Tctex1 domain containing 4

Overview
NameTctex1 domain containing 4
Smed IDSMED30022401
Length (bp)687
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tctex1 domain containing 4 (SMED30022401) t-SNE clustered cells

Violin plots show distribution of expression levels for Tctex1 domain containing 4 (SMED30022401) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tctex1 domain containing 4 (SMED30022401) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tctex1 domain containing 4 (SMED30022401) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022401

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022401 SmedASXL_007731SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022401 dd_Smed_v6_12765_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30022401 OX_Smed_1.0.08037ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022401 dd_Smed_v4_12765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022401 dd_Smed_v4_12765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tctex1 domain containing 4 vs. Ensembl Human
Match: TCTEX1D1 (Tctex1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26882])

HSP 1 Score: 72.7886 bits (177), Expect = 2.227e-15
Identity = 46/132 (34.85%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  265 RPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R  +Q ENTY++   K    +F       I+KD++ S L   +YEP     +T+ ++ +IK ++K+L   RYK I  + IGQ       +  SI+I S+ L  P S D+F  + + NSSLFA+A ++ +Y E
Sbjct:   59 RLTVQMENTYQLGPPK----HFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQL------NRQSILIGSRCLWDPKS-DTFSSYVFRNSSLFALANVYAVYLE 179          
BLAST of Tctex1 domain containing 4 vs. Ensembl Human
Match: TCTEX1D4 (Tctex1 domain containing 4 [Source:HGNC Symbol;Acc:HGNC:32315])

HSP 1 Score: 56.225 bits (134), Expect = 4.466e-9
Identity = 27/84 (32.14%), Postives = 43/84 (51.19%), Query Frame = 1
Query:  409 AAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            AA L + +   +  RL+EL   RYK +C + +G +      +   + + S+ L    + D      Y N+SLFAVA +HG+Y E
Sbjct:  145 AARLVRELCEQVHVRLRELSPPRYKLVCSVVLGPR------AGQGVHVVSRALWD-VARDGLASVSYTNTSLFAVATVHGLYCE 221          
BLAST of Tctex1 domain containing 4 vs. Ensembl Human
Match: TCTEX1D2 (Tctex1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28482])

HSP 1 Score: 51.6026 bits (122), Expect = 6.658e-8
Identity = 30/109 (27.52%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  328 FKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIY 654
            F+P+  +  +  +L   L   +Y P     LT++++  IK++LKE+  +RYK + Q+ IG+++ G G     + +AS+      + D++    + N SLF V    G +
Sbjct:   39 FRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQR-GEG-----VFMASRCFWDADT-DNYTHDVFMNDSLFCVVAAFGCF 140          
BLAST of Tctex1 domain containing 4 vs. Ensembl Human
Match: TCTEX1D2 (Tctex1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28482])

HSP 1 Score: 46.9802 bits (110), Expect = 2.383e-6
Identity = 28/90 (31.11%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  328 FKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGN--SNHSIIIASQMLSQPTSGDS 591
            F+P+  +  +  +L   L   +Y P     LT++++  IK++LKE+  +RYK + Q+ IG+++ G G       +I A   L  P S DS
Sbjct:   39 FRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQR-GEGVLLECSGMISAHCNLCLPGSSDS 127          
BLAST of Tctex1 domain containing 4 vs. Ensembl Human
Match: AC069257.4 (novel protein)

HSP 1 Score: 45.8246 bits (107), Expect = 4.478e-6
Identity = 22/67 (32.84%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  328 FKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNG 528
            F+P+  +  +  +L   L   +Y P     LT++++  IK++LKE+  +RYK + Q+ IG+ Q G G
Sbjct:   39 FRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGE-QRGEG 104          
BLAST of Tctex1 domain containing 4 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 65.855 bits (159), Expect = 4.827e-13
Identity = 43/133 (32.33%), Postives = 73/133 (54.89%), Query Frame = 1
Query:  262 RRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            +RP +Q ENTY+I   ++    F     + ++KD+L S L   +YE      +T+ +T ++K R+K+L   RYK I  + IGQ +      + +I + S+ L    + D+F    ++N+SLFA A + G+Y E
Sbjct:   52 QRPTVQMENTYRITPSRR----FPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIK------DQNIRMGSRCLWDD-NHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 4 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 65.855 bits (159), Expect = 4.827e-13
Identity = 43/133 (32.33%), Postives = 73/133 (54.89%), Query Frame = 1
Query:  262 RRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            +RP +Q ENTY+I   ++    F     + ++KD+L S L   +YE      +T+ +T ++K R+K+L   RYK I  + IGQ +      + +I + S+ L    + D+F    ++N+SLFA A + G+Y E
Sbjct:   52 QRPTVQMENTYRITPSRR----FPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIK------DQNIRMGSRCLWDD-NHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 4 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 56.9954 bits (136), Expect = 6.055e-10
Identity = 38/123 (30.89%), Postives = 67/123 (54.47%), Query Frame = 1
Query:  286 NTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIY 654
            NTY I  + K    FK   A+  + +IL   L   QY+P     L++++ + IK++LK++  +RYK+I Q+ IG+++ G G     + +A++      + D++ +  Y N SLF VA    +Y
Sbjct:   35 NTYLIRPNYKDK--FKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQR-GEG-----VKMAARCFWDADT-DNYAQEIYMNDSLFCVAAAFAVY 148          
BLAST of Tctex1 domain containing 4 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 46.9802 bits (110), Expect = 2.457e-6
Identity = 28/81 (34.57%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  286 NTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNG 528
            NTY I  + K    FK   A+  + +IL   L   QY+P     L++++ + IK++LK++  +RYK+I Q+ IG+++ G G
Sbjct:   35 NTYLIRPNYKDK--FKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQR-GEG 112          
BLAST of Tctex1 domain containing 4 vs. Ensembl Xenopus
Match: coq10b (coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252])

HSP 1 Score: 73.9442 bits (180), Expect = 6.410e-16
Identity = 45/133 (33.83%), Postives = 75/133 (56.39%), Query Frame = 1
Query:  262 RRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            +RP I  ENTY+    K+    F       I+KD+L S L   +YE      +T+ ++ +IK R+K+L   RYK I  ++IGQ       ++ S+ + S+ +  P + D+F  + ++NSSLFA+A ++G+Y E
Sbjct:   56 QRPAILMENTYQTGPTKR----FPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQL------NDQSMRVGSRCIWDP-ANDTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of Tctex1 domain containing 4 vs. Ensembl Xenopus
Match: ENSXETT00000044463.1 (tctex1 domain-containing protein 1-like [Source:NCBI gene;Acc:100498184])

HSP 1 Score: 57.7658 bits (138), Expect = 1.061e-9
Identity = 31/103 (30.10%), Postives = 53/103 (51.46%), Query Frame = 1
Query:  352 IMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            ++++ L + L    Y+P + A LT+++   IK  ++ +   RYK IC + IG K          I++ SQ L    S D+     Y+N +LF V L++ +Y E
Sbjct:  127 LIEEFLATKLKNESYDPSTCAALTKDLCEDIKKIVRRVTPPRYKLICSMAIGSK------DREDIMVTSQCLWDSYS-DNVTSCSYQNRTLFCVVLVYAVYFE 222          
BLAST of Tctex1 domain containing 4 vs. Ensembl Xenopus
Match: txnrd2 (thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GENE-5767949])

HSP 1 Score: 57.3806 bits (137), Expect = 1.222e-9
Identity = 34/106 (32.08%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  355 MKDILHS----NLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            MK +L S     L    Y P SA  L + ++  +K R+K +   RYK +C + +G++          I + S+ L   +  DS+V   YENSSLF V  ++ +Y E
Sbjct:   99 MKQVLESYLPERLGTITYNPASAPSLVKEVSEEVKGRVKRVLPTRYKALCVVTLGER------GQEDIAVVSRCLWD-SHSDSYVAHVYENSSLFCVVAVYAVYCE 197          
BLAST of Tctex1 domain containing 4 vs. Ensembl Xenopus
Match: ENSXETT00000022071.1 (lysophosphatidic acid receptor 6-like [Source:Xenbase;Acc:XB-GENE-5721642])

HSP 1 Score: 51.2174 bits (121), Expect = 6.964e-8
Identity = 35/124 (28.23%), Postives = 62/124 (50.00%), Query Frame = 1
Query:  283 ENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIY 654
            ENTY I  + +    FK    +  ++ +L   L   QY P     LT+ ++  IK+RLK++  +RYK + Q+ IG+++ G G     + +A++      + D++ E  + N  LF V    G +
Sbjct:    8 ENTYSIRPNFQHK--FKSAPVKDCIRSVLKEELSDKQYVPEEVPQLTRFLSETIKDRLKDMGFDRYKMVVQVVIGEQR-GEG-----VKMAARCFWDADT-DNYAEDVFMNEYLFCVVAAFGCF 122          
BLAST of Tctex1 domain containing 4 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 69.707 bits (169), Expect = 5.820e-15
Identity = 41/126 (32.54%), Postives = 70/126 (55.56%), Query Frame = 1
Query:  283 ENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            ENTY++   K     F       I++D+L + L   QY+P     +T+ ++ +IK ++KEL   RYK I  ++IGQ+       + SI+I S+ L  P S D+   + ++NS+ FA+A ++ +Y E
Sbjct:    2 ENTYQLGPTKP----FPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQR------DDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 116          
BLAST of Tctex1 domain containing 4 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 69.707 bits (169), Expect = 5.820e-15
Identity = 41/126 (32.54%), Postives = 70/126 (55.56%), Query Frame = 1
Query:  283 ENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            ENTY++   K     F       I++D+L + L   QY+P     +T+ ++ +IK ++KEL   RYK I  ++IGQ+       + SI+I S+ L  P S D+   + ++NS+ FA+A ++ +Y E
Sbjct:    2 ENTYQLGPTKP----FPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQR------DDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 116          
BLAST of Tctex1 domain containing 4 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 71.2478 bits (173), Expect = 5.914e-15
Identity = 42/132 (31.82%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  265 RPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R  ++ ENTY++   K     F       I++D+L + L   QY+P     +T+ ++ +IK ++KEL   RYK I  ++IGQ+       + SI+I S+ L  P S D+   + ++NS+ FA+A ++ +Y E
Sbjct:   57 RLTVRMENTYQLGPTKP----FPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQR------DDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 177          
BLAST of Tctex1 domain containing 4 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 71.2478 bits (173), Expect = 6.115e-15
Identity = 42/132 (31.82%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  265 RPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R  ++ ENTY++   K     F       I++D+L + L   QY+P     +T+ ++ +IK ++KEL   RYK I  ++IGQ+       + SI+I S+ L  P S D+   + ++NS+ FA+A ++ +Y E
Sbjct:   53 RLTVRMENTYQLGPTKP----FPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQR------DDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 4 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 71.2478 bits (173), Expect = 6.115e-15
Identity = 42/132 (31.82%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  265 RPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R  ++ ENTY++   K     F       I++D+L + L   QY+P     +T+ ++ +IK ++KEL   RYK I  ++IGQ+       + SI+I S+ L  P S D+   + ++NS+ FA+A ++ +Y E
Sbjct:   53 RLTVRMENTYQLGPTKP----FPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQR------DDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 4 vs. UniProt/SwissProt
Match: sp|A2VDD2|TC1DB_XENLA (Tctex1 domain-containing protein 1-B (Fragment) OS=Xenopus laevis OX=8355 GN=tctex1d1-b PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.386e-15
Identity = 44/133 (33.08%), Postives = 75/133 (56.39%), Query Frame = 1
Query:  262 RRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            +RP I  ENTY++   K+    F       I+KD+L S L   +YE      +T+ ++ +IK R+K+L   RYK I  ++IGQ       ++  + + S+ +  P + D+F  + ++NSSLFA+A ++G+Y E
Sbjct:   55 QRPAILVENTYQMGPTKR----FPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQL------NDQGMRVGSRCIWDP-ANDTFSSYSFKNSSLFALANVYGVYYE 176          
BLAST of Tctex1 domain containing 4 vs. UniProt/SwissProt
Match: sp|Q3B8D7|TC1DA_XENLA (Tctex1 domain-containing protein 1-A OS=Xenopus laevis OX=8355 GN=tctex1d1-a PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 7.154e-15
Identity = 45/131 (34.35%), Postives = 74/131 (56.49%), Query Frame = 1
Query:  268 PIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            P I  ENTY+I   K+    F       I+KD+L S L   +YE      +T+ ++ +IK R+K+L   RYK I  ++IGQ       ++ S+ + S+ +  P + D+F  + ++NSSLFA+A ++G+Y E
Sbjct:   58 PAILMENTYQIGPAKR----FPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQL------NDQSMRVGSRCIWDP-ANDTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of Tctex1 domain containing 4 vs. UniProt/SwissProt
Match: sp|Q8N7M0|TC1D1_HUMAN (Tctex1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TCTEX1D1 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.069e-14
Identity = 46/132 (34.85%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  265 RPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R  +Q ENTY++   K    +F       I+KD++ S L   +YEP     +T+ ++ +IK ++K+L   RYK I  + IGQ       +  SI+I S+ L  P S D+F  + + NSSLFA+A ++ +Y E
Sbjct:   59 RLTVQMENTYQLGPPK----HFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQL------NRQSILIGSRCLWDPKS-DTFSSYVFRNSSLFALANVYAVYLE 179          
BLAST of Tctex1 domain containing 4 vs. UniProt/SwissProt
Match: sp|Q9D5I4|TC1D1_MOUSE (Tctex1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tctex1d1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.278e-14
Identity = 42/132 (31.82%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  265 RPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R  ++ ENTY++   K     F       I++D+L + L   QY+P     +T+ ++ +IK ++KEL   RYK I  ++IGQ+       + SI+I S+ L  P S D+   + ++NS+ FA+A ++ +Y E
Sbjct:   53 RLTVRMENTYQLGPTKP----FPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQR------DDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 4 vs. UniProt/SwissProt
Match: sp|Q66IC8|TC1D1_DANRE (Tctex1 domain-containing protein 1 OS=Danio rerio OX=7955 GN=tctex1d1 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.644e-12
Identity = 43/133 (32.33%), Postives = 73/133 (54.89%), Query Frame = 1
Query:  262 RRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            +RP +Q ENTY+I   ++    F     + ++KD+L S L   +YE      +T+ +T ++K R+K+L   RYK I  + IGQ +      + +I + S+ L    + D+F    ++N+SLFA A + G+Y E
Sbjct:   52 QRPTVQMENTYRITPSRR----FPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIK------DQNIRMGSRCLWDD-NHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 4 vs. TrEMBL
Match: A0A0Q3RGZ2 (Tctex1 domain-containing protein 4 OS=Amazona aestiva OX=12930 GN=AAES_45136 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.214e-22
Identity = 62/185 (33.51%), Postives = 97/185 (52.43%), Query Frame = 1
Query:  136 RKQSVISTATNATDDLLKRNSRRYGGSRASI--------FSGSGLAMFPGRRPIIQ--YENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R+ S++ST   A            GG R SI         S SGL +F   +PI++   ENTY+I  D+     F   + + +++  L   L+   Y P  +A+L QN+  ++++R KE+   RYK +C + +GQ+      +  S+++ASQ L  P S DSF    + N+SLFAVA +HG+Y E
Sbjct:   51 RRSSILSTLPAALASRRSSLGAAPGGRRPSIGPWMLHSRVSFSGLPLF---QPILKTRLENTYRIGPDEGCK--FNAGRVQRVLEGALTGALETMVYTPQGSALLAQNLAEMLQSRAKEVVPPRYKXVCHVLLGQQ------AQQSLLVASQALWDPKS-DSFASATFSNASLFAVATVHGVYFE 223          
BLAST of Tctex1 domain containing 4 vs. TrEMBL
Match: A0A2I0LPA2 (Tctex1 domain containing 4 OS=Columba livia OX=8932 GN=TCTEX1D4 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.251e-21
Identity = 54/161 (33.54%), Postives = 89/161 (55.28%), Query Frame = 1
Query:  208 GGSRASI--------FSGSGLAMFPGRRPIIQ--YENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            GG R S+         S SGL +F   +PI++   ENTY++  D+     F   + + ++  +L S L    Y P  +A+L Q++  +++ R+KE+   RYK +CQ+ +GQ+         S+++AS+ L  P S D+F    + N+SLFAVA +HG+Y E
Sbjct:   74 GGRRPSVGPWMFHSRVSFSGLPLF---QPILKTRLENTYRMRPDEGCK--FDAGRVQQVLDTVLASTLGTTVYSPQGSALLAQSLAELLRGRVKEVVPPRYKLVCQVLLGQR------GQQSLLVASRALWDPES-DNFASTTFSNASLFAVATVHGVYLE 222          
BLAST of Tctex1 domain containing 4 vs. TrEMBL
Match: A0A2D4JNU5 (Uncharacterized protein OS=Micrurus lemniscatus lemniscatus OX=129467 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.473e-20
Identity = 63/189 (33.33%), Postives = 98/189 (51.85%), Query Frame = 1
Query:  124 IPSIRKQSVISTATNATDDLLKRNSRRYGGSRASI--------FSGSGLAMFPGRRPI--IQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
             P  R+ S++S          +RNS   GG R SI         S SGL +F    PI  + YENTYK   DK  +  F  ++ + +++ +L S     +Y P ++  L QN+++++++R+K+L   RYK +C +F+GQ       +N  + IAS+ L      DSF    + NSSLFAV  +H +Y E
Sbjct:   43 FPPSRRSSIMSILNAPFSS--RRNSLAAGGRRLSIGPWMHCGRVSFSGLPLF---EPIQEVHYENTYKTQPDK--DCRFNSSRTQQVLESVLASFFSDIKYNPANSGQLVQNLSDLVRSRVKDLTPPRYKLVCNVFLGQL------ANQGLHIASRSLWD-VENDSFASATFTNSSLFAVITVHALYYE 217          
BLAST of Tctex1 domain containing 4 vs. TrEMBL
Match: W4XM66 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 4.499e-19
Identity = 49/148 (33.11%), Postives = 87/148 (58.78%), Query Frame = 1
Query:  217 RASIFSGSGLAMFPGRRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R+++ +  G +  PGR P +++E TYK++ D+K    F    A+ I++DIL + L+   Y+P  + VL + + ++IK+R+KEL   RYK I  + I       G++ H+ + A+         DS+ ++ Y+N SL+A  +++GIYQE
Sbjct:   15 RSAMDARGGGSTAPGR-PAVRFECTYKMEPDRK----FMVGAAKQIIEDILTAQLESQSYDPQKSQVLCRELADVIKHRVKELLIPRYKIIALVTI-------GSAEHADVCAASQCVWNDKFDSYAQYTYKNGSLYATGIVYGIYQE 150          
BLAST of Tctex1 domain containing 4 vs. TrEMBL
Match: A0A493TD63 (Tctex1 domain containing 4 OS=Anas platyrhynchos platyrhynchos OX=8840 GN=TCTEX1D4 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.210e-18
Identity = 59/185 (31.89%), Postives = 91/185 (49.19%), Query Frame = 1
Query:  136 RKQSVISTATNATDDLLKRNSRRYGGSRASI--------FSGSGLAMFPGRRPI--IQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            R+ SV+ST                GG R SI         S SGL +F   +PI  I+ ENTY++  D+     F   + + +++ +L   L    Y P   A L  ++  +++ R KE+   RYK +C + +GQ      +   S+++AS+ L  P S DSF    + N+SLFAVA +HG+Y E
Sbjct:  127 RRSSVLSTLPAPLASRRSSLGAAPGGKRPSIGPWMLHSRVSFSGLPLF---QPIPEIRLENTYRMGPDEGCG--FNAGQVQRVLERVLAGVLGGTSYSPQGGASLVHSLAELLRGRAKEVVPPRYKLVCHVLLGQ------HGQQSLLVASRALWDPQS-DSFASATFSNASLFAVATVHGVYFE 299          
BLAST of Tctex1 domain containing 4 vs. Ensembl Cavefish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:103044040])

HSP 1 Score: 70.0922 bits (170), Expect = 1.426e-14
Identity = 45/132 (34.09%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  265 RPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            RP +Q ENTY++   K+    F     + I+KD+L S L   +YE      +T+ ++ ++K R+K++   RYK I  + IGQ     G + H   + S+ L   TS D+F    ++NSSLFA+A ++ +Y E
Sbjct:   57 RPAVQMENTYQLGPKKR----FPVQTVKEILKDVLSSYLLEVKYEAELCRQMTKTISEVVKARVKDMMIPRYKIIVVISIGQL---TGQNMH---VGSRCLWDATS-DTFCSNSFKNSSLFAIANVYAVYFE 177          
BLAST of Tctex1 domain containing 4 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 56.225 bits (134), Expect = 7.895e-10
Identity = 34/109 (31.19%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  328 FKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIY 654
            F+P      +++++   L    Y+   +A   Q ++  I +RLKEL  +RYK + Q+ IG+++ G G     + +AS+      + DS  +  Y N SLF VA + GIY
Sbjct:   42 FRPAVVSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRLKELGLDRYKLVVQVVIGEQR-GEG-----VQMASRCFWDADT-DSCAKDVYMNDSLFCVAAVFGIY 143          
BLAST of Tctex1 domain containing 4 vs. Ensembl Cavefish
Match: ENSAMXT00000038759.1 (tctex1 domain-containing protein 1-A-like [Source:NCBI gene;Acc:103036543])

HSP 1 Score: 55.8398 bits (133), Expect = 2.555e-9
Identity = 37/141 (26.24%), Postives = 68/141 (48.23%), Query Frame = 1
Query:  238 SGLAMFPGRRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            S L ++PG+    +Y+           +  F   +   +MK I+ + L   QY    +AV  + +++ IK   K L   RYK I  + IGQ +      +  +  +S+ +  P + D+F E+ ++N  LFA+ ++  +YQE
Sbjct:   74 SSLTVYPGQSEWQEYQTA--------PHRRFPREQVRSVMKSIVEARLGEAQYTSRCSAV-ARKLSDSIKEAAKSLSYERYKLISYVAIGQLR------DSEVTCSSRGVWCP-AADTFTEYTFKNDHLFALCVLFAVYQE 198          
BLAST of Tctex1 domain containing 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008035.1 (pep scaffold:Pmarinus_7.0:GL476353:419801:420827:1 gene:ENSPMAG00000007269.1 transcript:ENSPMAT00000008035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 9.436e-7
Identity = 30/112 (26.79%), Postives = 52/112 (46.43%), Query Frame = 1
Query:  328 FKPTKAEFIMKDILHSNLDRYQ-YEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            F   + E ++++ L  +L   +  +  + A L   ++  IK R KE    RYK I  + +G  +         +++AS+ L  P + D+F    Y   + F VA I G+Y E
Sbjct:    1 FPVERLERLLEETLTRHLGEGEALDAAACARLAPLLSEEIKARAKEQTPTRYKLIVSVTLGSWE------REQVVVASRCLWDP-AADAFASHHYRRGARFCVATIFGVYYE 105          
BLAST of Tctex1 domain containing 4 vs. Ensembl Nematostella
Match: EDO45441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB6])

HSP 1 Score: 75.0998 bits (183), Expect = 6.075e-17
Identity = 46/134 (34.33%), Postives = 73/134 (54.48%), Query Frame = 1
Query:  259 GRRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            G  P++  ENTY+    KK    F       IMK++L  NL    Y+P++   LT+ ++  +KNR+KEL   RYK IC + IGQ          ++ I S+ L    + D++  ++++N SLF VA ++G+Y E
Sbjct:   57 GMEPVM--ENTYQTTPTKK----FPEGNIRNIMKEVLIENLADVNYDPNTCRQLTKTISETLKNRVKELSVQRYKIICLVHIGQL------GKQAMRIGSRCLWD-ANFDTYTTYEFKNGSLFGVATVYGVYFE 177          
BLAST of Tctex1 domain containing 4 vs. Ensembl Nematostella
Match: EDO33563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRY5])

HSP 1 Score: 69.707 bits (169), Expect = 9.053e-16
Identity = 36/107 (33.64%), Postives = 58/107 (54.21%), Query Frame = 1
Query:  340 KAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            + E ++KDIL  +LD   YEP+   +    +TN +K R+K L   RYKY+C   +G+        N+  + A    +  T  DSF +++Y N SL+ + L++ IY E
Sbjct:    1 RIEPLIKDILEEHLDNQTYEPNFCRLAAIKITNQLKERMKRLRYPRYKYVCHAMLGE-------INNQDVRAVSRCAWDTCVDSFAQYEYRNCSLYGIGLVYAIYFE 100          
BLAST of Tctex1 domain containing 4 vs. Ensembl Nematostella
Match: EDO45313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT02])

HSP 1 Score: 62.3882 bits (150), Expect = 7.447e-13
Identity = 40/126 (31.75%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  283 ENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            +NTY+++   +    F   K + I+++    +L+ + YE      +T  ++ +IK R+K L   RYK IC ++IGQ        N  + I S+ L   T+ D+ VE  Y N +LFAVA + G + E
Sbjct:    1 KNTYRMEPSNR----FSHKKVKDIIEEAFQEHLNEHSYEAEFCKHMTTKLSELIKQRVKHLGFTRYKLICIVYIGQVM------NQGMRIGSRCLWN-TNFDNVVEGSYRNGNLFAVATVFGAFVE 115          
BLAST of Tctex1 domain containing 4 vs. Ensembl Nematostella
Match: EDO44337 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW25])

HSP 1 Score: 62.7734 bits (151), Expect = 1.034e-12
Identity = 38/134 (28.36%), Postives = 75/134 (55.97%), Query Frame = 1
Query:  259 GRRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            G    ++YENTYK++ DK+    F   + + IM++ L  +L   +Y+      ++++++  I  R+K L   ++K +C + IG+       +N  I +AS+ L      D++V+  + ++ LFAVA+++ +YQE
Sbjct:   13 GHHQKVRYENTYKLEPDKR----FNVQEVKEIMEETLEESLKDEKYDAIKCRGMSRSLSQTICERVKLLGFKQFKIVCTVTIGEM------NNQGIRVASRFLWNEKH-DNWVDSVFRSNELFAVAVVYAVYQE 135          
BLAST of Tctex1 domain containing 4 vs. Ensembl Nematostella
Match: EDO46990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU7])

HSP 1 Score: 62.003 bits (149), Expect = 1.197e-12
Identity = 41/125 (32.80%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  286 NTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            NTYK+  D K    F P K E + + +L   L    Y+P +       + + I +++K L  +RYK +C   IG+       ++ +I I S+      + D++ E  Y NS+LFAV  I+GIYQE
Sbjct:    2 NTYKLGPDNK----FSPAKVEEVAQSVLQKVLAESVYDPKTCRTQAMEIGDEILSQVKALGFDRYKIVCLTNIGKV------NDQTIRIGSR-CCWDQNLDNYAEAVYTNSTLFAVTAIYGIYQE 115          
BLAST of Tctex1 domain containing 4 vs. Ensembl Medaka
Match: tctex1d2 (Tctex1 domain containing 2 [Source:NCBI gene;Acc:101160473])

HSP 1 Score: 51.2174 bits (121), Expect = 5.302e-8
Identity = 30/109 (27.52%), Postives = 56/109 (51.38%), Query Frame = 1
Query:  328 FKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIY 654
            FKP   +  + +I+   L   +YEP        ++ + I++++K L  ++YK I Q+ IG+++ G G     + + S+      + D++ E  + N SLF VA + G Y
Sbjct:   40 FKPAIVKEFVHEIVRERLSGVKYEPEKIPETCSSLADCIRDKVKSLGIDKYKIIVQVMIGEQR-GQG-----VKMCSRFFWDADT-DNYAEDVFMNDSLFCVAAVFGCY 141          
BLAST of Tctex1 domain containing 4 vs. Planmine SMEST
Match: SMESG000018052.1 (SMESG000018052.1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.868e-24
Identity = 61/175 (34.86%), Postives = 93/175 (53.14%), Query Frame = 1
Query:  142 QSVISTATNATDDLLKRNSRRYGGSRASIFSGSGLAMFPGRR--PIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            Q+ ++ + +    LLK       G R SI+          R+  P IQYENTY++D D K    F   K + I+ D L   L  Y+Y+P+SA  +T+ +T  IK ++KEL S RYK++  + +G K  G      +I   S+ L    SGD+F E  Y N +++A+A ++GIY E
Sbjct:   11 QTGVAASDSRRASLLKWRRSTLVGPRKSIYMNQPNLWNLDRKIMPQIQYENTYRMDADPKET--FLSHKVKSILTDELKRVLHDYKYDPNSANEMTRILTEKIKFKMKELPSVRYKFVVIVVLGNKNSG------AICYGSRALWNDKSGDTFSEVSYTNDNIYAIATVYGIYYE 177          
BLAST of Tctex1 domain containing 4 vs. Planmine SMEST
Match: SMESG000017994.1 (SMESG000017994.1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.034e-23
Identity = 60/175 (34.29%), Postives = 94/175 (53.71%), Query Frame = 1
Query:  142 QSVISTATNATDDLLKRNSRRYGGSRASIFSGSGLAMFPGRR--PIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            Q+ ++ + +    LLK       G R SI+          R+  P IQYENTY++D + K    F   KA+ I+ D L   L  Y+Y+P++A  +T+ +T  IK ++KEL S RYK++  + +G K  G      +I   S+ L    SGD+F E  Y N +++A+A ++GIY E
Sbjct:   11 QTGVAASDSRRASLLKWRRSTLVGPRKSIYMNQPNLWNLDRKIMPQIQYENTYRMDANPKET--FLSHKAKSILTDELKRVLHNYKYDPNNANEMTRILTEKIKFKMKELPSVRYKFVVIVVLGNKNSG------AICYGSRALWNDKSGDTFSEVSYTNDNIYAIATVYGIYYE 177          
BLAST of Tctex1 domain containing 4 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.603e-23
Identity = 50/135 (37.04%), Postives = 78/135 (57.78%), Query Frame = 1
Query:  256 PGRRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            P  RP ++ ENTY++  D+K    F   K E I KD++ S L   +YEP     +++ ++ +++NR+KEL   RYK +  + +G++       +H     S+ L  P S DSF  ++++N SLFAVA I GIYQE
Sbjct:   52 PASRPTVRVENTYQLGPDQK----FPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQ------GDHGFTTTSRCLWDP-SIDSFACYEFKNGSLFAVATIFGIYQE 175          
BLAST of Tctex1 domain containing 4 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.378e-23
Identity = 50/135 (37.04%), Postives = 78/135 (57.78%), Query Frame = 1
Query:  256 PGRRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            P  RP ++ ENTY++  D+K    F   K E I KD++ S L   +YEP     +++ ++ +++NR+KEL   RYK +  + +G++       +H     S+ L  P S DSF  ++++N SLFAVA I GIYQE
Sbjct:   64 PASRPTVRVENTYQLGPDQK----FPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQ------GDHGFTTTSRCLWDP-SIDSFACYEFKNGSLFAVATIFGIYQE 187          
BLAST of Tctex1 domain containing 4 vs. Planmine SMEST
Match: SMESG000021852.1 (SMESG000021852.1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.483e-14
Identity = 45/153 (29.41%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  214 SRASIFSGSGLAMFPGRRPI----IQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLDRYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNSNHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE 660
            SR SI+S       PG++ +    IQYENTY+I  +       K  +   I++D+L   L   +Y+      L++ + + IK  +++L  NR+K +C + IG K      S  ++ IAS+ L    +GD   +  ++  S+FA+  + G+Y E
Sbjct:   43 SRGSIWSMQN----PGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQ--IIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVLIGDK------SGANVCIASRCLWNSENGDDVAQASFDGGSIFAIGTVFGLYFE 183          
The following BLAST results are available for this feature:
BLAST of Tctex1 domain containing 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCTEX1D12.227e-1534.85Tctex1 domain containing 1 [Source:HGNC Symbol;Acc... [more]
TCTEX1D44.466e-932.14Tctex1 domain containing 4 [Source:HGNC Symbol;Acc... [more]
TCTEX1D26.658e-827.52Tctex1 domain containing 2 [Source:HGNC Symbol;Acc... [more]
TCTEX1D22.383e-631.11Tctex1 domain containing 2 [Source:HGNC Symbol;Acc... [more]
AC069257.44.478e-632.84novel protein[more]
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tctex1d14.827e-1332.33Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d14.827e-1332.33Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d26.055e-1030.89Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d22.457e-634.57Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
coq10b6.410e-1633.83coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252][more]
ENSXETT00000044463.11.061e-930.10tctex1 domain-containing protein 1-like [Source:NC... [more]
txnrd21.222e-932.08thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000022071.16.964e-828.23lysophosphatidic acid receptor 6-like [Source:Xenb... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tctex1d15.820e-1532.54Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d15.820e-1532.54Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d15.914e-1531.82Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d16.115e-1531.82Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d16.115e-1531.82Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2VDD2|TC1DB_XENLA6.386e-1533.08Tctex1 domain-containing protein 1-B (Fragment) OS... [more]
sp|Q3B8D7|TC1DA_XENLA7.154e-1534.35Tctex1 domain-containing protein 1-A OS=Xenopus la... [more]
sp|Q8N7M0|TC1D1_HUMAN1.069e-1434.85Tctex1 domain-containing protein 1 OS=Homo sapiens... [more]
sp|Q9D5I4|TC1D1_MOUSE4.278e-1431.82Tctex1 domain-containing protein 1 OS=Mus musculus... [more]
sp|Q66IC8|TC1D1_DANRE3.644e-1232.33Tctex1 domain-containing protein 1 OS=Danio rerio ... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0Q3RGZ23.214e-2233.51Tctex1 domain-containing protein 4 OS=Amazona aest... [more]
A0A2I0LPA28.251e-2133.54Tctex1 domain containing 4 OS=Columba livia OX=893... [more]
A0A2D4JNU54.473e-2033.33Uncharacterized protein OS=Micrurus lemniscatus le... [more]
W4XM664.499e-1933.11Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A493TD631.210e-1831.89Tctex1 domain containing 4 OS=Anas platyrhynchos p... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tctex1d11.426e-1434.09Tctex1 domain containing 1 [Source:NCBI gene;Acc:1... [more]
tctex1d27.895e-1031.19Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000038759.12.555e-926.24tctex1 domain-containing protein 1-A-like [Source:... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008035.19.436e-726.79pep scaffold:Pmarinus_7.0:GL476353:419801:420827:1... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454416.075e-1734.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335639.053e-1633.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453137.447e-1331.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443371.034e-1228.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469901.197e-1232.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctex1d25.302e-827.52Tctex1 domain containing 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Tctex1 domain containing 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018052.12.868e-2434.86SMESG000018052.1[more]
SMESG000017994.11.034e-2334.29SMESG000017994.1[more]
SMESG000040148.11.603e-2337.04SMESG000040148.1[more]
SMESG000040148.12.378e-2337.04SMESG000040148.1[more]
SMESG000021852.12.483e-1429.41SMESG000021852.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022401 ID=SMED30022401|Name=Tctex1 domain containing 4|organism=Schmidtea mediterranea sexual|type=transcript|length=687bp
CTAGACAGTGTTTAGAGACCGTTATTTAAAAACAATAGCTAAAAGTTGGT
TCCTTGATCTGACTACTTAAAAACTAGAATTCTGATGGCAAACGTCAGCA
GTAACTCAAATACTCAGCTCTTGATTCCATCAATAAGGAAACAGAGTGTT
ATTTCCACAGCAACTAATGCCACTGACGACTTATTGAAAAGAAATAGCCG
AAGATATGGAGGCAGTCGTGCTAGTATTTTTAGTGGATCAGGTCTGGCGA
TGTTTCCAGGCCGTCGTCCAATAATTCAATACGAAAACACCTACAAAATC
GATGTTGATAAAAAGAGCAATGGATATTTTAAACCGACAAAAGCAGAATT
CATCATGAAAGACATATTGCACAGTAATCTCGATCGATATCAGTATGAGC
CACACAGTGCTGCTGTTTTAACGCAAAACATGACAAATATTATTAAAAAC
CGATTAAAAGAATTGGACAGCAATCGCTACAAGTACATCTGTCAGTTGTT
TATCGGCCAGAAACAATGTGGAAATGGAAATTCTAACCATTCAATCATCA
TTGCAAGCCAAATGCTTTCACAGCCGACAAGTGGGGACAGCTTTGTAGAA
TTCAAATACGAAAACAGTTCATTGTTTGCAGTTGCTTTAATTCATGGAAT
TTACCAGGAATGAAAATATCAATAATAATAATAATAA
back to top

protein sequence of SMED30022401-orf-1

>SMED30022401-orf-1 ID=SMED30022401-orf-1|Name=SMED30022401-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MANVSSNSNTQLLIPSIRKQSVISTATNATDDLLKRNSRRYGGSRASIFS
GSGLAMFPGRRPIIQYENTYKIDVDKKSNGYFKPTKAEFIMKDILHSNLD
RYQYEPHSAAVLTQNMTNIIKNRLKELDSNRYKYICQLFIGQKQCGNGNS
NHSIIIASQMLSQPTSGDSFVEFKYENSSLFAVALIHGIYQE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001669acrosomal vesicle
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005930axoneme
GO:0036126sperm flagellum
Vocabulary: molecular function
TermDefinition
GO:0008157protein phosphatase 1 binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038586Tctex-1-like_sf
IPR005334Tctex-1-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038586Tctex-1-like superfamilyGENE3DG3DSA:3.30.1140.40coord: 86..190
e-value: 1.0E-11
score: 46.6
IPR005334Dynein light chain Tctex-1 likePFAMPF03645Tctex-1coord: 88..190
e-value: 7.3E-17
score: 61.5
IPR005334Dynein light chain Tctex-1 likePANTHERPTHR21255T-COMPLEX-ASSOCIATED-TESTIS-EXPRESSED 1/ DYNEIN LIGHT CHAINcoord: 58..192
NoneNo IPR availablePANTHERPTHR21255:SF44TCTEX1 DOMAIN-CONTAINING PROTEIN 1coord: 58..192