCATG
GGATTTTTTCATGTAGAATAAATTGAAAAACTGATACTTTCTATGTTTAT
GTTTCTATAATAAACTTGCTGCCGAAAAAAA
back to top

protein sequence of SMED30022404-orf-1

>SMED30022404-orf-1 ID=SMED30022404-orf-1|Name=SMED30022404-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MDRHLVSLVVEINEIAIKLMTSHLESTRDYSSLRMAQLKSAFREMKKDSD
FSIFAGDLNLRDKELKQIGDLPPDICDVWEATGKRYEVRFTWDPKRNFNA
NQNCPNGFGQRFDRMYFYSKRPAAGKNIKPVFFGLEGLQKIKLGIRFPSD
HWAIMGFFHVE*
back to top

protein sequence of SMED30022404-orf-2

>SMED30022404-orf-2 ID=SMED30022404-orf-2|Name=SMED30022404-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=173bp
YKSYMMSDNESDNDLPKEVYQKRIDDFVESTNTDVALAMYYLGENKYNLK
VALEKFELDDHILINGFNVPCSQIRTNNLKEFRILSWNLEGLEAKDLKKR
TDSVIETINNCKANIVFLQELVEENETEIRKQLGKEFNIFTANDLGHYYC
GILVRKHPDIQTRKDSFKVALK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036691Endo/exonu/phosph_ase_sf
IPR005135Endo/exonuclease/phosphatase
Vocabulary: molecular function
TermDefinition
GO:0000287magnesium ion binding
GO:0003697single-stranded DNA binding
GO:0004518nuclease activity
GO:0016787hydrolase activity
GO:0030145manganese ion binding
GO:0046872metal ion binding
GO:00702605'-tyrosyl-DNA phosphodiesterase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016605PML body
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006302double-strand break repair
GO:0006974cellular response to DNA damage stimulus
GO:0007275multicellular organism development
GO:0090305nucleic acid phosphodiester bond hydrolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 103..123
NoneNo IPR availableGENE3DG3DSA:1.10.8.10coord: 11..55
e-value: 2.5E-5
score: 25.7
IPR036691Endonuclease/exonuclease/phosphatase superfamilyGENE3DG3DSA:3.60.10.10coord: 69..165
e-value: 1.6E-15
score: 59.6
IPR036691Endonuclease/exonuclease/phosphatase superfamilySUPERFAMILYSSF56219DNase I-likecoord: 63..153