Hyaluronan binding protein 2

Overview
NameHyaluronan binding protein 2
Smed IDSMED30022385
Length (bp)1464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hyaluronan binding protein 2 (SMED30022385) t-SNE clustered cells

Violin plots show distribution of expression levels for Hyaluronan binding protein 2 (SMED30022385) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hyaluronan binding protein 2 (SMED30022385) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hyaluronan binding protein 2 (SMED30022385) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022385

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30022385h1SMcG0010832 dd_Smed_v4_2031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022385h1SMcG0010832 dd_Smed_v4_2031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022385h1SMcG0010832 dd_Smed_v4_2031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022385h1SMcG0010832 dd_Smed_v4_2031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022385h1SMcG0010832 dd_Smed_v4_2031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022385h1SMcG0010832 dd_Smed_v4_2031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022385h1SMcG0010832 dd_Smed_v4_2031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hyaluronan binding protein 2 vs. Ensembl Human
Match: NOTCH3 (notch receptor 3 [Source:HGNC Symbol;Acc:HGNC:7883])

HSP 1 Score: 81.6481 bits (200), Expect = 1.583e-15
Identity = 41/123 (33.33%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C E D  E L+   C+N   C+ +  + +C C + +TG +CE D D C ++ C+N   C+        + C CP  F G+ C  DV+EC+  + CR+ A C++   GY C
Sbjct:  415 FLCQCGRGYTGPRC-ETDVNECLSGP-CRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNG---FSCTCPSGFSGSTCQLDVDECA-STPCRNGAKCVDQPDGYEC 531          

HSP 2 Score: 69.707 bits (169), Expect = 7.488e-12
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   Y    C S++D C    +  C++ GKC+    K  C CPS  TG  CE + D C +N C    T  +      +Y C+C   F G  C+ ++NEC+  S C    +C++   G+ C
Sbjct:  566 FSCACAPGYTGTRCESQVDECR---SQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPC----TFGVCRDGINRYDCVCQPGFTGPLCNVEINECA-SSPCGEGGSCVDGENGFRC 681          

HSP 3 Score: 68.9366 bits (167), Expect = 1.498e-11
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +F   C   Y   +C S++D C       C++ G C+       C+CP+ YTG  CE+    C  + C N  TC+ S    L Y C C   F+G  C  +V++C     C +  TC++    YNC
Sbjct:  141 RFLCSCPPGYQGRSCRSDVDECRVGEP--CRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQS--GDLTYDCACLPGFEGQNCEVNVDDCPGH-RCLNGGTCVDGVNTYNC 260          

HSP 4 Score: 68.1662 bits (165), Expect = 2.519e-11
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++D C  +    C++ G+C+       C+C   YTG  CE D + CL+  C N +TC        ++ CIC   F GT+C  D++EC   S C +   C +   G++C
Sbjct:  391 DVDECS-IGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIG---QFTCICMAGFTGTYCEVDIDECQ-SSPCVNGGVCKDRVNGFSC 493          

HSP 5 Score: 66.6254 bits (161), Expect = 8.243e-11
Identity = 37/123 (30.08%), Postives = 55/123 (44.72%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKC----IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C   D C   ++  C   G C    +   A+ SC CP  + G  C    D CL++ C + + C + P    ++ C CP  +QG  C  DV+EC     CR   TC+N  G + C
Sbjct:   67 CPPGWVGERCQLEDPC---HSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSL-PDPCLSSPCAHGARCSVGPDG--RFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGSFRC 183          

HSP 6 Score: 65.4698 bits (158), Expect = 1.675e-10
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  518 SMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            S  C   +   +CS+ ID C    T +C +   C  + A   C CP   TG  C  D D+C++N C  ++ C  +P +  +  C CP  F G  C +DV+ECS   + C     C+N  G + C
Sbjct:  299 SCVCVNGWTGESCSQNIDDCA---TAVCFHGATCHDRVASFYCACPMGKTGLLCHLD-DACVSNPCHEDAICDTNPVNG-RAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLC 417          

HSP 7 Score: 60.8474 bits (146), Expect = 5.196e-9
Identity = 39/128 (30.47%), Postives = 53/128 (41.41%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDK----SSCRSNA-----TCINNYGGYNC 883
            C + +  P C + D  E      C  +G C       SC C   YTG  C+ D + C  N C+N  +CQ    S   + C C   F G  C  DV+EC        +C  +      TC   YGG++C
Sbjct:  798 CPQGWQGPRCQQ-DVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSCQDGVGS---FSCSCLPGFAGPRCARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGFHC 921          

HSP 8 Score: 59.6918 bits (143), Expect = 1.240e-8
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C+      +C+CP E+TG FC +D D C    N+C N  TC  +      + C+C   + G  C +++++C+  + C   ATC +    + C
Sbjct:  245 CLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGG---HSCVCVNGWTGESCSQNIDDCA-TAVCFHGATCHDRVASFYC 338          

HSP 9 Score: 59.3066 bits (142), Expect = 1.306e-8
Identity = 34/123 (27.64%), Postives = 51/123 (41.46%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C+  +  P CS+    +   +  C+  G C        C CP    G  CE     C  N C +   C+ +P       C CP  +QG  C +DV+EC+  + C  +  C N  G ++C
Sbjct:  716 FRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCEL-LSPCTPNPCEHGGRCESAPGQLPV--CSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSC 835          

HSP 10 Score: 59.3066 bits (142), Expect = 1.411e-8
Identity = 31/97 (31.96%), Postives = 47/97 (48.45%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC+  G+C+ + +   C CP   TG  CE + D CL   C +  TC+        Y C C   + G  C +DV+EC+ +  C+   +CI+    Y C
Sbjct: 1054 LCQAGGQCVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGG---YMCECLPGYNGDNCEDDVDECASQ-PCQHGGSCIDLVARYLC 1146          

HSP 11 Score: 57.7658 bits (138), Expect = 4.472e-8
Identity = 32/102 (31.37%), Postives = 44/102 (43.14%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC------SDKSSCRSNATCINNYGGYNC 883
            C++ G C        CEC   Y GD CEDD D C +  C +  +C    A   +Y C CP    G  C  + ++C           C  N TC++  GG+ C
Sbjct: 1093 CQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVA---RYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRC 1191          

HSP 12 Score: 55.4546 bits (132), Expect = 2.232e-7
Identity = 39/134 (29.10%), Postives = 62/134 (46.27%), Query Frame = 2
Query:  503 FMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC-----LNNS--CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNAT--CINNYGG 874
            +M  +  +C   Y   NC + +D C    +  C++ G CI   A+  C CP    G  CE ++D C     L++   C++N TC         ++C CP  + G  C  D+NEC    +C +  T  C+ + GG
Sbjct: 1102 YMGGYMCECLPGYNGDNCEDDVDECA---SQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGG---FRCTCPPGYTGLRCEADINECR-SGACHAAHTRDCLQDPGG 1228          

HSP 13 Score: 55.4546 bits (132), Expect = 2.606e-7
Identity = 35/124 (28.23%), Postives = 50/124 (40.32%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +  P C+ ++D C    +  C   G C    A  +C CP  Y G  CE D   C  +SC N  TC     S   + C+C   + G  C  + + C  +  C     C   + G+ C
Sbjct:  871 FSCSCLPGFAGPRCARDVDECL---SNPC-GPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNS---FSCLCRPGYTGAHCQHEADPCLSR-PCLHGGVCSAAHPGFRC 986          

HSP 14 Score: 55.0694 bits (131), Expect = 3.068e-7
Identity = 34/117 (29.06%), Postives = 52/117 (44.44%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGY 877
            C++D   P+CS          + C N G C+      SC C   YTG  C+ + D CL+  C++   C    A+   ++C C   F G  C   V+ CS +  C++   C+   G Y
Sbjct:  921 CEQDL--PDCS---------PSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVCS---AAHPGFRCTCLESFTGPQCQTLVDWCS-RQPCQNGGRCVQT-GAY 1021          

HSP 15 Score: 54.6842 bits (130), Expect = 4.004e-7
Identity = 34/124 (27.42%), Postives = 53/124 (42.74%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C  ++D C    +T C+N  KC+ +     C C   + G  C+ + D C  + C ++  C    AS   + C C   + GT C   V+EC  +  CR    C++    Y C
Sbjct:  491 FSCTCPSGFSGSTCQLDVDECA---STPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCSPDPC-HHGRCVDGIAS---FSCACAPGYTGTRCESQVDECRSQ-PCRHGGKCLDLVDKYLC 606          

HSP 16 Score: 51.9878 bits (123), Expect = 2.388e-6
Identity = 36/134 (26.87%), Postives = 56/134 (41.79%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C + +  P C   +D+C +     C+N G+C+Q  A   C CP  ++G  C+     C          L   C     C    +S   + C+CP    G+ C ++V+ C  +  C+   TC    GGY C
Sbjct:  984 FRCTCLESFTGPQCQTLVDWCSR---QPCQNGGRCVQTGA--YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSS---HYCVCPEGRTGSHCEQEVDPCLAQ-PCQHGGTCRGYMGGYMC 1108          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Human
Match: NOTCH1 (notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881])

HSP 1 Score: 73.559 bits (179), Expect = 5.003e-13
Identity = 41/127 (32.28%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  524 KCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-------SDKSSCRSNATCINNYGGYNC 883
            +CQ  Y    C   D  ++ + + C+N   C       SC+C + Y G  C ++ D CL++ C N  TC   P +   YKC CP   QG  C  +V++C       S    C +N TC++  GGY+C
Sbjct: 1132 RCQAGYTGSYCE--DLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNT---YKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSC 1253          

HSP 2 Score: 72.4034 bits (176), Expect = 1.383e-12
Identity = 41/122 (33.61%), Postives = 62/122 (50.82%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   Y  P CS+ +D C  L    C++ GKCI       C+C   YTG  CE D + C++N C N++TC  QI      +++CIC   ++G  C  + +EC+  S C  N  C++    + C
Sbjct:  400 CPSGYTGPACSQDVDECS-LGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIG-----EFQCICMPGYEGVHCEVNTDECA-SSPCLHNGRCLDKINEFQC 514          

HSP 3 Score: 71.2478 bits (173), Expect = 2.794e-12
Identity = 34/96 (35.42%), Postives = 47/96 (48.96%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N   C       +C CP+ ++G  CE++   C  +SC N  TC     S   + C+CP  F G++C  DVNEC D   C    TC +  G Y C
Sbjct:  954 CRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINS---FTCLCPPGFTGSYCQHDVNEC-DSQPCLHGGTCQDGCGSYRC 1045          

HSP 4 Score: 69.707 bits (169), Expect = 8.405e-12
Identity = 42/134 (31.34%), Postives = 68/134 (50.75%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   C + Y  PNC   + +C+   ++ CKN GKC Q + +  CECPS +TG +C+    SC          +   C +   C  +  +   + C C   + G++C + V+ECS  S C++ ATC +  GGY+C
Sbjct: 1043 YRCTCPQGYTGPNCQNLVHWCD---SSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNT---HHCRCQAGYTGSYCEDLVDECS-PSPCQNGATCTDYLGGYSC 1169          

HSP 5 Score: 69.3218 bits (168), Expect = 1.090e-11
Identity = 40/122 (32.79%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +   NC E ID C   N   CKN G C+      +C CP E+TG +C +D D C  + N+C N  TC  +      Y C+C   + G  C E++++C+  ++C   ATC +    + C
Sbjct:  245 CLPGFTGQNCEENIDDCPGNN---CKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGG---YNCVCVNGWTGEDCSENIDDCA-SAACFHGATCHDRVASFYC 359          

HSP 6 Score: 67.3958 bits (163), Expect = 3.893e-11
Identity = 38/124 (30.65%), Postives = 56/124 (45.16%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   CQ  Y   NC ++ID C       C N G C        C+C   + G FCE+D + C ++ C N + C     S   Y C CP  F G  C  +  +C++ SSC +  TC++    + C
Sbjct:  891 YRCHCQAGYSGRNCETDIDDCRP---NPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDS---YTCTCPAGFSGIHCENNTPDCTE-SSCFNGGTCVDGINSFTC 1007          

HSP 7 Score: 67.3958 bits (163), Expect = 4.394e-11
Identity = 39/133 (29.32%), Postives = 64/133 (48.12%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDK----SSCRSNAT-----CINNYGGYNC 883
            +F   C   Y   +C E++  ++  ++ C +NG+C+ K  +  CECP+ +TG  C+ D D C +  C N + C   P +   Y C+C   + GT C  D++EC        SC+         C   Y G++C
Sbjct:  473 EFQCICMPGYEGVHC-EVN-TDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNT---YTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC 600          

HSP 8 Score: 67.0106 bits (162), Expect = 6.485e-11
Identity = 41/121 (33.88%), Postives = 57/121 (47.11%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            C   +   +CSE ID C    +  C +   C  + A   CECP   TG  C  + D+C++N C   S C  +P +  K  C CP  + G  C +DV+ECS   + C     CIN  G + C
Sbjct:  323 CVNGWTGEDCSENIDDCA---SAACFHGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNG-KAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFEC 438          

HSP 9 Score: 66.2402 bits (160), Expect = 1.043e-10
Identity = 38/124 (30.65%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+ +C + Y  P C SE++ C   N+  C + G C        C+C   ++G  C+ + + C +N C+N  TC+   +    Y C C   F G  C  ++NEC+  + C +  TCI++  GY C
Sbjct:  700 FTCRCPEGYHDPTCLSEVNEC---NSNPCVH-GACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSG---YVCTCREGFSGPNCQTNINECA-SNPCLNQGTCIDDVAGYKC 815          

HSP 10 Score: 66.2402 bits (160), Expect = 1.128e-10
Identity = 40/123 (32.52%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C E+D  E +  + C++   C   +    C C + Y+G  CE D D C  N C N  +C     +     C C   F+GTFC ED+NEC+    CR+ A C +    Y C
Sbjct:  853 FSCVCPTGWQGQTC-EVDINECV-LSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAF---CDCLPGFRGTFCEEDINECA-SDPCRNGANCTDCVDSYTC 969          

HSP 11 Score: 65.4698 bits (158), Expect = 1.995e-10
Identity = 34/113 (30.09%), Postives = 53/113 (46.90%), Query Frame = 2
Query:  545 SPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +P+C+E         + C N G C+      +C CP  +TG +C+ D + C +  C++  TCQ    S   Y+C CP  + G  C   V+ C D S C++   C   +  Y C
Sbjct:  984 TPDCTE---------SSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGS---YRCTCPQGYTGPNCQNLVHWC-DSSPCKNGGKCWQTHTQYRC 1083          

HSP 12 Score: 61.2326 bits (147), Expect = 3.686e-9
Identity = 44/133 (33.08%), Postives = 54/133 (40.60%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            +S KC   Y   NCS EID C    +  C+N G C+       C CP    G  CE + D C         +  C NN TC         Y C CP  F G  C  DVNEC S+    R    C+     ++C
Sbjct: 1167 YSCKCVAGYHGVNCSEEIDECL---SHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGG---YSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHC 1293          

HSP 13 Score: 61.2326 bits (147), Expect = 3.915e-9
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 2
Query:  482 NSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            N    L F   +   C   +  P C  +++ C +    LC++ G C  +     C C + +TG  CE     C  + C N  TC+  P   + ++C C   F G  C E++++C   ++C++   C++    YNC
Sbjct:  151 NGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQ-KPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCR--PTGDVTHECACLPGFTGQNCEENIDDCPG-NNCKNGGACVDGVNTYNC 281          

HSP 14 Score: 58.5362 bits (140), Expect = 2.493e-8
Identity = 31/97 (31.96%), Postives = 46/97 (47.42%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC++ G C+       C C + YTG +CED  D C  + C N +TC         Y C C   + G  C E+++EC     C++  TC++    Y C
Sbjct: 1115 LCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGG---YSCKCVAGYHGVNCSEEIDECLSH-PCQNGGTCLDLPNTYKC 1207          

HSP 15 Score: 58.151 bits (139), Expect = 3.145e-8
Identity = 45/160 (28.12%), Postives = 59/160 (36.88%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKC----IQKYAKISCECPSEYTGDFCEDDKD-SCLNNSCINNSTCQISPASKLK-----------------------------------YKCICPIYFQGTFCHEDVNECSDKSS-CRSNATCINNYGGYNC 883
            C   ++ P C + + C    +T CKN G C     +  A  +C C   ++G  C    D +CL N C N  TC +   ++ K                                   Y C CP  F G  C +DVNEC  K   CR   TC N  G Y C
Sbjct:   48 CGGAFVGPRCQDPNPCL---STPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRC 204          

HSP 16 Score: 56.6102 bits (135), Expect = 9.786e-8
Identity = 35/133 (26.32%), Postives = 52/133 (39.10%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC----------------------QISPASKL---------------KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C    +   C C   ++G  C+ + + C +N C+N  TC                       ++P +                  + C+CP  +QG  C  D+NEC   S CR  A+C N +GGY C
Sbjct:  762 CVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECV-LSPCRHGASCQNTHGGYRC 893          

HSP 17 Score: 55.8398 bits (133), Expect = 1.653e-7
Identity = 34/117 (29.06%), Postives = 50/117 (42.74%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKL-NTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCIN 862
            +S  C   ++   C E D  E L N    +    C+Q+     CEC + +TG  CE   + C    C N  TC ++  +   + C CP  F+G  C  D   C     C +  TCI+
Sbjct: 1251 YSCTCPPGFVGERC-EGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCG-SLRCLNGGTCIS 1365          

HSP 18 Score: 54.6842 bits (130), Expect = 4.109e-7
Identity = 36/120 (30.00%), Postives = 51/120 (42.50%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C K    PNC   +D C    ++ C ++G C+ K     C C   YTG  C  + D C  N C N  TC+        + C CP  +    C  +VNEC+       +  C ++  GY C
Sbjct:  629 CLKGTTGPNCEINLDDCA---SSPC-DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGING---FTCRCPEGYHDPTCLSEVNECNSNPCV--HGACRDSLNGYKC 739          

HSP 19 Score: 51.6026 bits (122), Expect = 3.572e-6
Identity = 29/87 (33.33%), Postives = 39/87 (44.83%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            C NNG C+ +    SC CP  + G+ CE D + CL+N C    T Q        + C C     G  C   +N C  K  C++  TC
Sbjct: 1238 CFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGT-QNCVQRVNDFHCECRAGHTGRRCESVINGCKGK-PCKNGGTC 1322          

HSP 20 Score: 51.2174 bits (121), Expect = 4.906e-6
Identity = 31/87 (35.63%), Postives = 43/87 (49.43%), Query Frame = 2
Query:  629 AKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
             K  C CPS YTG  C  D D C    N C +   C  +  S   ++C C   + G  C  DVNEC   + C+++ATC++  G + C
Sbjct:  394 GKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGS---FECQCLQGYTGPRCEIDVNECV-SNPCQNDATCLDQIGEFQC 476          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 73.559 bits (179), Expect = 6.087e-13
Identity = 41/123 (33.33%), Postives = 55/123 (44.72%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  KC   Y    C EID  E L +  C + G C       SC CP  +TG  CE D + CL + C N + CQ  P S   + C+C   + G  C   VN C + + C +  +C +    Y C
Sbjct: 3846 FLCKCLPGYAGSWC-EIDIDECLPSP-CHSGGTCHNLVGGFSCSCPDGFTGRACERDINECLQSPCKNGAICQNFPGS---FNCVCKTGYTGKMCESSVNYC-ECNPCFNGGSCQSGVDSYYC 3962          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Human
Match: NOTCH4 (notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884])

HSP 1 Score: 72.4034 bits (176), Expect = 1.105e-12
Identity = 39/122 (31.97%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFC--EKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CQ  Y  P C  ++D C   +   + C++ G C+      +C CP  YTG  CE D + CL+  C   STC    A+   + C+CP   +G  C  + NEC+  + C ++A C +   G+ C
Sbjct:  420 CQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLAT---FHCLCPPGLEGQLCEVETNECA-SAPCLNHADCHDLLNGFQC 537          

HSP 2 Score: 67.0106 bits (162), Expect = 6.401e-11
Identity = 37/102 (36.27%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKIS----CECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSS--CRSNATCINNYGGYNC 883
            C N G C     K S    C CP  + G  CE + D+C+++ C N  TCQ    +   Y C+CP  + G  C EDV+EC  +    CR+  TC N+ G ++C
Sbjct:  243 CSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDT---YTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHC 341          

HSP 3 Score: 65.855 bits (159), Expect = 1.443e-10
Identity = 37/141 (26.24%), Postives = 62/141 (43.97%), Query Frame = 2
Query:  485 SKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCEKLN-------TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + H L     F   C + +  P C+  +  C+K         ++LC N G C+       C CP  + G  C+D  + C +  C N +TC   P+    Y C C   + G  C ++++ C  +  C ++ TC    GG++C
Sbjct:  856 NSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSG---YLCQCAPGYDGQNCSKELDACQSQ-PCHNHGTCTPKPGGFHC 992          

HSP 4 Score: 64.3142 bits (155), Expect = 3.768e-10
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  518 SMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            S  C   +  P C +E+  C    +  C + G C  + +  +C CP+ YTG  C ++  +C +  C+N  +C  SP     Y C CP    G  C    + C   + C +  TC+N  G ++C
Sbjct:  676 SCVCDVGWTGPECEAELGGCI---SAPCAHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSCNPSPGG---YYCTCPPSHTGPQCQTSTDYCV-SAPCFNGGTCVNRPGTFSC 791          

HSP 5 Score: 62.3882 bits (150), Expect = 1.475e-9
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 2
Query:  590 TLCKNNGKC-IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            + C   G+C IQ   +  C C   +TG+ C+  +D C  N C+N   C    A+  + +C CP  F+G  C  DVNEC  D   C    +C N  G + C
Sbjct:  125 SFCSKRGRCHIQASGRPQCSCMPGWTGEQCQ-LRDFCSANPCVNGGVCL---ATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQC 220          

HSP 6 Score: 62.3882 bits (150), Expect = 1.594e-9
Identity = 35/121 (28.93%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDD-KDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +  P C +  D+C    +  C N G C+ +    SC C   + G  CE   + SC ++ C N +TCQ SP      +C+CP  + G  C   ++ C+ K  C  N+ C+     ++C
Sbjct:  755 CPPSHTGPQCQTSTDYCV---SAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGP---RCLCPTVYTGGSCQTLMDLCAQK-PCPRNSHCLQTGPSFHC 868          

HSP 7 Score: 61.2326 bits (147), Expect = 3.875e-9
Identity = 31/100 (31.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC----SDKSSCRSNATCINNYGGYNC 883
            C     CI +    SC CP   TG  C  + D CL+  C  ++ C  +P +     C+C   + G  CH+D++EC       S C    +C+N  G +NC
Sbjct:  364 CAPGSTCIDRVGSFSCLCPPGRTGLLCHLE-DMCLSQPCHGDAQCSTNPLTGSTL-CLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNC 461          

HSP 8 Score: 57.7658 bits (138), Expect = 4.514e-8
Identity = 31/112 (27.68%), Postives = 48/112 (42.86%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNN--SCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            C   +    C   DFC   +   C N G C+  Y +I C CP  + G  CE D + C  +   C   ++C  +  S   ++C+CP+  +G  C      C  +  C +  TC
Sbjct:  145 CMPGWTGEQCQLRDFC---SANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGS---FQCLCPVGQEGPRCELRAGPCPPR-GCSNGGTC 249          

HSP 9 Score: 55.0694 bits (131), Expect = 2.995e-7
Identity = 29/96 (30.21%), Postives = 44/96 (45.83%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N+  C        C C   ++G  CE+D D C ++ C N   CQ  P +   + C C   F+G  C  +V+EC     C   A+C++  G + C
Sbjct:  522 CLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPCANGGQCQDQPGA---FHCKCLPGFEGPRCQTEVDECL-SDPCPVGASCLDLPGAFFC 613          

HSP 10 Score: 53.5286 bits (127), Expect = 8.843e-7
Identity = 34/112 (30.36%), Postives = 47/112 (41.96%), Query Frame = 2
Query:  524 KCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            +C   Y   NCS E+D C+   +  C N+G C  K     C CP  + G  CE D D CL+  C    T      +   Y C C     G +C  +++ C  +  C    TC
Sbjct:  955 QCAPGYDGQNCSKELDACQ---SQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFY-CQCLPGHTGQWCEVEIDPCHSQ-PCFHGGTC 1061          

HSP 11 Score: 53.1434 bits (126), Expect = 1.164e-6
Identity = 43/168 (25.60%), Postives = 55/168 (32.74%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC-QISPA--------------------------------------------SKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +  P C E         + C+N   C        C CP+ YTG  C+   D C    C  NS C Q  P+                                            S   Y C CP  FQG+ C + VN C  +  C++ ATC+    GY C
Sbjct:  789 FSCLCAMGFQGPRC-EGKLRPSCADSPCRNRATCQDSPQGPRCLCPTVYTGGSCQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESR-PCQNGATCMAQPSGYLC 954          

HSP 12 Score: 51.2174 bits (121), Expect = 4.882e-6
Identity = 35/130 (26.92%), Postives = 54/130 (41.54%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDV---NECSDKSSCRSN---ATCINNYGGYNC 883
            F   C   +    C E ID C    ++ C N G+C  +     C+C   + G  C+ + D CL++ C   ++C   P +   + C+CP  F G  C   +   N C  K  C+     A C+   G   C
Sbjct:  535 FQCICLPGFSGTRCEEDIDECR---SSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGA---FFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGC 658          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Human
Match: NOTCH4 (notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884])

HSP 1 Score: 72.4034 bits (176), Expect = 1.124e-12
Identity = 39/122 (31.97%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFC--EKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CQ  Y  P C  ++D C   +   + C++ G C+      +C CP  YTG  CE D + CL+  C   STC    A+   + C+CP   +G  C  + NEC+  + C ++A C +   G+ C
Sbjct:  419 CQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLAT---FHCLCPPGLEGQLCEVETNECA-SAPCLNHADCHDLLNGFQC 536          

HSP 2 Score: 67.0106 bits (162), Expect = 6.456e-11
Identity = 37/102 (36.27%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKIS----CECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSS--CRSNATCINNYGGYNC 883
            C N G C     K S    C CP  + G  CE + D+C+++ C N  TCQ    +   Y C+CP  + G  C EDV+EC  +    CR+  TC N+ G ++C
Sbjct:  242 CSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDT---YTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHC 340          

HSP 3 Score: 65.855 bits (159), Expect = 1.456e-10
Identity = 37/141 (26.24%), Postives = 62/141 (43.97%), Query Frame = 2
Query:  485 SKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCEKLN-------TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + H L     F   C + +  P C+  +  C+K         ++LC N G C+       C CP  + G  C+D  + C +  C N +TC   P+    Y C C   + G  C ++++ C  +  C ++ TC    GG++C
Sbjct:  855 NSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSG---YLCQCAPGYDGQNCSKELDACQSQ-PCHNHGTCTPKPGGFHC 991          

HSP 4 Score: 64.3142 bits (155), Expect = 3.801e-10
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  518 SMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            S  C   +  P C +E+  C    +  C + G C  + +  +C CP+ YTG  C ++  +C +  C+N  +C  SP     Y C CP    G  C    + C   + C +  TC+N  G ++C
Sbjct:  675 SCVCDVGWTGPECEAELGGCI---SAPCAHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSCNPSPGG---YYCTCPPSHTGPQCQTSTDYCV-SAPCFNGGTCVNRPGTFSC 790          

HSP 5 Score: 62.3882 bits (150), Expect = 1.513e-9
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 2
Query:  590 TLCKNNGKC-IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            + C   G+C IQ   +  C C   +TG+ C+  +D C  N C+N   C    A+  + +C CP  F+G  C  DVNEC  D   C    +C N  G + C
Sbjct:  124 SFCSKRGRCHIQASGRPQCSCMPGWTGEQCQ-LRDFCSANPCVNGGVCL---ATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQC 219          

HSP 6 Score: 61.6178 bits (148), Expect = 2.651e-9
Identity = 35/121 (28.93%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDD-KDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +  P C +  D+C    +  C N G C+ +    SC C   + G  CE   + SC ++ C N +TCQ SP      +C+CP  + G  C   ++ C+ K  C  N+ C+     ++C
Sbjct:  754 CPPSHTGPQCQTSTDYCV---SAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGP---RCLCPTGYTGGSCQTLMDLCAQK-PCPRNSHCLQTGPSFHC 867          

HSP 7 Score: 61.2326 bits (147), Expect = 4.011e-9
Identity = 31/100 (31.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC----SDKSSCRSNATCINNYGGYNC 883
            C     CI +    SC CP   TG  C  + D CL+  C  ++ C  +P +     C+C   + G  CH+D++EC       S C    +C+N  G +NC
Sbjct:  363 CAPGSTCIDRVGSFSCLCPPGRTGLLCHLE-DMCLSQPCHGDAQCSTNPLTGSTL-CLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNC 460          

HSP 8 Score: 58.9214 bits (141), Expect = 2.153e-8
Identity = 39/135 (28.89%), Postives = 56/135 (41.48%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCH-EDV---NECSDKSSCRSN-------ATCINNYGGYNC 883
            ++  C + +   +CSE +D CE      C+N G C        C C S + G  CE++ D C+  +C   STC     S   + C+CP    G  CH ED+     C   + C +N         C   Y G  C
Sbjct:  297 YTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGS---FSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTC 428          

HSP 9 Score: 57.7658 bits (138), Expect = 4.514e-8
Identity = 31/112 (27.68%), Postives = 48/112 (42.86%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNN--SCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            C   +    C   DFC   +   C N G C+  Y +I C CP  + G  CE D + C  +   C   ++C  +  S   ++C+CP+  +G  C      C  +  C +  TC
Sbjct:  144 CMPGWTGEQCQLRDFC---SANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGS---FQCLCPVGQEGPRCELRAGPCPPR-GCSNGGTC 248          

HSP 10 Score: 55.0694 bits (131), Expect = 3.021e-7
Identity = 29/96 (30.21%), Postives = 44/96 (45.83%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N+  C        C C   ++G  CE+D D C ++ C N   CQ  P +   + C C   F+G  C  +V+EC     C   A+C++  G + C
Sbjct:  521 CLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPCANGGQCQDQPGA---FHCKCLPGFEGPRCQTEVDECL-SDPCPVGASCLDLPGAFFC 612          

HSP 11 Score: 53.5286 bits (127), Expect = 9.073e-7
Identity = 34/112 (30.36%), Postives = 47/112 (41.96%), Query Frame = 2
Query:  524 KCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            +C   Y   NCS E+D C+   +  C N+G C  K     C CP  + G  CE D D CL+  C    T      +   Y C C     G +C  +++ C  +  C    TC
Sbjct:  954 QCAPGYDGQNCSKELDACQ---SQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFY-CQCLPGHTGQWCEVEIDPCHSQ-PCFHGGTC 1060          

HSP 12 Score: 53.1434 bits (126), Expect = 1.087e-6
Identity = 43/168 (25.60%), Postives = 55/168 (32.74%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC-QISPA--------------------------------------------SKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +  P C E         + C+N   C        C CP+ YTG  C+   D C    C  NS C Q  P+                                            S   Y C CP  FQG+ C + VN C  +  C++ ATC+    GY C
Sbjct:  788 FSCLCAMGFQGPRC-EGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESR-PCQNGATCMAQPSGYLC 953          

HSP 13 Score: 51.2174 bits (121), Expect = 4.882e-6
Identity = 35/130 (26.92%), Postives = 54/130 (41.54%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDV---NECSDKSSCRSN---ATCINNYGGYNC 883
            F   C   +    C E ID C    ++ C N G+C  +     C+C   + G  C+ + D CL++ C   ++C   P +   + C+CP  F G  C   +   N C  K  C+     A C+   G   C
Sbjct:  534 FQCICLPGFSGTRCEEDIDECR---SSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGA---FFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGC 657          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Celegans
Match: lin-12 (pep chromosome:WBcel235:III:9060096:9071760:-1 gene:WBGene00003001.1 transcript:R107.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-12)

HSP 1 Score: 65.4698 bits (158), Expect = 5.906e-11
Identity = 42/129 (32.56%), Postives = 61/129 (47.29%), Query Frame = 2
Query:  497 LSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +SF   F   C   Y    C E    +      C+   KCI       C+CP E TG +CE    S + + C N+ TC  SP S+  ++C C   ++G  C +D NEC  ++ C +N TC+N  G + C
Sbjct:  265 ISFSGGFQCICDDGYSGSYCQEGK--DNCVNNKCEAGSKCINGVNSYFCDCPPERTGPYCEKMDCSAIPDIC-NHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRC 390          

HSP 2 Score: 53.5286 bits (127), Expect = 3.005e-7
Identity = 37/106 (34.91%), Postives = 56/106 (52.83%), Query Frame = 2
Query:  578 KLNTTLCKN---NGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSD-KSSCRSNATCINNYGGYNC 883
            ++ T +CK+   NG  + K +     CPS Y GD C+  +  C  + C+N   C     +  + KC CP  F+G  C  DVNEC + K++C + +TC+N  G Y C
Sbjct:   82 RMETCVCKDCDINGNSLLKPS-----CPSGYGGDDCKT-QGWCYPSVCMNGGQCI---GAGNRAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYIC 178          

HSP 3 Score: 51.9878 bits (123), Expect = 9.679e-7
Identity = 33/91 (36.26%), Postives = 42/91 (46.15%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKI--SCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCIN 862
            C NN  CI   A I  +C C   + GD CE  KD CL N C N   C      +  + C CP  F G  C ++      KS+C++   CIN
Sbjct:  512 CMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCH---QHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCIN 599          

HSP 4 Score: 50.447 bits (119), Expect = 2.762e-6
Identity = 36/107 (33.64%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDS---------CLNNSCINNSTCQISPASKLKYKCICPIYFQGTFC--HEDV---NECSDKSSC 838
            EI  C +     C N GKC+  +    C CP ++TG+ CE ++ +         CL++ C+NN+TC I   + + Y CIC   F+G  C  H+D+   N CS+   C
Sbjct:  458 EIGICSRQGGK-CFNGGKCLSGF----CVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATC-IDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVC 558          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 60.4622 bits (145), Expect = 2.294e-9
Identity = 41/129 (31.78%), Postives = 54/129 (41.86%), Query Frame = 2
Query:  503 FMIQFSMKCQKDYLSPNCSEI-DFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINN-YGGYNC 883
            FM +    C+  Y+   C  + D C   +T  C N GKC Q      C CP  + G  C+ + D C    C N   C   P  K    C+C   F G  C E  + CS  + CR+ A CI    G + C
Sbjct: 2031 FMHRAQCHCKPGYVGDRCEMLEDVC---STQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVK-STTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKC 2155          

HSP 2 Score: 56.9954 bits (136), Expect = 2.875e-8
Identity = 34/101 (33.66%), Postives = 49/101 (48.51%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSD 826
            CQ  +   NC + ID C     + C+N+ KCI +     CEC   Y G  C+   D C    C NN+TC    A+   Y C C + F G  C  +++EC++
Sbjct: 2232 CQPGWTGENCDQNIDECA---ASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGAT---YHCDCTLGFDGVHCEMNIDECAE 2326          

HSP 3 Score: 55.8398 bits (133), Expect = 6.558e-8
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  491 HNLSFMIQFSMKCQKDYLSPNCSEI-DFCEKLNTTLCKNNGKCI-QKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKL--KYKCICPIYFQGTFCHEDVNECS 823
            H+L  +   +  C+  +  P C EI D C   N   C+N  +CI +K  +  C+C   + G  C+ + D C ++ C  N+TC       L   YKC CP  F G  CH   N C+
Sbjct: 2105 HDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNP--CRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATC-----VDLINDYKCECPTGFSGKRCHIKENLCA 2212          

HSP 4 Score: 51.9878 bits (123), Expect = 9.866e-7
Identity = 33/127 (25.98%), Postives = 62/127 (48.82%), Query Frame = 2
Query:  506 MIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + +F  +C   +  PNC + ID C     + C  N  C+       CECP+ ++G  C   ++ C ++ C++     +        +C+C   + G  C ++++EC+  S C+++A CI+   GY C
Sbjct: 2150 LGRFKCQCVPGWEGPNCDKNIDDCAD---SPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHG----LCIDKLYSRQCLCQPGWTGENCDQNIDECA-ASPCQNDAKCIDEINGYMC 2268          

HSP 5 Score: 50.447 bits (119), Expect = 3.331e-6
Identity = 31/95 (32.63%), Postives = 41/95 (43.16%), Query Frame = 2
Query:  536 DYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC 820
            + L  +C  ID   K+    C+NN +C     +  C C   Y GD CE  +D C    C N   C+        YKC CP  F G  C  + +EC
Sbjct: 2006 ESLESSCFPIDCSAKM----CENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCE---QVGTTYKCTCPKMFNGARCQFESDEC 2093          

HSP 6 Score: 50.447 bits (119), Expect = 3.388e-6
Identity = 31/96 (32.29%), Postives = 46/96 (47.92%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G+C    + + C CP+ +TG  CE     C   +C N   C  + A+    KC C   F G  C  +++ECS  + C S ATC++    + C
Sbjct: 2445 CHNGGECGDFGSHLECACPASFTGKGCEFKNTGC--KTCENGGKC--AEAAGGLQKCECSPGFTGERCETNIDECS-TAHCPSGATCVDQVNTHIC 2535          

HSP 7 Score: 50.0618 bits (118), Expect = 4.732e-6
Identity = 31/104 (29.81%), Postives = 49/104 (47.12%), Query Frame = 2
Query:  572 CEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+KL T  C++            C C   YTG  C+  +D C ++ C+N++ C     +   YKC+C   + G  C +D   C+ K  CR+N  C++    Y C
Sbjct: 2329 CDKLGTESCRD------AVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGA---YKCVCKSGWTGPKCEQDNGSCAAK-PCRNNGFCVSLVADYFC 2422          

HSP 8 Score: 49.2914 bits (116), Expect = 7.910e-6
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  605 NGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +G CI K     C C   +TG+ C+ + D C  + C N++ C  +I+      Y C C   ++G  C   V+ C+ K  C +NATC N    Y+C
Sbjct: 2218 HGLCIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEIN-----GYMCECADGYEGVHCQHLVDHCA-KQPCHNNATCTNMGATYHC 2306          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Celegans
Match: ZC116.3 (Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc:Q20911])

HSP 1 Score: 59.6918 bits (143), Expect = 3.880e-9
Identity = 29/69 (42.03%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  689 DSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS----DKSSCRSNATCINNYGGYNC 883
            ++C  N C N  TC   P+   K+ C+CP +F GT C  D++ECS      + C++N TCINN GG+ C
Sbjct:  170 NACDPNKCSNGGTC--IPSFGAKFTCLCPPHFTGTTCEADIDECSVYNGTTAGCQNNGTCINNRGGFEC 236          

HSP 2 Score: 49.6766 bits (117), Expect = 5.282e-6
Identity = 45/147 (30.61%), Postives = 62/147 (42.18%), Query Frame = 2
Query:  500 SFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTL--CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--------NNSCIN---NSTCQISPASKLKYKCICPIYFQGTFCHE-----DVNECSDKSSCRSNATCINNYGGYNC 883
            SF  +F+  C   +    C ++ID C   N T   C+NNG CI       C+C S Y G  C+    +C         +  CI    + T Q S +    YKCIC   F+ +         DVNEC + + C     CIN  G + C
Sbjct:  186 SFGAKFTCLCPPHFTGTTCEADIDECSVYNGTTAGCQNNGTCINNRGGFECQCQSGYHGSLCQYHMSACSKTFELCGPHGHCIESIVDPTGQ-SSSDTTTYKCICDWGFKVSSDKNNPTCVDVNEC-ESNPCHPGVDCINLPGSFVC 330          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Celegans
Match: egas-4 (EGF plus ASC domain ion channel [Source:UniProtKB/TrEMBL;Acc:Q20852])

HSP 1 Score: 59.3066 bits (142), Expect = 4.894e-9
Identity = 40/132 (30.30%), Postives = 62/132 (46.97%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKY----AKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRS---NATCINNYGGYNC 883
             +S  C   Y+  NC   D C  +N   C+N G C+  Y    +  +C+C  ++ G +CE+++  C    C N   C+        Y C C   + G  C  DV+EC  D + C++   +ATC+N  G Y C
Sbjct:  383 SYSCACLNLYMDTNCETFDSC-YINK--CENGGTCVPTYNLLDSTFTCQCTPDWKGTYCEEERYYCDETPCENGGECEDIIGPPNSYNCTCTPQWTGFNCTIDVDECVEDTTLCKTKDPDATCVNTNGSYYC 511          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 59.3066 bits (142), Expect = 5.007e-9
Identity = 43/143 (30.07%), Postives = 68/143 (47.55%), Query Frame = 2
Query:  476 LTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEK-----LNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN--NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            L N+   ++   +F+  C K +      E D+CEK     +N+  C+N GKC+       C+CP EY G  CED  + C    N C NN  C     S   Y C+C   F G  C  ++++C +   C++  +C++    Y+C
Sbjct:  918 LNNATCKVAQAGRFNCYCNKGF------EGDYCEKNIDDCVNSK-CENGGKCVDLINSYRCDCPMEYEGKHCEDKLEYCTKKLNPCENNGKCIPINGS---YSCMCSPGFTGNNCETNIDDCKN-VECQNGGSCVDGILSYDC 1049          

HSP 2 Score: 58.9214 bits (141), Expect = 6.321e-9
Identity = 30/97 (30.93%), Postives = 53/97 (54.64%), Query Frame = 2
Query:  596 CKNNGKC-IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CKNN  C      K +C C   + G  CE+  D+C  + C+NN+TC+++ A   ++ C C   F+G +C +++++C + S C +   C++    Y C
Sbjct:  878 CKNNAICETTSSRKYTCNCTPGFYGVHCENQIDACYGSPCLNNATCKVAQAG--RFNCYCNKGFEGDYCEKNIDDCVN-SKCENGGKCVDLINSYRC 971          

HSP 3 Score: 51.2174 bits (121), Expect = 1.459e-6
Identity = 33/94 (35.11%), Postives = 48/94 (51.06%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFC-EKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCH 802
            C  +Y   +C + +++C +KLN   C+NNGKCI      SC C   +TG+ CE + D C N  C N  +C       L Y C+C   + G +C 
Sbjct:  973 CPMEYEGKHCEDKLEYCTKKLNP--CENNGKCIPINGSYSCMCSPGFTGNNCETNIDDCKNVECQNGGSC---VDGILSYDCLCRPGYAGQYCE 1061          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0304659)

HSP 1 Score: 76.6406 bits (187), Expect = 2.935e-14
Identity = 48/125 (38.40%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASK-LKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS +C   Y    C + ID C    T  C N G CI K     C C   +TG  CE   D C +N C N + C  +P+S  L + C C + + G +C ED++ECS  S CR+ A+C+N  G Y C
Sbjct:  813 FSCQCMPGYTGQKCETNIDDCV---TNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKC--TPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRC 932          

HSP 2 Score: 68.9366 bits (167), Expect = 6.525e-12
Identity = 40/98 (40.82%), Postives = 52/98 (53.06%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS--DKSSCRSNATCINNYGGYNC 883
            C+N G C        C+CP  + G  CE + D CL + C N  TC I   S   Y C CP  F G FC +DV+EC+  D   C++ ATC N +G Y+C
Sbjct:  264 CQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTC-IDGIS--DYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSC 358          

HSP 3 Score: 64.6994 bits (156), Expect = 1.493e-10
Identity = 44/132 (33.33%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  500 SFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS---CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            S  + +  KC K +   NC +  D C      LC+N G CI   +  +C CP  +TG FC+DD D C       C N +TC  +  S   Y CIC   + G  C  + ++C  +++C   ATCI+  G + C
Sbjct:  272 SNGLSYECKCPKGFEGKNCEQNYDDCLG---HLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGS---YSCICVNGWAGLDCSNNTDDCK-QAACFYGATCIDGVGSFYC 396          

HSP 4 Score: 62.7734 bits (151), Expect = 6.202e-10
Identity = 43/135 (31.85%), Postives = 61/135 (45.19%), Query Frame = 2
Query:  482 NSKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            N    L+    +   C K Y   +C+   D C       C+N G C+      SC C   + G  CE D + CL+  C N +TC     S   Y C CP+ F G  C  +  +C++ SSC +  +CI+   GYNC
Sbjct:  919 NGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASF---PCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNS---YTCTCPLGFSGINCQTNDEDCTE-SSCLNGGSCIDGINGYNC 1046          

HSP 5 Score: 60.4622 bits (145), Expect = 2.827e-9
Identity = 38/125 (30.40%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKL-KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   C + +  P C + I+ CE   +  C+N G C+       C C   +TG  CE D D C +N C+N+ TC      K+  +KC C + F G  C  ++++C  +  CR+   C ++  GY+C
Sbjct:  472 YRCNCSQGFTGPRCETNINECE---SHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCH----DKINGFKCSCALGFTGARCQINIDDCQSQ-PCRNRGICHDSIAGYSC 588          

HSP 6 Score: 59.3066 bits (142), Expect = 6.350e-9
Identity = 37/124 (29.84%), Postives = 63/124 (50.81%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  C   Y   +CSE ID C++   + C++NG C+       C C   +TG  CE + + C ++ C N  +C   P +   ++C+C   F GT C  D++EC   + C ++ TC +   G+ C
Sbjct:  433 YACSCATGYKGVDCSEDIDECDQ--GSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGT---FRCVCMPGFTGTQCEIDIDECQ-SNPCLNDGTCHDKINGFKC 550          

HSP 7 Score: 58.9214 bits (141), Expect = 8.509e-9
Identity = 39/124 (31.45%), Postives = 55/124 (44.35%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C   +   +CS   D C++     C     CI       C+C    TG  C  D D+C +N C  ++ C  SP +   Y C C   ++G  C ED++EC   S C  N  C+N  G Y C
Sbjct:  356 YSCICVNGWAGLDCSNNTDDCKQ---AACFYGATCIDGVGSFYCQCTKGKTGLLCHLD-DACTSNPCHADAICDTSPING-SYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRC 474          

HSP 8 Score: 55.8398 bits (133), Expect = 9.613e-8
Identity = 36/120 (30.00%), Postives = 53/120 (44.17%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C + Y    C  EID C+   +  C+N G C        C+C   + G  CE + D C  N C N  TC       + + C CP    G  C  + ++C    +C +N +CI+  GG+ C
Sbjct: 1171 CSQGYAGSYCQKEIDECQ---SQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCH---DRVMNFSCSCPPGTMGIICEINKDDCK-PGACHNNGSCIDRVGGFEC 1283          

HSP 9 Score: 54.299 bits (129), Expect = 2.430e-7
Identity = 31/99 (31.31%), Postives = 48/99 (48.48%), Query Frame = 2
Query:  587 TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++ C NNG CI +     CECP  +    C  D D C +N C+N   C+       ++ C CP  + G  C  D++ECS  + C+   TC +    ++C
Sbjct:  721 SSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCE---DGINEFICHCPPGYTGKRCELDIDECS-SNPCQHGGTCYDKLNAFSC 815          

HSP 10 Score: 53.9138 bits (128), Expect = 3.038e-7
Identity = 37/138 (26.81%), Postives = 58/138 (42.03%), Query Frame = 2
Query:  476 LTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKC--IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            L      L  + +++  C   Y    C   + C    ++ C+N   C  +   +  +C CP  +TGD C  D + C +N C    TC  +  S   Y+C+CP  + G  C      CS  S C++   C +N   Y C
Sbjct:  149 LNGGTCQLKTLEEYTCACANGYTGERCETKNLCA---SSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGS---YQCMCPTGYTGKDCDTKYKPCS-PSPCQNGGICRSNGLSYEC 279          

HSP 11 Score: 53.9138 bits (128), Expect = 3.117e-7
Identity = 33/107 (30.84%), Postives = 48/107 (44.86%), Query Frame = 2
Query:  503 FMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC 820
             +  +  +C++ +   NC   ID C       C+N G C  +    SC CP    G  CE +KD C   +C NN +C         ++C+C   F G  C  D+NEC
Sbjct: 1201 LIGAYECQCRQGFQGQNCELNIDDCAP---NPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGG---FECVCQPGFVGARCEGDINEC 1301          

HSP 12 Score: 51.6026 bits (122), Expect = 1.619e-6
Identity = 40/138 (28.99%), Postives = 61/138 (44.20%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            D+N   ++P    N      ++  ++  C   +   NC   D  E    + C N G CI      +C C + Y+G  C+   + C +N C+N +TC        +Y C CP  F G  C E V+ C  +S C + ATC
Sbjct:  984 DINECLSQPCQ--NGATCSQYVNSYTCTCPLGFSGINCQTND--EDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCH---EQNNEYTCHCPSGFTGKQCSEYVDWCG-QSPCENGATC 1113          

HSP 13 Score: 51.2174 bits (121), Expect = 2.185e-6
Identity = 40/129 (31.01%), Postives = 53/129 (41.09%), Query Frame = 2
Query:  500 SFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            S  + FS  C+  Y    C E ID C    ++ C+N   C+       C C   Y G  C  + D C +  C N  TC         Y C+C   F G  C  D+NEC  +  C++ ATC      Y C
Sbjct:  886 SNFLDFSCTCKLGYTGRYCDEDIDECSL--SSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIG---DYSCLCVDGFDGKHCETDINECLSQ-PCQNGATCSQYVNSYTC 1008          

HSP 14 Score: 51.2174 bits (121), Expect = 2.528e-6
Identity = 36/108 (33.33%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +I+ CE   +  C+ +G C  +     C+C +  +G  CE + + C +N C N +TC     S   YKC C   F G  C ++V+EC   S C +N  CI+   GY C
Sbjct:  639 QINECE---SNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINS---YKCQCVPGFTGQHCEKNVDECI-SSPCANNGVCIDQVNGYKC 739          

HSP 15 Score: 50.8322 bits (120), Expect = 2.950e-6
Identity = 33/102 (32.35%), Postives = 49/102 (48.04%), Query Frame = 2
Query:  524 KCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECS 823
            +CQ      NC E++   + ++  C N   CI       C+C   +TG  CE + D C+++ C NN  C  Q++      YKC CP  F    C  DV+EC+
Sbjct:  664 QCQAGTSGKNC-EVNV-NECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVN-----GYKCECPRGFYDAHCLSDVDECA 758          

HSP 16 Score: 50.0618 bits (118), Expect = 5.707e-6
Identity = 39/131 (29.77%), Postives = 56/131 (42.75%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLK-------YKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +    C   ID C+   +  C+N G C    A  SCECP  YTG  CE           IN + C  +P  + K       +KC+C   + G  C + +NEC + + C+ +  C +  G Y C
Sbjct:  548 FKCSCALGFTGARCQINIDDCQ---SQPCRNRGICHDSIAGYSCECPPGYTGTSCE-----------ININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINEC-ESNPCQFDGHCQDRVGSYYC 663          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0070507)

HSP 1 Score: 76.6406 bits (187), Expect = 2.935e-14
Identity = 48/125 (38.40%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASK-LKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS +C   Y    C + ID C    T  C N G CI K     C C   +TG  CE   D C +N C N + C  +P+S  L + C C + + G +C ED++ECS  S CR+ A+C+N  G Y C
Sbjct:  813 FSCQCMPGYTGQKCETNIDDCV---TNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKC--TPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRC 932          

HSP 2 Score: 68.9366 bits (167), Expect = 6.525e-12
Identity = 40/98 (40.82%), Postives = 52/98 (53.06%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS--DKSSCRSNATCINNYGGYNC 883
            C+N G C        C+CP  + G  CE + D CL + C N  TC I   S   Y C CP  F G FC +DV+EC+  D   C++ ATC N +G Y+C
Sbjct:  264 CQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTC-IDGIS--DYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSC 358          

HSP 3 Score: 64.6994 bits (156), Expect = 1.493e-10
Identity = 44/132 (33.33%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  500 SFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS---CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            S  + +  KC K +   NC +  D C      LC+N G CI   +  +C CP  +TG FC+DD D C       C N +TC  +  S   Y CIC   + G  C  + ++C  +++C   ATCI+  G + C
Sbjct:  272 SNGLSYECKCPKGFEGKNCEQNYDDCLG---HLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGS---YSCICVNGWAGLDCSNNTDDCK-QAACFYGATCIDGVGSFYC 396          

HSP 4 Score: 62.7734 bits (151), Expect = 6.202e-10
Identity = 43/135 (31.85%), Postives = 61/135 (45.19%), Query Frame = 2
Query:  482 NSKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            N    L+    +   C K Y   +C+   D C       C+N G C+      SC C   + G  CE D + CL+  C N +TC     S   Y C CP+ F G  C  +  +C++ SSC +  +CI+   GYNC
Sbjct:  919 NGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASF---PCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNS---YTCTCPLGFSGINCQTNDEDCTE-SSCLNGGSCIDGINGYNC 1046          

HSP 5 Score: 60.4622 bits (145), Expect = 2.827e-9
Identity = 38/125 (30.40%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKL-KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   C + +  P C + I+ CE   +  C+N G C+       C C   +TG  CE D D C +N C+N+ TC      K+  +KC C + F G  C  ++++C  +  CR+   C ++  GY+C
Sbjct:  472 YRCNCSQGFTGPRCETNINECE---SHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCH----DKINGFKCSCALGFTGARCQINIDDCQSQ-PCRNRGICHDSIAGYSC 588          

HSP 6 Score: 59.3066 bits (142), Expect = 6.350e-9
Identity = 37/124 (29.84%), Postives = 63/124 (50.81%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  C   Y   +CSE ID C++   + C++NG C+       C C   +TG  CE + + C ++ C N  +C   P +   ++C+C   F GT C  D++EC   + C ++ TC +   G+ C
Sbjct:  433 YACSCATGYKGVDCSEDIDECDQ--GSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGT---FRCVCMPGFTGTQCEIDIDECQ-SNPCLNDGTCHDKINGFKC 550          

HSP 7 Score: 58.9214 bits (141), Expect = 8.509e-9
Identity = 39/124 (31.45%), Postives = 55/124 (44.35%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C   +   +CS   D C++     C     CI       C+C    TG  C  D D+C +N C  ++ C  SP +   Y C C   ++G  C ED++EC   S C  N  C+N  G Y C
Sbjct:  356 YSCICVNGWAGLDCSNNTDDCKQ---AACFYGATCIDGVGSFYCQCTKGKTGLLCHLD-DACTSNPCHADAICDTSPING-SYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRC 474          

HSP 8 Score: 55.8398 bits (133), Expect = 9.613e-8
Identity = 36/120 (30.00%), Postives = 53/120 (44.17%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C + Y    C  EID C+   +  C+N G C        C+C   + G  CE + D C  N C N  TC       + + C CP    G  C  + ++C    +C +N +CI+  GG+ C
Sbjct: 1171 CSQGYAGSYCQKEIDECQ---SQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCH---DRVMNFSCSCPPGTMGIICEINKDDCK-PGACHNNGSCIDRVGGFEC 1283          

HSP 9 Score: 54.299 bits (129), Expect = 2.430e-7
Identity = 31/99 (31.31%), Postives = 48/99 (48.48%), Query Frame = 2
Query:  587 TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++ C NNG CI +     CECP  +    C  D D C +N C+N   C+       ++ C CP  + G  C  D++ECS  + C+   TC +    ++C
Sbjct:  721 SSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCE---DGINEFICHCPPGYTGKRCELDIDECS-SNPCQHGGTCYDKLNAFSC 815          

HSP 10 Score: 53.9138 bits (128), Expect = 3.038e-7
Identity = 37/138 (26.81%), Postives = 58/138 (42.03%), Query Frame = 2
Query:  476 LTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKC--IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            L      L  + +++  C   Y    C   + C    ++ C+N   C  +   +  +C CP  +TGD C  D + C +N C    TC  +  S   Y+C+CP  + G  C      CS  S C++   C +N   Y C
Sbjct:  149 LNGGTCQLKTLEEYTCACANGYTGERCETKNLCA---SSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGS---YQCMCPTGYTGKDCDTKYKPCS-PSPCQNGGICRSNGLSYEC 279          

HSP 11 Score: 53.9138 bits (128), Expect = 3.117e-7
Identity = 33/107 (30.84%), Postives = 48/107 (44.86%), Query Frame = 2
Query:  503 FMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC 820
             +  +  +C++ +   NC   ID C       C+N G C  +    SC CP    G  CE +KD C   +C NN +C         ++C+C   F G  C  D+NEC
Sbjct: 1201 LIGAYECQCRQGFQGQNCELNIDDCAP---NPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGG---FECVCQPGFVGARCEGDINEC 1301          

HSP 12 Score: 51.6026 bits (122), Expect = 1.619e-6
Identity = 40/138 (28.99%), Postives = 61/138 (44.20%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            D+N   ++P    N      ++  ++  C   +   NC   D  E    + C N G CI      +C C + Y+G  C+   + C +N C+N +TC        +Y C CP  F G  C E V+ C  +S C + ATC
Sbjct:  984 DINECLSQPCQ--NGATCSQYVNSYTCTCPLGFSGINCQTND--EDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCH---EQNNEYTCHCPSGFTGKQCSEYVDWCG-QSPCENGATC 1113          

HSP 13 Score: 51.2174 bits (121), Expect = 2.185e-6
Identity = 40/129 (31.01%), Postives = 53/129 (41.09%), Query Frame = 2
Query:  500 SFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            S  + FS  C+  Y    C E ID C    ++ C+N   C+       C C   Y G  C  + D C +  C N  TC         Y C+C   F G  C  D+NEC  +  C++ ATC      Y C
Sbjct:  886 SNFLDFSCTCKLGYTGRYCDEDIDECSL--SSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIG---DYSCLCVDGFDGKHCETDINECLSQ-PCQNGATCSQYVNSYTC 1008          

HSP 14 Score: 51.2174 bits (121), Expect = 2.528e-6
Identity = 36/108 (33.33%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +I+ CE   +  C+ +G C  +     C+C +  +G  CE + + C +N C N +TC     S   YKC C   F G  C ++V+EC   S C +N  CI+   GY C
Sbjct:  639 QINECE---SNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINS---YKCQCVPGFTGQHCEKNVDECI-SSPCANNGVCIDQVNGYKC 739          

HSP 15 Score: 50.8322 bits (120), Expect = 2.950e-6
Identity = 33/102 (32.35%), Postives = 49/102 (48.04%), Query Frame = 2
Query:  524 KCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECS 823
            +CQ      NC E++   + ++  C N   CI       C+C   +TG  CE + D C+++ C NN  C  Q++      YKC CP  F    C  DV+EC+
Sbjct:  664 QCQAGTSGKNC-EVNV-NECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVN-----GYKCECPRGFYDAHCLSDVDECA 758          

HSP 16 Score: 50.0618 bits (118), Expect = 5.707e-6
Identity = 39/131 (29.77%), Postives = 56/131 (42.75%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLK-------YKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +    C   ID C+   +  C+N G C    A  SCECP  YTG  CE           IN + C  +P  + K       +KC+C   + G  C + +NEC + + C+ +  C +  G Y C
Sbjct:  548 FKCSCALGFTGARCQINIDDCQ---SQPCRNRGICHDSIAGYSCECPPGYTGTSCE-----------ININDCDSNPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINEC-ESNPCQFDGHCQDRVGSYYC 663          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Fly
Match: CG42255 (gene:FBgn0259140 transcript:FBtr0332131)

HSP 1 Score: 75.485 bits (184), Expect = 5.657e-14
Identity = 40/107 (37.38%), Postives = 50/107 (46.73%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN------NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC---SDKSSCRSNATCIN--NYGGYNC 883
            CKN G C   Y    CECP+ + GD CEDD + C        + C+NN  C  +P S   Y+C+C   F GT C    N C     +  C  + TCI   N  GY C
Sbjct:  163 CKNGGTCHDAYKGFQCECPAGWQGDSCEDDVNECFTLAGTDLDGCLNNGQCINTPGS---YRCVCRNGFTGTHCRLRHNTCLFGGSRELCGEHGTCIQAANSAGYVC 266          

HSP 2 Score: 60.4622 bits (145), Expect = 3.406e-9
Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFC 799
            C+NNG C+Q     +C C   Y+G  C +  D+C  + C+N  TC++ P +  KY+C+CP  + GT C
Sbjct:  432 CQNNGTCVQNGRGTTCICQPGYSGVVC-NSSDACHPSPCLNGGTCRLLPDA--KYQCVCPRGYTGTTC 496          

HSP 3 Score: 56.6102 bits (135), Expect = 4.416e-8
Identity = 27/71 (38.03%), Postives = 37/71 (52.11%), Query Frame = 2
Query:  686 KDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-----SDKSSCRSNATCINNYGGYNC 883
            ++ CL+N C N  TC  +      ++C CP  +QG  C +DVNEC     +D   C +N  CIN  G Y C
Sbjct:  155 RNECLSNPCKNGGTCHDAYKG---FQCECPAGWQGDSCEDDVNECFTLAGTDLDGCLNNGQCINTPGSYRC 222          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Fly
Match: uif (gene:FBgn0031879 transcript:FBtr0307072)

HSP 1 Score: 70.0922 bits (170), Expect = 3.378e-12
Identity = 34/96 (35.42%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C + GKC    + ++C CP++Y+G  C+ + D+C  + C N +TC  + A    Y C CP  F G  C +D+ +C D +SC   ATC++   G+ C
Sbjct: 2455 CMHGGKCQDFGSGLNCSCPADYSGIGCQYEYDACEEHVCQNGATCVDNGAG---YSCQCPPGFTGRNCEQDIVDCKD-NSCPPGATCVDLTNGFYC 2546          

HSP 2 Score: 64.6994 bits (156), Expect = 1.504e-10
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYN 880
            C++ G C+     I C CP+ ++G  CE D D C +  C N   C+  P     Y+C CP  + G  C E+ ++C +  +C + A C N  G  N
Sbjct: 2030 CQHGGLCVPMGHDIQCFCPAGFSGRRCEQDIDECASQPCYNGGQCKDLPQG---YRCECPAGYSGINCQEEASDCGN-DTCPARAMCKNEPGYKN 2120          

HSP 3 Score: 63.5438 bits (153), Expect = 3.472e-10
Identity = 33/109 (30.28%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  572 CEKLNTTL-----CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CE+  TT      C+N+  CI  +    C CPS   G  CE   + C+ + C++   CQ   +      C CP  + G  C  + + C ++  C++ ATC++N  GY+C
Sbjct: 2404 CEQQVTTCGAQAPCQNDASCIDLFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGKCQDFGSG---LNCSCPADYSGIGCQYEYDAC-EEHVCQNGATCVDNGAGYSC 2508          

HSP 4 Score: 62.003 bits (149), Expect = 1.037e-9
Identity = 37/126 (29.37%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNG--KCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS KC+  Y+  +C +EID C    +  C   G  +C+    K  C C   + G  C  D D C    C+NN  C+        ++C C   + G  C + V  C  ++ C+++A+CI+ +  Y C
Sbjct: 2313 FSCKCRPGYVGLSCEAEIDECL---SDPCNPVGTERCLDLDNKFECVCRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGG---FECGCEPGWSGMRCEQQVTTCGAQAPCQNDASCIDLFQDYFC 2432          

HSP 5 Score: 56.9954 bits (136), Expect = 3.440e-8
Identity = 39/131 (29.77%), Postives = 59/131 (45.04%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEI------DFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  +C   Y   NC E       D C      +CKN       Y  ++C C S YTGD C+   D C    N C N ++CQ     + +YKC C   ++G  C +++N+CS+ + C   A C +    + C
Sbjct: 2081 YRCECPAGYSGINCQEEASDCGNDTCPA--RAMCKNE----PGYKNVTCLCRSGYTGDQCDVTIDPCTANGNPCGNGASCQ--ALEQGRYKCECVPGWEGIHCEQNINDCSE-NPCLLGANCTDLVNDFQC 2202          

HSP 6 Score: 55.8398 bits (133), Expect = 8.699e-8
Identity = 34/124 (27.42%), Postives = 54/124 (43.55%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +    C + ID C    +  CK+ G C+ +     C C   +TG  C+ + D C N  C N  TC         Y C C   + G  C   +++C+  + C+  ATC++   G++C
Sbjct: 2200 FQCACPPGFTGKRCEQKIDLCL---SEPCKH-GTCVDRLFDHECVCHPGWTGSACDINIDDCENRPCANEGTCVDLVDG---YSCNCEPGYTGKNCQHTIDDCA-SNPCQHGATCVDQLDGFSC 2315          

HSP 7 Score: 54.6842 bits (130), Expect = 1.867e-7
Identity = 32/96 (33.33%), Postives = 43/96 (44.79%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDV 811
            C  DY    C  E D CE+    +C+N   C+   A  SC+CP  +TG  CE D   C +NSC   +TC         + C CP    G  C + +
Sbjct: 2472 CPADYSGIGCQYEYDACEE---HVCQNGATCVDNGAGYSCQCPPGFTGRNCEQDIVDCKDNSCPPGATCVDLTNG---FYCQCPFNMTGDDCRKAI 2561          

HSP 8 Score: 54.299 bits (129), Expect = 2.819e-7
Identity = 38/157 (24.20%), Postives = 59/157 (37.58%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC----------------QISPASKL---------------------KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +    C   ID CE      C N G C+      SC C   YTG  C+   D C +N C + +TC                 +S  +++                     K++C+C   F+G  C  D+++C +   C +N  C +  GG+ C
Sbjct: 2241 CHPGWTGSACDINIDDCE---NRPCANEGTCVDLVDGYSCNCEPGYTGKNCQHTIDDCASNPCQHGATCVDQLDGFSCKCRPGYVGLSCEAEIDECLSDPCNPVGTERCLDLDNKFECVCRDGFKGPLCATDIDDC-EAQPCLNNGICRDRVGGFEC 2393          

HSP 9 Score: 50.0618 bits (118), Expect = 5.378e-6
Identity = 26/96 (27.08%), Postives = 44/96 (45.83%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C     C        C CP  +TG  CE   D CL+  C  + TC         ++C+C   + G+ C  ++++C ++  C +  TC++   GY+C
Sbjct: 2187 CLLGANCTDLVNDFQCACPPGFTGKRCEQKIDLCLSEPC-KHGTCV---DRLFDHECVCHPGWTGSACDINIDDCENR-PCANEGTCVDLVDGYSC 2277          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Fly
Match: uif (gene:FBgn0031879 transcript:FBtr0302162)

HSP 1 Score: 70.0922 bits (170), Expect = 3.378e-12
Identity = 34/96 (35.42%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C + GKC    + ++C CP++Y+G  C+ + D+C  + C N +TC  + A    Y C CP  F G  C +D+ +C D +SC   ATC++   G+ C
Sbjct: 2455 CMHGGKCQDFGSGLNCSCPADYSGIGCQYEYDACEEHVCQNGATCVDNGAG---YSCQCPPGFTGRNCEQDIVDCKD-NSCPPGATCVDLTNGFYC 2546          

HSP 2 Score: 64.6994 bits (156), Expect = 1.504e-10
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYN 880
            C++ G C+     I C CP+ ++G  CE D D C +  C N   C+  P     Y+C CP  + G  C E+ ++C +  +C + A C N  G  N
Sbjct: 2030 CQHGGLCVPMGHDIQCFCPAGFSGRRCEQDIDECASQPCYNGGQCKDLPQG---YRCECPAGYSGINCQEEASDCGN-DTCPARAMCKNEPGYKN 2120          

HSP 3 Score: 63.5438 bits (153), Expect = 3.472e-10
Identity = 33/109 (30.28%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  572 CEKLNTTL-----CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CE+  TT      C+N+  CI  +    C CPS   G  CE   + C+ + C++   CQ   +      C CP  + G  C  + + C ++  C++ ATC++N  GY+C
Sbjct: 2404 CEQQVTTCGAQAPCQNDASCIDLFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGKCQDFGSG---LNCSCPADYSGIGCQYEYDAC-EEHVCQNGATCVDNGAGYSC 2508          

HSP 4 Score: 62.003 bits (149), Expect = 1.037e-9
Identity = 37/126 (29.37%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNG--KCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS KC+  Y+  +C +EID C    +  C   G  +C+    K  C C   + G  C  D D C    C+NN  C+        ++C C   + G  C + V  C  ++ C+++A+CI+ +  Y C
Sbjct: 2313 FSCKCRPGYVGLSCEAEIDECL---SDPCNPVGTERCLDLDNKFECVCRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGG---FECGCEPGWSGMRCEQQVTTCGAQAPCQNDASCIDLFQDYFC 2432          

HSP 5 Score: 56.9954 bits (136), Expect = 3.440e-8
Identity = 39/131 (29.77%), Postives = 59/131 (45.04%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEI------DFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  +C   Y   NC E       D C      +CKN       Y  ++C C S YTGD C+   D C    N C N ++CQ     + +YKC C   ++G  C +++N+CS+ + C   A C +    + C
Sbjct: 2081 YRCECPAGYSGINCQEEASDCGNDTCPA--RAMCKNE----PGYKNVTCLCRSGYTGDQCDVTIDPCTANGNPCGNGASCQ--ALEQGRYKCECVPGWEGIHCEQNINDCSE-NPCLLGANCTDLVNDFQC 2202          

HSP 6 Score: 55.8398 bits (133), Expect = 8.699e-8
Identity = 34/124 (27.42%), Postives = 54/124 (43.55%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +    C + ID C    +  CK+ G C+ +     C C   +TG  C+ + D C N  C N  TC         Y C C   + G  C   +++C+  + C+  ATC++   G++C
Sbjct: 2200 FQCACPPGFTGKRCEQKIDLCL---SEPCKH-GTCVDRLFDHECVCHPGWTGSACDINIDDCENRPCANEGTCVDLVDG---YSCNCEPGYTGKNCQHTIDDCA-SNPCQHGATCVDQLDGFSC 2315          

HSP 7 Score: 54.6842 bits (130), Expect = 1.867e-7
Identity = 32/96 (33.33%), Postives = 43/96 (44.79%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDV 811
            C  DY    C  E D CE+    +C+N   C+   A  SC+CP  +TG  CE D   C +NSC   +TC         + C CP    G  C + +
Sbjct: 2472 CPADYSGIGCQYEYDACEE---HVCQNGATCVDNGAGYSCQCPPGFTGRNCEQDIVDCKDNSCPPGATCVDLTNG---FYCQCPFNMTGDDCRKAI 2561          

HSP 8 Score: 54.299 bits (129), Expect = 2.819e-7
Identity = 38/157 (24.20%), Postives = 59/157 (37.58%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC----------------QISPASKL---------------------KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +    C   ID CE      C N G C+      SC C   YTG  C+   D C +N C + +TC                 +S  +++                     K++C+C   F+G  C  D+++C +   C +N  C +  GG+ C
Sbjct: 2241 CHPGWTGSACDINIDDCE---NRPCANEGTCVDLVDGYSCNCEPGYTGKNCQHTIDDCASNPCQHGATCVDQLDGFSCKCRPGYVGLSCEAEIDECLSDPCNPVGTERCLDLDNKFECVCRDGFKGPLCATDIDDC-EAQPCLNNGICRDRVGGFEC 2393          

HSP 9 Score: 50.0618 bits (118), Expect = 5.378e-6
Identity = 26/96 (27.08%), Postives = 44/96 (45.83%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C     C        C CP  +TG  CE   D CL+  C  + TC         ++C+C   + G+ C  ++++C ++  C +  TC++   GY+C
Sbjct: 2187 CLLGANCTDLVNDFQCACPPGFTGKRCEQKIDLCLSEPC-KHGTCV---DRLFDHECVCHPGWTGSACDINIDDCENR-PCANEGTCVDLVDGYSC 2277          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 77.411 bits (189), Expect = 1.929e-14
Identity = 41/124 (33.06%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  C+  Y    C ++ID C+    T C N G C       SC CP  +TG  CE D + CL+N C N + CQ  P     + C+C   F G  C   +N C + + C +  +C N   GY C
Sbjct: 3395 YACNCRPGYAGALCETDIDECQP---TPCHNGGTCHNLVGGFSCTCPDGFTGMACERDVNECLSNPCQNGALCQNYPGG---FNCLCKSGFAGKACDSVINYC-ECNPCFNGGSCQNRVEGYYC 3511          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 77.411 bits (189), Expect = 1.929e-14
Identity = 41/124 (33.06%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  C+  Y    C ++ID C+    T C N G C       SC CP  +TG  CE D + CL+N C N + CQ  P     + C+C   F G  C   +N C + + C +  +C N   GY C
Sbjct: 3401 YACNCRPGYAGALCETDIDECQP---TPCHNGGTCHNLVGGFSCTCPDGFTGMACERDVNECLSNPCQNGALCQNYPGG---FNCLCKSGFAGKACDSVINYC-ECNPCFNGGSCQNRVEGYYC 3517          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 76.6406 bits (187), Expect = 3.859e-14
Identity = 41/124 (33.06%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  C+  Y    C ++ID C+    T C N G C       SC CP  +TG  CE D + CL+N C N + CQ  P     + C+C   F G  C   +N C + + C +  +C N   GY C
Sbjct: 2004 YACNCRPGYAGALCETDIDECQP---TPCHNGGTCHNLVGGFSCTCPDGFTGMACERDVNECLSNPCQNGALCQNYPGG---FNCLCKSGFAGKACDSVINYC-ECNPCFNGGSCQNRVEGYYC 2120          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Zebrafish
Match: notch1a (notch receptor 1a [Source:NCBI gene;Acc:30718])

HSP 1 Score: 74.7146 bits (182), Expect = 1.181e-13
Identity = 41/124 (33.06%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +    C+E ID C    +  C+N G C       +C CP+ ++G  CE +   C  +SC N  TC    +S   + C+C   F G +C  DVNEC D   C++  +C + YG Y C
Sbjct:  145 FVCVCLAGFRGERCAEDIDECV---SAPCRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISS---FSCVCLPGFTGNYCQHDVNEC-DSRPCQNGGSCQDGYGTYKC 261          

HSP 2 Score: 66.2402 bits (160), Expect = 5.394e-11
Identity = 39/113 (34.51%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  548 PNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            PNC   I+ C    +  C N G CI   A   C C   YTG+ CE+    C    C N   C+ S   +  + C CP  +QG  C  D+NEC  ++ C +   C N  GG+ C
Sbjct:    2 PNCQMNINECA---SNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQ-SFSCNCPAGWQGQTCEVDINECV-RNPCTNGGVCENLRGGFQC 109          

HSP 3 Score: 65.855 bits (159), Expect = 9.226e-11
Identity = 39/123 (31.71%), Postives = 52/123 (42.28%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C E+D  E +    C N G C        C C   +TG  CE+D D C  N C N   CQ        + C+C   F+G  C ED++EC   + CR+   C +    Y C
Sbjct:   69 FSCNCPAGWQGQTC-EVDINECVRNP-CTNGGVCENLRGGFQCRCNPGFTGALCENDIDDCEPNPCSNGGVCQDRVNG---FVCVCLAGFRGERCAEDIDECV-SAPCRNGGNCTDCVNSYTC 185          

HSP 4 Score: 63.1586 bits (152), Expect = 5.720e-10
Identity = 33/113 (29.20%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  545 SPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +P+C+E         + C N G C+   +  SC C   +TG++C+ D + C +  C N  +CQ    +   YKC CP  + G  C   V  C D S C++  +C      + C
Sbjct:  200 TPDCTE---------SSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSCQDGYGT---YKCTCPHGYTGLNCQSLVRWC-DSSPCKNGGSCWQQGASFTC 299          

HSP 5 Score: 62.7734 bits (151), Expect = 7.874e-10
Identity = 31/97 (31.96%), Postives = 48/97 (49.48%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC++ G+C+       C C + YTG +C++  D C  N C N +TC         Y C C   + G  C +++NEC  +  C++  TCI+    Y C
Sbjct:  331 LCRHAGQCVDAGNTHLCRCQAGYTGSYCQEQVDECQPNPCQNGATCTDYLGG---YSCECVPGYHGMNCSKEINECLSQ-PCQNGGTCIDLVNTYKC 423          

HSP 6 Score: 62.3882 bits (150), Expect = 8.886e-10
Identity = 40/134 (29.85%), Postives = 65/134 (48.51%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   C   Y   NC S + +C+   ++ CKN G C Q+ A  +C+C S +TG +C+    SC          +   C +   C  +  + L   C C   + G++C E V+EC   + C++ ATC +  GGY+C
Sbjct:  259 YKCTCPHGYTGLNCQSLVRWCD---SSPCKNGGSCWQQGASFTCQCASGWTGIYCDVPSVSCEVAARQQGVSVAVLCRHAGQCVDAGNTHL---CRCQAGYTGSYCQEQVDECQ-PNPCQNGATCTDYLGGYSC 385          

HSP 7 Score: 58.151 bits (139), Expect = 1.788e-8
Identity = 29/90 (32.22%), Postives = 42/90 (46.67%), Query Frame = 2
Query:  614 CIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+Q      CEC + YTG  CE   + C +  C N  TC ++  +K  Y C C   + G+ C  D   C     CR+ ATC++ +    C
Sbjct:  500 CVQLINDFRCECRTGYTGKRCETVFNGCKDTPCKNGGTCAVASNTKHGYICKCQPGYSGSSCEYDSQSCG-SLRCRNGATCVSGHLSPRC 588          

HSP 8 Score: 56.225 bits (134), Expect = 7.156e-8
Identity = 42/133 (31.58%), Postives = 52/133 (39.10%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNN--------SCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            +S +C   Y   NCS EI+ C    +  C+N G CI       C CP    G  CE D D C  +         C N   C         Y C+CP  F G  C  DVNEC SD      +  C+     + C
Sbjct:  383 YSCECVPGYHGMNCSKEINECL---SQPCQNGGTCIDLVNTYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGG---YGCVCPAGFVGERCEGDVNECLSDPCDPSGSYNCVQLINDFRC 509          

HSP 9 Score: 56.225 bits (134), Expect = 8.072e-8
Identity = 37/110 (33.64%), Postives = 50/110 (45.45%), Query Frame = 2
Query:  479 TNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDS-CLNNSCINNSTCQISPASKLK-YKCICPIYFQGTFCH 802
            +N+KH       +  KCQ  Y   +C E D  +   +  C+N   C+  +    C C   ++G  C+   DS CL N C N  TCQ  P S    Y+C CP  F G  CH
Sbjct:  542 SNTKHG------YICKCQPGYSGSSC-EYD-SQSCGSLRCRNGATCVSGHLSPRCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQ--PISDAPFYRCSCPANFNGLLCH 641          

HSP 10 Score: 51.6026 bits (122), Expect = 2.389e-6
Identity = 42/154 (27.27%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEI-DFCEKLNTTLCKNNGKCI----QKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC--INNYGGYNC 883
            D+N   + P   + S + +  +  F  +C+  Y    C  + + C+    T CKN G C      K+  I C+C   Y+G  CE D  SC +  C N +TC    +  L  +C+C   F G  C   ++     + C +  TC  I++   Y C
Sbjct:  483 DVNECLSDPCDPSGSYNCVQLINDFRCECRTGYTGKRCETVFNGCKD---TPCKNGGTCAVASNTKHGYI-CKCQPGYSGSSCEYDSQSCGSLRCRNGATCV---SGHLSPRCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQPISDAPFYRC 629          

HSP 11 Score: 51.6026 bits (122), Expect = 2.430e-6
Identity = 28/99 (28.28%), Postives = 45/99 (45.45%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCI---NNYGGYNC 883
            C N G+C+ +     C CP+ + G+ CE D + CL++ C  + +          ++C C   + G  C    N C D + C++  TC    N   GY C
Sbjct:  454 CFNGGRCVDRVGGYGCVCPAGFVGERCEGDVNECLSDPCDPSGSYNCVQLIN-DFRCECRTGYTGKRCETVFNGCKD-TPCKNGGTCAVASNTKHGYIC 550          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Zebrafish
Match: notch3 (notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-5])

HSP 1 Score: 72.0182 bits (175), Expect = 8.993e-13
Identity = 42/123 (34.15%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C EID  E L+   C+N+  C+ +  + +C C   Y G +CE D D C +N C+N+  C+        + C C   F GT C  D++EC+  + C++ A CI+   GY C
Sbjct:  391 FQCQCGRGYTGPRC-EIDINECLSMP-CQNDATCLDRIGEFTCICMPGYQGKYCEVDIDECESNPCVNDGICR---DMVNGFTCTCQPGFTGTMCQIDIDECA-STPCQNGAKCIDRPNGYEC 507          

HSP 2 Score: 62.7734 bits (151), Expect = 6.868e-10
Identity = 46/156 (29.49%), Postives = 71/156 (45.51%), Query Frame = 2
Query:  422 TVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            T ++   D+N    +P    N     + +   +  C   +   +CSE ID C    T +C N   C  + A   CECP   TG  C  D D+C++N C   + C  +P +  +  C CP  F G  C++D++ECS   + C     C+N  G + C
Sbjct:  243 TGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCA---TAVCFNGATCHDRVASFFCECPVGKTGLLCHLD-DACVSNPCNEGAVCDTNPLNG-RAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQC 393          

HSP 3 Score: 61.6178 bits (148), Expect = 1.641e-9
Identity = 45/162 (27.78%), Postives = 62/162 (38.27%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQIS-------------------------PASKL-----------KYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
             ++  C   Y   NC ++ID C K     C N G C+  +    CEC + Y+G  CE     C  + C+N  TC  +                         P  K             Y C CP  + G +C EDVNEC    ++C +  TC N  GG+ C
Sbjct:  117 HYNCSCPPGYQGKNCRNDIDECRKPGK--CLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQTGDHTYECACLPGFRGHNCEDNVDDCPGHKCMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTC 276          

HSP 4 Score: 60.4622 bits (145), Expect = 3.851e-9
Identity = 50/203 (24.63%), Postives = 78/203 (38.42%), Query Frame = 2
Query:  422 TVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCE------------------------------------------------CPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            T ++  +++N  +++P    N       M  +   C K Y  P C   +D+C   N   CKN G+C QK A  +C+                                                CP++YTG +CE   D C    C+N +TC+   +    + C C   ++G  C  +VNEC     C++  TCI+  G Y C
Sbjct:  969 TGDYCQYEVNECDSQP--CLNGGICQDAMESYRCSCPKGYTGPRCQYPVDWCRPSNP--CKNGGRCRQKDASFTCDCLGGWSGRYCDIPGVSCEVAARQRGRQTDELCLHGGHCVNTGNTHYCKCPADYTGSYCESQFDHCEEKPCLNGATCR---SYMGGFTCDCMPGYEGNNCEREVNECQSH-PCQNGGTCIDLVGHYIC 1163          

HSP 5 Score: 56.9954 bits (136), Expect = 5.455e-8
Identity = 39/115 (33.91%), Postives = 50/115 (43.48%), Query Frame = 2
Query:  500 SFMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS-------CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC 820
            S+M  F+  C   Y   NC  E++ C+   +  C+N G CI       C CP    G  CE ++D C   S       C NN TC         Y+C CP  F G  C  D+NEC
Sbjct: 1118 SYMGGFTCDCMPGYEGNNCEREVNECQ---SHPCQNGGTCIDLVGHYICSCPPGTLGVLCEINEDDCATPSWPRGMPKCQNNGTCVDRVGG---YRCNCPPGFTGERCEGDINEC 1226          

HSP 6 Score: 56.9954 bits (136), Expect = 5.502e-8
Identity = 36/122 (29.51%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C++ +D C  +    C++ GKC+       C+C   YTG  CE D + CL+  C N++TC  +I      ++ CIC   +QG +C  D++EC + + C ++  C +   G+ C
Sbjct:  355 CPAGFVGGACNQDMDEC-SIGANPCEHFGKCVNTEGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIG-----EFTCICMPGYQGKYCEVDIDEC-ESNPCVNDGICRDMVNGFTC 469          

HSP 7 Score: 55.4546 bits (132), Expect = 1.504e-7
Identity = 36/125 (28.80%), Postives = 58/125 (46.40%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++   C+  +  P C  EID C+   +  C+N G C+       C+CP  +   +C    D C +N C+ + TC+  P     Y+C C   + G  C  D N+C   S C++  TC +   G+ C
Sbjct:  616 RYECVCKPGFTGPQCKDEIDECQ---SNPCRNGGTCVDDENGFHCQCPEGFHDPYCYSQVDECASNPCL-HGTCRDDPNG---YRCDCEPGWVGKNCDLDRNDCL-PSPCQNAGTCFDQLNGFTC 732          

HSP 8 Score: 53.9138 bits (128), Expect = 3.935e-7
Identity = 37/124 (29.84%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +    C+ E++ C+ +    CKN G C       +C C   +TG  CE +   C  +SC N  TC         +KC C   F G +C  +VNEC D   C +   C +    Y C
Sbjct:  884 FRCSCLPGFTGARCATELNECQSV---PCKNGGTCTDYVNSYTCTCKPGFTGLLCETNVPDCTESSCFNGGTCT---DGINGFKCTCRTGFTGDYCQYEVNEC-DSQPCLNGGICQDAMESYRC 1000          

HSP 9 Score: 53.5286 bits (127), Expect = 6.045e-7
Identity = 32/96 (33.33%), Postives = 43/96 (44.79%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CKN G C        C C + YTG  CE D + C  N C+N  +C     S   ++C C   F G  C  ++NEC     C++  TC +    Y C
Sbjct:  833 CKNRGTCTNTLGGYVCSCRAGYTGPNCETDINDCSPNPCLNGGSCTDGVNS---FRCSCLPGFTGARCATELNECQ-SVPCKNGGTCTDYVNSYTC 924          

HSP 10 Score: 53.1434 bits (126), Expect = 8.305e-7
Identity = 39/160 (24.38%), Postives = 69/160 (43.12%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC----------------------QISPASK---------------LKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   C+  ++  NC ++D  + L  + C+N G C  +    +C+C   + G+ C+ + + C ++ C+N  TC                       ++P S                L Y+C C   +QG  C+ D+NEC+  + C++  TC N  GGY C
Sbjct:  692 YRCDCEPGWVGKNC-DLDRNDCL-PSPCQNAGTCFDQLNGFTCKCRQGFRGNLCQVNINECASSPCLNQGTCVDGVASFTCLCEPPYSGPTCAELLTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQGHLCNNDINECT-SNPCKNRGTCTNTLGGYVC 848          

HSP 11 Score: 52.7582 bits (125), Expect = 9.776e-7
Identity = 38/160 (23.75%), Postives = 60/160 (37.50%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFC------------------------------------EKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            Q++  CQ+ +   +CS +D C                                    E      C N G C+  +    CEC + Y+G  CE     C  + C+N  TC  +      Y+C C   F+G  C ++V++C     C +N  C++    YNC
Sbjct:   80 QYTCVCQRGFRGQDCSLVDACATSPCANGARCTNWNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGSFRCECLTGYSGRTCEVPTQPCAPSQCLNGGTCHQT--GDHTYECACLPGFRGHNCEDNVDDCPGH-KCMNNGICVDGVNTYNC 236          

HSP 12 Score: 51.9878 bits (123), Expect = 1.594e-6
Identity = 31/98 (31.63%), Postives = 52/98 (53.06%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C NNG C+      +C+CP E+TG +C +D + CL   N+C N  TC  +      + C+C   + G  C E++++C+  + C + ATC +    + C
Sbjct:  221 CMNNGICVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGG---HTCVCVNGWTGDDCSENIDDCA-TAVCFNGATCHDRVASFFC 314          

HSP 13 Score: 51.6026 bits (122), Expect = 1.993e-6
Identity = 35/134 (26.12%), Postives = 54/134 (40.30%), Query Frame = 2
Query:  491 HNLSFMIQFSMKCQKDYLSPNCSEIDFCEK---LNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
             N    I     C+  Y+   C  +D C +   LN   CK+  +      + +C C   + G  C    D+C  + C N + C         Y C CP  +QG  C  D++EC     C +   C+N +G + C
Sbjct:   32 ENGGMCIDSRCLCRPGYIGSLCQHLDPCHRSPCLNAAACKS--QVANSIPQYTCVCQRGFRGQDCSL-VDACATSPCANGARCT---NWNNHYNCSCPPGYQGKNCRNDIDECRKPGKCLNGGICMNTHGSFRC 159          

HSP 14 Score: 50.8322 bits (120), Expect = 3.758e-6
Identity = 33/128 (25.78%), Postives = 54/128 (42.19%), Query Frame = 2
Query:  506 MIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQK--YAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  F+  C+  Y  P C+E+      +   C N+  C+    Y    C C   + G  C +D + C +N C N  TC  +      Y C C   + G  C  D+N+CS  + C +  +C +    + C
Sbjct:  765 VASFTCLCEPPYSGPTCAEL--LTPCSPNPCANHASCVHTPDYLGYQCNCQPGWQGHLCNNDINECTSNPCKNRGTCTNTLGG---YVCSCRAGYTGPNCETDINDCS-PNPCLNGGSCTDGVNSFRC 886          

HSP 15 Score: 50.0618 bits (118), Expect = 7.211e-6
Identity = 36/145 (24.83%), Postives = 52/145 (35.86%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNN----------------------------------------SCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVN----ECSDKSSCR-----SNATCINNYGGYNC 883
            C+NNG C+ +     C CP  +TG+ CE D + CL+N                                         C N   C +S +S   Y C C + + G+ C   +N     C +  SC      +  TCI  +GG  C
Sbjct: 1193 CQNNGTCVDRVGGYRCNCPPGFTGERCEGDINECLSNPCNPSNSLDCIQLPNDYQCVCKPGFTGRGCQSRFSVCESQPCKNGGVCSLSGSSPPGYSCTCQLGYAGSNCERSMNCKELPCYNGGSCTLTTRGARCTCIQGFGGPLC 1337          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Xenopus
Match: SNED1 (sushi, nidogen and EGF-like domains 1 [Source:NCBI gene;Acc:100498350])

HSP 1 Score: 78.9518 bits (193), Expect = 7.471e-15
Identity = 43/114 (37.72%), Postives = 59/114 (51.75%), Query Frame = 2
Query:  542 LSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            L P C EID C    +  C N   C  + +   CEC   Y+G +CE + + CL+  C N  TCQ  P +   +KCICP  F G++C  +V+ C D S C++   C N  G Y C
Sbjct:  714 LPPECEEIDECA---SHPCHNGASCKDRISHFICECQKGYSGKYCEQETNECLSQPCKNGGTCQDLPGT---FKCICPEGFTGSYCETEVDGC-DSSPCQNGGLCENLAGSYLC 820          

HSP 2 Score: 56.6102 bits (135), Expect = 8.866e-8
Identity = 44/135 (32.59%), Postives = 58/135 (42.96%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHED-----VNECSDKSSCRSNA------TCINNYGGYNC 883
             F  +CQK Y    C E +  E L+   CKN G C        C CP  +TG +CE + D C ++ C N   C+    S   Y C+CP  F G  C        +N C ++  C S+A      TC   Y G  C
Sbjct:  741 HFICECQKGYSGKYC-EQETNECLSQP-CKNGGTCQDLPGTFKCICPEGFTGSYCETEVDGCDSSPCQNGGLCENLAGS---YLCVCPRGFFGYHCQTVSDMCLLNPCGNRGVCVSSADGLMSCTCRTGYTGTMC 870          

HSP 3 Score: 53.5286 bits (127), Expect = 6.831e-7
Identity = 36/117 (30.77%), Postives = 54/117 (46.15%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKD---SCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINN 865
            CQ+ Y   NC +E+  C   +++ C N G C    A   C+C   +TG  CE  ++   +C ++ C+NN  C+ +      Y C CP  F G  C   V   SD   CR+   C + 
Sbjct:  370 CQRGYTGDNCDTELLPC---SSSPCLNGGSCENIDAGFRCQCALGFTGTHCEKGENKPSACFSSPCMNNGVCKDAEGG---YLCDCPAGFSGMHCEHRV---SDDCPCRNGGRCADG 477          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Xenopus
Match: SNED1 (sushi, nidogen and EGF-like domains 1 [Source:NCBI gene;Acc:100498350])

HSP 1 Score: 78.9518 bits (193), Expect = 7.671e-15
Identity = 43/114 (37.72%), Postives = 59/114 (51.75%), Query Frame = 2
Query:  542 LSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            L P C EID C    +  C N   C  + +   CEC   Y+G +CE + + CL+  C N  TCQ  P +   +KCICP  F G++C  +V+ C D S C++   C N  G Y C
Sbjct:  713 LPPECEEIDECA---SHPCHNGASCKDRISHFICECQKGYSGKYCEQETNECLSQPCKNGGTCQDLPGT---FKCICPEGFTGSYCETEVDGC-DSSPCQNGGLCENLAGSYLC 819          

HSP 2 Score: 56.6102 bits (135), Expect = 7.927e-8
Identity = 44/135 (32.59%), Postives = 58/135 (42.96%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHED-----VNECSDKSSCRSNA------TCINNYGGYNC 883
             F  +CQK Y    C E +  E L+   CKN G C        C CP  +TG +CE + D C ++ C N   C+    S   Y C+CP  F G  C        +N C ++  C S+A      TC   Y G  C
Sbjct:  740 HFICECQKGYSGKYC-EQETNECLSQP-CKNGGTCQDLPGTFKCICPEGFTGSYCETEVDGCDSSPCQNGGLCENLAGS---YLCVCPRGFFGYHCQTVSDMCLLNPCGNRGVCVSSADGLMSCTCRTGYTGTMC 869          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Xenopus
Match: SNED1 (sushi, nidogen and EGF-like domains 1 [Source:NCBI gene;Acc:100498350])

HSP 1 Score: 78.9518 bits (193), Expect = 8.191e-15
Identity = 43/114 (37.72%), Postives = 59/114 (51.75%), Query Frame = 2
Query:  542 LSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            L P C EID C    +  C N   C  + +   CEC   Y+G +CE + + CL+  C N  TCQ  P +   +KCICP  F G++C  +V+ C D S C++   C N  G Y C
Sbjct:  710 LPPECEEIDECA---SHPCHNGASCKDRISHFICECQKGYSGKYCEQETNECLSQPCKNGGTCQDLPGT---FKCICPEGFTGSYCETEVDGC-DSSPCQNGGLCENLAGSYLC 816          

HSP 2 Score: 56.225 bits (134), Expect = 9.720e-8
Identity = 43/138 (31.16%), Postives = 57/138 (41.30%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTL---CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHED-----VNECSDKSSCRSNA------TCINNYGGYNC 883
             F  +CQK Y    C +     + N  L   CKN G C        C CP  +TG +CE + D C ++ C N   C+    S   Y C+CP  F G  C        +N C ++  C S+A      TC   Y G  C
Sbjct:  737 HFICECQKGYSGKYCEQ-----ETNECLSQPCKNGGTCQDLPGTFKCICPEGFTGSYCETEVDGCDSSPCQNGGLCENLAGS---YLCVCPRGFFGYHCQTVSDMCLLNPCGNRGVCVSSADGLMSCTCRTGYTGTMC 866          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Xenopus
Match: NOTCH3 (notch 3 [Source:NCBI gene;Acc:100494244])

HSP 1 Score: 77.411 bits (189), Expect = 2.799e-14
Identity = 37/119 (31.09%), Postives = 59/119 (49.58%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +    C +  FC  L    C++ G+C+       C+C   YTG  CE D + CL+  C N++TC        ++ CIC   F G+ C  D++EC+  + C++ A C++   GY C
Sbjct:  342 CPPGFTGGACDQDSFCMSLCANPCEHFGRCVNTQGSFQCQCGRGYTGPRCETDVNECLSTPCQNDATCLDRIG---EFTCICMAGFTGSMCQIDIDECA-STPCKNGAKCVDRPNGYEC 456          

HSP 2 Score: 72.7886 bits (177), Expect = 7.662e-13
Identity = 40/124 (32.26%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +++  C   Y   +C  +D  E     LC+N G+C+       C CPS YTG FCE     C  + C N  TC+      L Y+C C   F+G  C  +V++C     C +  TC++    YNC
Sbjct:  104 RYNCTCPPGYQGRSC-RVDIDECRTPGLCQNGGQCVNTPGSFRCRCPSGYTGQFCEAIYVPCAPSQCQNGGTCR--QTGDLTYQCACLPGFEGPNCEINVDDCPGH-KCMNGGTCVDGVNTYNC 223          

HSP 3 Score: 63.5438 bits (153), Expect = 6.301e-10
Identity = 37/101 (36.63%), Postives = 46/101 (45.54%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKS-----SCRSNATCINNYGGYNC 883
            C N G C        CECPS Y G  CE D + C ++ C N  TC        +Y C CP    G  C  + ++CS  S      C +N TCI+  GGY C
Sbjct: 1018 CHNGGACHSYLGGYVCECPSGYEGKNCEYDINECQSHPCQNGGTCIDLIG---RYICSCPPGTLGVLCEINEDDCSPLSISGPPKCLNNGTCIDKVGGYRC 1115          

HSP 4 Score: 62.003 bits (149), Expect = 2.055e-9
Identity = 43/139 (30.94%), Postives = 63/139 (45.32%), Query Frame = 2
Query:  524 KCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTG----------DF--------CEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +C+  +  P C  +ID C    +  C N GKC+   A  SC C   YTG          DF        CE   D C  + C N   C  +P  +  + C C   ++G  C +D++EC+ +S C++   C N  GGY+C
Sbjct:  666 RCRDGFRGPTCMIDIDECA---SAPCLNGGKCMDGIAGYSCLCTLPYTGMWWKRKQQIADFIFQPPGQKCETILDPCAPDPCHNGGICSPTPDYE-SHMCQCSPGWRGETCDDDIDECA-RSPCKNGGFCTNMQGGYSC 799          

HSP 5 Score: 60.4622 bits (145), Expect = 6.035e-9
Identity = 49/154 (31.82%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKC---IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNE---------CSDKSSCRSNATCINN 865
            D+N   + P H  N++H +     +   C+  Y    C S ++ CE   +  C+N G C   +      +C CP  +TG  CE    SC   SC + STC   P   L  +CICP    G  C    N          CS+ S CR+ ATCI N
Sbjct: 1129 DINECLSGPCHAQNTRHCVQLANDYQCVCKSGYTGRRCQSVMNTCE---SRPCQNGGVCSVTVNTPLGYTCRCPLGFTGPSCERPPLSCRELSCPSGSTCLPPP---LGPRCICP---PGVLCRTPNNSSAPTPAPLPCSN-SPCRNGATCIPN 1272          

HSP 6 Score: 59.6918 bits (143), Expect = 8.970e-9
Identity = 33/99 (33.33%), Postives = 46/99 (46.46%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC---INNYGGYNC 883
            C NNG CI K     C CP  YTG+ CE D + CL+  C   +T      +   Y+C+C   + G  C   +N C  +  C++   C   +N   GY C
Sbjct: 1100 CLNNGTCIDKVGGYRCNCPPGYTGERCEGDINECLSGPCHAQNTRHCVQLAN-DYQCVCKSGYTGRRCQSVMNTCESR-PCQNGGVCSVTVNTPLGYTC 1196          

HSP 7 Score: 59.3066 bits (142), Expect = 1.440e-8
Identity = 35/130 (26.92%), Postives = 57/130 (43.85%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   Y    C   +D C +   + C+N G+C Q      CECP+ + G +C+  + SC           +  C +   C  + +S   + CIC   + G++C   +N+C D   C +   C +  GGY C
Sbjct:  911 CPYGYTGAQCQNLVDLCRR---SPCQNGGRCTQTGPSFRCECPAGWAGSYCDVPRVSCEVAAARRNVRADQLCHSGGICMNAGSS---HHCICRGGYTGSYCENPINQC-DPDPCHNGGACHSYLGGYVC 1033          

HSP 8 Score: 58.9214 bits (141), Expect = 1.696e-8
Identity = 35/128 (27.34%), Postives = 59/128 (46.09%), Query Frame = 2
Query:  509 IQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + +   C   +  PNC   +D C       C N G C+      +C+C  E+TG +C +D D C    N+C N  TC  +      + C+C   + G  C E++++C+  + C + ATC +    + C
Sbjct:  181 LTYQCACLPGFEGPNCEINVDDCPGHK---CMNGGTCVDGVNTYNCQCAPEWTGQYCTEDVDECQLQPNACHNGGTCFNTQGG---HTCVCVNGWTGESCSENIDDCA-TAVCFNGATCHDRVASFYC 301          

HSP 9 Score: 58.151 bits (139), Expect = 2.795e-8
Identity = 36/121 (29.75%), Postives = 54/121 (44.63%), Query Frame = 2
Query:  524 KCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +C   +    C + ID C +   + CKN G C       SC C S + G  CE D + C  N C+N   C+    S   + C C   F G+ C +++N+     SC +  TC++    Y C
Sbjct:  762 QCSPGWRGETCDDDIDECAR---SPCKNGGFCTNMQGGYSCACLSGFNGQDCETDINDCNPNPCLNGGACKDGINS---FACSCIPGFTGSRCTDEIND-----SCFNGGTCVDGVNSYTC 871          

HSP 10 Score: 56.6102 bits (135), Expect = 8.926e-8
Identity = 35/116 (30.17%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCH-EDV---NECSDKSSCRSN 847
            ++ +C  ++    C+E +D C+ L    C N G C       +C C + +TG+ C ++ D C    C N +TC    AS   + C CP+   G  CH ED    N C   + C +N
Sbjct:  221 YNCQCAPEWTGQYCTEDVDECQ-LQPNACHNGGTCFNTQGGHTCVCVNGWTGESCSENIDDCATAVCFNGATCHDRVAS---FYCECPMGKTGLLCHLEDACVSNPCHKDAMCDTN 332          

HSP 11 Score: 56.225 bits (134), Expect = 1.314e-7
Identity = 32/123 (26.02%), Postives = 54/123 (43.90%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+  C   +    C++     ++N + C N G C+      +C C   +TG  C+++ D C +  C N + C     S   Y+CICP  + G  C   V+ C  +S C++   C      + C
Sbjct:  835 FACSCIPGFTGSRCTD-----EINDS-CFNGGTCVDGVNSYTCRCRPGFTGSHCQNEVDECASRPCQNGAMCVDGVES---YRCICPYGYTGAQCQNLVDLCR-RSPCQNGGRCTQTGPSFRC 947          

HSP 12 Score: 55.8398 bits (133), Expect = 1.730e-7
Identity = 34/106 (32.08%), Postives = 47/106 (44.34%), Query Frame = 2
Query:  542 LSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS-CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            L  +CS ID C    +  C+N  +C     + +C CP  Y G  C  D D C     C N   C  +P S   ++C CP  + G FC      C+  S C++  TC
Sbjct:   77 LGQDCSLIDACA---SNPCENGARCTNWNGRYNCTCPPGYQGRSCRVDIDECRTPGLCQNGGQCVNTPGS---FRCRCPSGYTGQFCEAIYVPCA-PSQCQNGGTC 175          

HSP 13 Score: 55.0694 bits (131), Expect = 3.077e-7
Identity = 30/95 (31.58%), Postives = 43/95 (45.26%), Query Frame = 2
Query:  599 KNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +N   C+Q      C C S YTG  C+   ++C +  C N   C ++  + L Y C CP+ F G  C      C +  SC S +TC+    G  C
Sbjct: 1141 QNTRHCVQLANDYQCVCKSGYTGRRCQSVMNTCESRPCQNGGVCSVTVNTPLGYTCRCPLGFTGPSCERPPLSCRE-LSCPSGSTCLPPPLGPRC 1234          

HSP 14 Score: 51.6026 bits (122), Expect = 3.020e-6
Identity = 34/125 (27.20%), Postives = 53/125 (42.40%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +F+  C   +    C  +ID C    +T CKN  KC+ +     C C   + G  C+ + D C  + C ++  C+   AS   + C C   + G  C   +NEC   + C     CI+    Y C
Sbjct:  415 EFTCICMAGFTGSMCQIDIDECA---STPCKNGAKCVDRPNGYECRCAEGFEGPLCDRNIDDCSPDPC-HHGKCRDGIAS---FTCTCEPGYTGYRCENQINECH-SNPCMHGGKCIDLVNKYLC 531          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Xenopus
Match: FAT4 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:100145590])

HSP 1 Score: 73.1738 bits (178), Expect = 6.854e-13
Identity = 41/124 (33.06%), Postives = 55/124 (44.35%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C   Y    C ++ID C  L    C N G C       SC CP  +TG  CE D + CL+  C N + CQ  P     + C+C     G  C   VN C + + C + A+C +   GY C
Sbjct: 3834 FMCRCMPGYEGEFCETDIDECLPLP---CHNGGTCHNLVGGFSCSCPDGFTGIACERDINECLSTPCKNGAVCQNFPGG---FNCVCKAGSTGKLCESAVNYC-ECNPCFNGASCQSGVDGYYC 3950          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Mouse
Match: Notch3 (notch 3 [Source:MGI Symbol;Acc:MGI:99460])

HSP 1 Score: 82.4185 bits (202), Expect = 6.367e-16
Identity = 41/123 (33.33%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C E D  E L+   C+N   C+ +  + +C C + +TG +CE D D C ++ C+N   C+        + C CP  F G+ C  DV+EC+  + CR+ A C++   GY C
Sbjct:  416 FLCQCGRGYTGPRC-ETDVNECLSGP-CRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNG---FSCTCPSGFSGSMCQLDVDECA-STPCRNGAKCVDQPDGYEC 532          

HSP 2 Score: 72.4034 bits (176), Expect = 8.600e-13
Identity = 41/125 (32.80%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +F+  C   Y   +C S+ID C   + T C++ G C+       C+CP  YTG  CE+    C  + C N  TC+ S  S + Y C C   F+G  C  +V++C     C +  TC++    YNC
Sbjct:  142 RFACACPPGYQGQSCQSDIDECR--SGTTCRHGGTCLNTPGSFRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQS--SDVTYDCACLPGFEGQNCEVNVDDCPGH-RCLNGGTCVDGVNTYNC 261          

HSP 3 Score: 68.1662 bits (165), Expect = 1.714e-11
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++D C  +    C++ G+C+       C+C   YTG  CE D + CL+  C N +TC        ++ CIC   F GT+C  D++EC   S C +   C +   G++C
Sbjct:  392 DVDECS-IGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIG---QFTCICMAGFTGTYCEVDIDECQ-SSPCVNGGVCKDRVNGFSC 494          

HSP 4 Score: 67.3958 bits (163), Expect = 2.932e-11
Identity = 46/156 (29.49%), Postives = 70/156 (44.87%), Query Frame = 2
Query:  422 TVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            T +F   D++    +P    N     + +   S  C   +   +CS+ ID C    T +C +   C  + A   C CP   TG  C  D D+C++N C  ++ C  +P S  +  C CP  F G  C +DV+ECS   + C     C+N  G + C
Sbjct:  268 TGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCA---TAVCFHGATCHDRVASFYCACPMGKTGLLCHLD-DACVSNPCHEDAICDTNPVSG-RAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLC 418          

HSP 5 Score: 67.0106 bits (162), Expect = 3.577e-11
Identity = 34/123 (27.64%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKC----IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C   D C   ++  C   G C    +   A+ SC C   + G  C    D C++  C++ + C + P  +  + C CP  +QG  C  D++EC   ++CR   TC+N  G + C
Sbjct:   68 CLPGWVGERCQLEDPC---HSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQ-PDPCVSRPCVHGAPCSVGPDGR--FACACPPGYQGQSCQSDIDECRSGTTCRHGGTCLNTPGSFRC 184          

HSP 6 Score: 66.6254 bits (161), Expect = 4.678e-11
Identity = 39/124 (31.45%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   Y    C S++D C    +  C+  GKC+    K  C CP   TG  CE + D C +N C    T  +      +Y C+C   F G  C+ ++NEC+  S C    +C++   G++C
Sbjct:  567 FSCACAPGYTGIRCESQVDECR---SQPCRYGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPC----TFGVCRDGINRYDCVCQPGFTGPLCNVEINECA-SSPCGEGGSCVDGENGFHC 682          

HSP 7 Score: 63.1586 bits (152), Expect = 5.633e-10
Identity = 37/114 (32.46%), Postives = 51/114 (44.74%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSS------CRSNATCINNYGGYNC 883
            E+D C       C++ G C        CECP+ Y GD CED+ D C +  C N  +C    A   +Y C CP    G  C  + ++C    S      C  N TC++  GG+ C
Sbjct: 1085 EVDPC---TAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCIDLVA---RYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRC 1192          

HSP 8 Score: 62.3882 bits (150), Expect = 1.173e-9
Identity = 32/97 (32.99%), Postives = 47/97 (48.45%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC+  GKCI K     C CP   TG  CE + D C    C +  TC+        Y C CP  + G  C ++++EC+ +  C++  +CI+    Y C
Sbjct: 1055 LCQEGGKCIDKGRSHYCVCPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGG---YVCECPAGYAGDSCEDNIDECASQ-PCQNGGSCIDLVARYLC 1147          

HSP 9 Score: 59.6918 bits (143), Expect = 8.441e-9
Identity = 37/119 (31.09%), Postives = 50/119 (42.02%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +  P C + D  E    + C  +G C        C C   YTG FC+ D D C  N C++  +CQ    S   + C C   F G  C  DV+EC   SS     TC ++   + C
Sbjct:  799 CPPGWQGPRCQQ-DVDECAGASPCGPHGTCTNLPGNFRCICHRGYTGPFCDQDIDDCDPNPCLHGGSCQDGVGS---FSCSCLDGFAGPRCARDVDEC--LSSPCGPGTCTDHVASFTC 911          

HSP 10 Score: 58.151 bits (139), Expect = 2.252e-8
Identity = 35/128 (27.34%), Postives = 57/128 (44.53%), Query Frame = 2
Query:  509 IQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + +   C   +   NC   +D C       C N G C+      +C+CP E+TG FC +D D C    N+C N  TC         + C+C   + G  C +++++C+  + C   ATC +    + C
Sbjct:  219 VTYDCACLPGFEGQNCEVNVDDCPGHR---CLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGG---HSCVCVNGWTGESCSQNIDDCA-TAVCFHGATCHDRVASFYC 339          

HSP 11 Score: 57.7658 bits (138), Expect = 2.940e-8
Identity = 35/123 (28.46%), Postives = 52/123 (42.28%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C+  +  P CS+    +   +  C+  G C        C C   + G  CE     C  + C +   C+  P  +L   C CP  +QG  C +DV+EC+  S C  + TC N  G + C
Sbjct:  717 FRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEV-LSPCTPSLCEHGGHCESDP-DRLTV-CSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRC 836          

HSP 12 Score: 56.9954 bits (136), Expect = 5.953e-8
Identity = 36/124 (29.03%), Postives = 53/124 (42.74%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +  P C+ ++D C    ++ C   G C    A  +C CP  Y G  CE D   C  +SC N  TC    +S   + C+C   + GT C  + + C  +  C     C   + G+ C
Sbjct:  872 FSCSCLDGFAGPRCARDVDECL---SSPC-GPGTCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSCFNGGTCVDGVSS---FSCLCRPGYTGTHCQYEADPCFSR-PCLHGGICNPTHPGFEC 987          

HSP 13 Score: 55.0694 bits (131), Expect = 2.295e-7
Identity = 34/121 (28.10%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGY 877
            F+  C   Y   +C EID  +  + + C N G C+   +  SC C   YTG  C+ + D C +  C++   C     +   ++C C   F G+ C   V+ CS ++ C++   C+   G Y
Sbjct:  909 FTCACPPGYGGFHC-EIDLPD-CSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHCQYEADPCFSRPCLHGGICN---PTHPGFECTCREGFTGSQCQNPVDWCS-QAPCQNGGRCVQT-GAY 1022          

HSP 14 Score: 52.7582 bits (125), Expect = 1.031e-6
Identity = 34/124 (27.42%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C  ++D C    +T C+N  KC+ +     C C   + G  CE + D C  + C ++  C    AS   + C C   + G  C   V+EC  +  CR    C++    Y C
Sbjct:  492 FSCTCPSGFSGSMCQLDVDECA---STPCRNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPC-HHGRCVDGIAS---FSCACAPGYTGIRCESQVDECRSQ-PCRYGGKCLDLVDKYLC 607          

HSP 15 Score: 50.0618 bits (118), Expect = 7.167e-6
Identity = 35/134 (26.12%), Postives = 55/134 (41.04%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C++ +    C   +D+C +     C+N G+C+Q  A   C CP  ++G  C+     C          L   C     C     S   + C+CP    G+ C  +V+ C+ +  C+   TC    GGY C
Sbjct:  985 FECTCREGFTGSQCQNPVDWCSQ---APCQNGGRCVQTGA--YCICPPGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKCIDKGRS---HYCVCPEGRTGSHCEHEVDPCTAQ-PCQHGGTCRGYMGGYVC 1109          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Mouse
Match: Notch1 (notch 1 [Source:MGI Symbol;Acc:MGI:97363])

HSP 1 Score: 78.1814 bits (191), Expect = 1.117e-14
Identity = 45/120 (37.50%), Postives = 60/120 (50.00%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C++ +  PNC + I+ C    +  C N G CI   A   C CP  YTG  CE     C  + C N+  C+ S   +  + C+CP  +QG  C  D+NEC  KS CR  A+C N  G Y C
Sbjct:  779 CREGFSGPNCQTNINECA---SNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYE-SFSCVCPTGWQGQTCEVDINECV-KSPCRHGASCQNTNGSYRC 893          

HSP 2 Score: 71.633 bits (174), Expect = 1.529e-12
Identity = 40/122 (32.79%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   Y  P CS+ +D C  L    C++ GKC+       C+C   YTG  CE D + C++N C N++TC  QI      +++CIC   ++G +C  + +EC+  S C  N  C++    + C
Sbjct:  400 CPSGYTGPACSQDVDEC-ALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIG-----EFQCICMPGYEGVYCEINTDECA-SSPCLHNGHCMDKINEFQC 514          

HSP 3 Score: 71.2478 bits (173), Expect = 1.727e-12
Identity = 40/120 (33.33%), Postives = 56/120 (46.67%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CQ  Y   NC S+ID C       C N G C        C+C   + G FCE+D + C +N C N + C     S   Y C CP+ F G  C  +  +C++ SSC +  TC++    + C
Sbjct:  895 CQAGYTGRNCESDIDDCRP---NPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDS---YTCTCPVGFNGIHCENNTPDCTE-SSCFNGGTCVDGINSFTC 1007          

HSP 4 Score: 69.3218 bits (168), Expect = 7.476e-12
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDF-CEKLN-------TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            Q+  +C+  +   NC  +   CE          T LC++ G C+ +  K  C C + YTG +CED+ D C  N C N +TC         + C C   + G+ C E++NEC  +  C++  TCI+    Y C
Sbjct: 1080 QYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGG---FSCKCVAGYHGSNCSEEINECLSQ-PCQNGGTCIDLTNSYKC 1207          

HSP 5 Score: 68.1662 bits (165), Expect = 1.644e-11
Identity = 39/122 (31.97%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +   NC E +D C   N   CKN G C+      +C CP E+TG +C +D D C  + N+C N  TC  +      Y C+C   + G  C E++++C+  ++C   ATC +    + C
Sbjct:  245 CLPGFAGQNCEENVDDCPGNN---CKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGG---YNCVCVNGWTGEDCSENIDDCA-SAACFQGATCHDRVASFYC 359          

HSP 6 Score: 68.1662 bits (165), Expect = 1.777e-11
Identity = 42/127 (33.07%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-------SDKSSCRSNATCINNYGGYNC 883
            CQ  Y    C  E+D C   +   C+N   C       SC+C + Y G  C ++ + CL+  C N  TC     S   YKC CP   QG  C  +V++C       S    C +N TC++  GGY C
Sbjct: 1133 CQAGYTGSYCEDEVDEC---SPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNS---YKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTC 1253          

HSP 7 Score: 65.0846 bits (157), Expect = 1.558e-10
Identity = 38/124 (30.65%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+ +C + Y  P C SE++ C   N+  C + G C        C+C   ++G  C+ + + C +N C+N  TC+   +    Y C C   F G  C  ++NEC+  + C +  TCI++  GY C
Sbjct:  700 FTCRCPEGYHDPTCLSEVNEC---NSNPCIH-GACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSG---YVCTCREGFSGPNCQTNINECA-SNPCLNQGTCIDDVAGYKC 815          

HSP 8 Score: 64.6994 bits (156), Expect = 2.239e-10
Identity = 40/123 (32.52%), Postives = 55/123 (44.72%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C E+D  E + +  C++   C        C C + YTG  CE D D C  N C N  +C     +     C C   FQG FC ED+NEC+  + C++ A C +    Y C
Sbjct:  853 FSCVCPTGWQGQTC-EVDINECVKSP-CRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAF---CDCLPGFQGAFCEEDINECA-SNPCQNGANCTDCVDSYTC 969          

HSP 9 Score: 63.929 bits (154), Expect = 3.274e-10
Identity = 39/121 (32.23%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            C   +   +CSE ID C    +  C     C  + A   CECP   TG  C  + D+C++N C   S C  +P +  K  C CP  + G  C +DV+EC+   + C     C+N  G + C
Sbjct:  323 CVNGWTGEDCSENIDDCA---SAACFQGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNG-KAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFEC 438          

HSP 10 Score: 63.929 bits (154), Expect = 3.958e-10
Identity = 37/135 (27.41%), Postives = 62/135 (45.93%), Query Frame = 2
Query:  482 NSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            N    L F   +  +C   +  P C  +++ C + N  LC++ G C  +     C C + +TG  CE     C  + C N  TC+  P     ++C C   F G  C E+V++C   ++C++   C++    YNC
Sbjct:  151 NGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQ-NPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCR--PTGDTTHECACLPGFAGQNCEENVDDCPG-NNCKNGGACVDGVNTYNC 281          

HSP 11 Score: 62.7734 bits (151), Expect = 9.141e-10
Identity = 34/113 (30.09%), Postives = 53/113 (46.90%), Query Frame = 2
Query:  545 SPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +P+C+E         + C N G C+      +C CP  +TG +C+ D + C +  C++  TCQ S  +   YKC CP  + G  C   V  C D + C++   C      Y+C
Sbjct:  984 TPDCTE---------SSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGT---YKCTCPQGYTGLNCQNLVRWC-DSAPCKNGGRCWQTNTQYHC 1083          

HSP 12 Score: 61.6178 bits (148), Expect = 1.760e-9
Identity = 38/133 (28.57%), Postives = 60/133 (45.11%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDK----SSCRSNAT-----CINNYGGYNC 883
            +F   C   Y    C EI+  ++  ++ C +NG C+ K  +  C+CP  + G  C+ D D C +  C N + C   P +   Y C+C   + GT C  D++EC        SC+         C   Y G++C
Sbjct:  473 EFQCICMPGYEGVYC-EIN-TDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNT---YTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHC 600          

HSP 13 Score: 55.0694 bits (131), Expect = 2.105e-7
Identity = 38/134 (28.36%), Postives = 63/134 (47.01%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   C + Y   NC   + +C+   +  CKN G+C Q   +  CEC S +TG  C+    SC          +   C +   C        K+ C C   + G++C ++V+ECS  + C++ ATC +  GG++C
Sbjct: 1043 YKCTCPQGYTGLNCQNLVRWCD---SAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCV---DEGDKHYCHCQAGYTGSYCEDEVDECS-PNPCQNGATCTDYLGGFSC 1169          

HSP 14 Score: 53.9138 bits (128), Expect = 4.148e-7
Identity = 44/160 (27.50%), Postives = 57/160 (35.62%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCI----QKYAKISCECPSEYTGDFCEDDKD-SCLNNSCINNSTCQISPASKLK-----------------------------------YKCICPIYFQGTFCHEDVNECSDKSS-CRSNATCINNYGGYNC 883
            C   ++   C + + C    +T CKN G C           +C CP  ++G  C    D +CL N C N  TC +   ++ K                                   Y C CP  F G  C +DVNECS     CR   TC N  G Y C
Sbjct:   48 CSGAFVGQRCQDSNPCL---STPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRC 204          

HSP 15 Score: 53.5286 bits (127), Expect = 5.798e-7
Identity = 36/123 (29.27%), Postives = 49/123 (39.84%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNN----GKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C K    PNC       ++N   C +N    G C+ K     C C   YTG  C  + D C  + C N  TC+   A    + C CP  +    C  +VNEC+       +  C +   GY C
Sbjct:  629 CLKGTTGPNC-------EINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAG---FTCRCPEGYHDPTCLSEVNECNSNPCI--HGACRDGLNGYKC 739          

HSP 16 Score: 52.373 bits (124), Expect = 1.503e-6
Identity = 25/83 (30.12%), Postives = 37/83 (44.58%), Query Frame = 2
Query:  614 CIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCIN 862
            C+Q+     CEC + +TG  CE   + C    C N   C ++  +   + C CP  F+G  C  D   C     C +  TCI+
Sbjct: 1284 CVQRVNDFHCECRAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCG-SLRCLNGGTCIS 1365          

HSP 17 Score: 51.2174 bits (121), Expect = 3.483e-6
Identity = 26/88 (29.55%), Postives = 39/88 (44.32%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQI-SPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            C N G+C       +C C   + G  C+D  + CL+  C N  TC +      + Y C CP+ F G  C   ++     + CR+  TC
Sbjct:   31 CLNGGRCEVANGTEACVCSGAFVGQRCQD-SNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTC 117          

HSP 18 Score: 51.2174 bits (121), Expect = 3.667e-6
Identity = 31/87 (35.63%), Postives = 43/87 (49.43%), Query Frame = 2
Query:  629 AKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
             K  C CPS YTG  C  D D C    N C +   C  +  S   ++C C   + G  C  DVNEC   + C+++ATC++  G + C
Sbjct:  394 GKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGS---FECQCLQGYTGPRCEIDVNECI-SNPCQNDATCLDQIGEFQC 476          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Mouse
Match: Svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:MGI Symbol;Acc:MGI:1928849])

HSP 1 Score: 75.0998 bits (183), Expect = 1.284e-13
Identity = 41/127 (32.28%), Postives = 68/127 (53.54%), Query Frame = 2
Query:  506 MIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  +   C K Y+  +C ++++ C+   ++ C NN  C  +    SC+CP  + G  CE + D CL+  C N +TC+    S   ++C CP  F GT C  ++NEC   + CR+ ATC++    Y+C
Sbjct: 1287 LASYRCTCVKGYMGVHCETDVNECQ---SSPCLNNAVCKDQVGGFSCKCPPGFLGTRCEKNVDECLSQPCQNGATCKDGANS---FRCQCPAGFTGTHCELNINEC-QSNPCRNQATCVDELNSYSC 1406          

HSP 2 Score: 73.559 bits (179), Expect = 4.264e-13
Identity = 49/150 (32.67%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  455 INNKPFH--LTNSKHNLSFMIQFSMK----CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++++ FH    N  HN     Q        C   Y    C ++ID C  L    C N G C  +    +CEC   Y+G  CE++ + C+++ C+N  TC    AS   Y+C C   + G  C  DVNEC   S C +NA C +  GG++C
Sbjct: 1188 VSSQVFHECFLNPCHNSGTCQQLGRGYVCLCPPGYTGLKCETDIDECSSLP---CLNGGICRDQVGGFTCECSLGYSGQICEENINECISSPCLNKGTCTDGLAS---YRCTCVKGYMGVHCETDVNEC-QSSPCLNNAVCKDQVGGFSC 1330          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 70.4774 bits (171), Expect = 3.306e-12
Identity = 34/105 (32.38%), Postives = 49/105 (46.67%), Query Frame = 2
Query:  572 CEKLNTTLCKNNGKCIQKYAKI-SCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+   ++ C+N G C     ++  C CPS Y G  CE   D C +N C N  TC         + C CP  F+G  C  D ++C  K +C +   C++  G Y C
Sbjct:  926 CDPCLSSPCQNQGTCHNDPLEVYRCTCPSGYKGRHCEVSLDGCSSNPCGNGGTCHAQEGEDAGFTCSCPSGFEGPTCGVDTDDCV-KHACVNGGVCVDGVGNYTC 1029          

HSP 2 Score: 62.003 bits (149), Expect = 1.195e-9
Identity = 37/126 (29.37%), Postives = 57/126 (45.24%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN--NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+  C   +  P C  + D C K     C N G C+      +C+CP +YTG  CE   D C    N C + + C  +P      +C C + + G  C E+ ++C D   C++ A C++    Y C
Sbjct:  989 FTCSCPSGFEGPTCGVDTDDCVK---HACVNGGVCVDGVGNYTCQCPLQYTGRACEQLVDFCSPDMNPCQHEAQCVGTPDGP---RCECMLGYTGDNCSENQDDCKDH-KCQNGAQCVDEVNSYAC 1107          

HSP 3 Score: 55.4546 bits (132), Expect = 1.628e-7
Identity = 35/137 (25.55%), Postives = 59/137 (43.07%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHE--------DVNECSDKSSC-----RSNATCINNYGGYNC 883
            ++ +C   Y    C + +DFC   +   C++  +C+       CEC   YTGD C +++D C ++ C N + C     S   Y C+C   + G  C          +  EC + ++C     R    C+  +GG  C
Sbjct: 1027 YTCQCPLQYTGRACEQLVDFCSP-DMNPCQHEAQCVGTPDGPRCECMLGYTGDNCSENQDDCKDHKCQNGAQCVDEVNS---YACLCVEGYSGQLCEIPPAPRSSCEGTECQNGANCVDQGSRPVCQCLPGFGGPEC 1159          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Mouse
Match: Notch4 (notch 4 [Source:MGI Symbol;Acc:MGI:107471])

HSP 1 Score: 70.4774 bits (171), Expect = 3.458e-12
Identity = 40/124 (32.26%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  C   Y+   CSE +  C   ++  C N G C  +    SC C   +TG  C+   D C++ SC+N  TC   P +   + C+C   FQG  C E  N     S CR+ ATC +   G  C
Sbjct:  710 YNCTCPAGYMGLTCSEEVTAC---HSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCVNKPGT---FFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARC 827          

HSP 2 Score: 68.5514 bits (166), Expect = 1.326e-11
Identity = 39/122 (31.97%), Postives = 59/122 (48.36%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCE--KLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CQ  Y    C  ++D C+  +   + C++ G CI      +C C   YTG  CE D + CL+  C   STC    A+   + C+CP   +G  C  +VNEC+  + C + A C +   G+ C
Sbjct:  417 CQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLAT---FHCLCPPGLEGRLCEVEVNECT-SNPCLNQAACHDLLNGFQC 534          

HSP 3 Score: 66.6254 bits (161), Expect = 5.165e-11
Identity = 38/126 (30.16%), Postives = 61/126 (48.41%), Query Frame = 2
Query:  506 MIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  F + CQK  +S    EI       + LC+N G CI   +   C CP  + G  C+D+ + C  N C + STC   P+    Y C C   ++G  C + ++ C  +  C ++ TC +  GG++C
Sbjct:  875 LCDFPLSCQKAAMSQGI-EI-------SGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSG---YVCQCAPGYEGQNCSKVLDACQSQ-PCHNHGTCTSRPGGFHC 988          

HSP 4 Score: 64.6994 bits (156), Expect = 1.858e-10
Identity = 40/128 (31.25%), Postives = 55/128 (42.97%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC----SDKSSCRSNATCINNYGGYNC 883
            F   C   +    C E +D C       C     CI +    SC CP   TG  C  + D CL+  C  N+ C  +P +     CIC   + G+ CH+D++EC       S C    +CIN  G +NC
Sbjct:  336 FHCVCVSGWGGAGCEENLDDCA---AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLE-DMCLSQPCHVNAQCSTNPLTGSTL-CICQPGYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNC 458          

HSP 5 Score: 63.1586 bits (152), Expect = 5.662e-10
Identity = 35/120 (29.17%), Postives = 56/120 (46.67%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C + +  P C +E+  C    +T C + G C  + +  +C CP+ Y G  C ++  +C +  C+N  +C I P     Y C C     G  C   V+ C   +SC +  TC+N  G + C
Sbjct:  676 CDEGWTGPECETELGGCI---STPCAHGGTCHPQPSGYNCTCPAGYMGLTCSEEVTACHSGPCLNGGSCSIRPEG---YSCTCLPSHTGRHCQTAVDHCV-SASCLNGGTCVNKPGTFFC 788          

HSP 6 Score: 62.7734 bits (151), Expect = 8.067e-10
Identity = 40/160 (25.00%), Postives = 59/160 (36.88%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDD----------------------------------------KDSCLNNSCINNSTCQISPASKLKYK-CICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+  +    C   DFC   +   C N G C+  Y +I C CP  + G  CE D                                        K +C   SC+N  TCQ+ P     +  C+CP  F G  C  + ++C  +  C++ ATC++    Y C
Sbjct:  142 CEPGWTGEQCQLRDFC---SANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCV-RHQCQNGATCLDGLDTYTC 297          

HSP 7 Score: 57.7658 bits (138), Expect = 2.861e-8
Identity = 29/99 (29.29%), Postives = 49/99 (49.49%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS---CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N   C+      +C CP  + G  C +D D C       C N  TCQ +  S   + C+C   + G  C E++++C+  ++C   +TCI+  G ++C
Sbjct:  282 CQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGS---FHCVCVSGWGGAGCEENLDDCA-AATCAPGSTCIDRVGSFSC 376          

HSP 8 Score: 54.299 bits (129), Expect = 3.842e-7
Identity = 44/174 (25.29%), Postives = 57/174 (32.76%), Query Frame = 2
Query:  524 KCQKDYLSPNCSEIDFCEKLNTTLCKNNGKC--------------IQKYAKISCECPSEYTGDFCEDD---------------------------------------KDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            +C   +L   C   D C   +T LCKN G C                     SC CPS +TGD C+                                         +D C  N C N   C    A+  + +C CP  F+G  C  D+NEC  +   C    +C N  G Y C
Sbjct:   49 QCAPGFLGETCQFPDPCR--DTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCL---ATYPQIQCRCPPGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQC 217          

HSP 9 Score: 53.5286 bits (127), Expect = 5.704e-7
Identity = 29/96 (30.21%), Postives = 42/96 (43.75%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N   C        C C   +TG  CE D D C +  C N   C+  P +   + C C   F+G  C ++V+EC     C   A+C++  G + C
Sbjct:  519 CLNQAACHDLLNGFQCLCLPGFTGARCEKDMDECSSTPCANGGRCRDQPGA---FYCECLPGFEGPHCEKEVDECL-SDPCPVGASCLDLPGAFFC 610          

HSP 10 Score: 50.447 bits (119), Expect = 5.226e-6
Identity = 25/81 (30.86%), Postives = 36/81 (44.44%), Query Frame = 2
Query:  641 CECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C C   +TG  CE +   C++  C +  TC   P+    Y C CP  + G  C E+V  C     C +  +C     GY+C
Sbjct:  674 CVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSG---YNCTCPAGYMGLTCSEEVTACH-SGPCLNGGSCSIRPEGYSC 750          

HSP 11 Score: 50.0618 bits (118), Expect = 8.234e-6
Identity = 34/124 (27.42%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  524 KCQKDYLSPNCSEI-DFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYG---GYNC 883
            +C   Y   NCS++ D C+   +  C N+G C  +     C CP  + G  CE D D CL+  C  + T      +   Y C C     G  C  +++ C  +  C +  +C    G   G+ C
Sbjct:  951 QCAPGYEGQNCSKVLDACQ---SQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTAACHSLANAFY-CQCLPGHTGQRCEVEMDLCQSQ-PCSNGGSCEITTGPPPGFTC 1069          
BLAST of Hyaluronan binding protein 2 vs. UniProt/SwissProt
Match: sp|P0C6B8|SVEP1_RAT (Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Svep1 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.304e-15
Identity = 46/120 (38.33%), Postives = 61/120 (50.83%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   Y    C ++ID C  L    C N G C  K    +CEC S YTG  CE++ + C ++ C+N  TC    AS   Y+C C   + G  C  DVNEC   S C +NA C +  GG++C
Sbjct: 1214 CPPGYTGLKCETDIDECSSLP---CLNGGICRDKVGGFTCECSSGYTGQICEENINECSSSPCLNKGTCTDGLAS---YRCTCVSGYVGVHCETDVNECQ-SSPCLNNAVCKDQVGGFSC 1326          

HSP 2 Score: 79.337 bits (194), Expect = 3.599e-14
Identity = 39/127 (30.71%), Postives = 66/127 (51.97%), Query Frame = 2
Query:  506 MIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  +   C   Y+  +C ++++ C+   ++ C NN  C  +    SC+CP  + G  CE + D CL+  C N +TC+    S   ++C CP  F G  C  ++NEC   + CR+ ATC++    Y+C
Sbjct: 1283 LASYRCTCVSGYVGVHCETDVNECQ---SSPCLNNAVCKDQVGGFSCKCPPGFLGTRCEKNVDECLSQPCQNGATCKDGANS---FRCQCPAGFTGPHCELNINECQ-SNPCRNQATCVDELNSYSC 1402          

HSP 3 Score: 65.4698 bits (158), Expect = 8.522e-10
Identity = 34/96 (35.42%), Postives = 44/96 (45.83%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N+G C Q      C CP  YTG  CE D D C +  C+N   C+        + C C   + G  C E++NECS  S C +  TC +    Y C
Sbjct: 1197 CHNSGTCQQLGRGYVCLCPPGYTGLKCETDIDECSSLPCLNGGICRDKVGG---FTCECSSGYTGQICEENINECS-SSPCLNKGTCTDGLASYRC 1288          
BLAST of Hyaluronan binding protein 2 vs. UniProt/SwissProt
Match: sp|Q9R172|NOTC3_RAT (Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 4.080e-15
Identity = 42/123 (34.15%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C E D  E L+   C+N   C+ +  + +C C + +TG FCE D D C ++ C+N   C+        + C CP  F G+ C  DV+EC+  + CR+ A C++   GY C
Sbjct:  417 FLCQCGRGYTGPRC-ETDVNECLSGP-CRNQATCLDRIGQFTCICMAGFTGTFCEVDIDECQSSPCVNGGVCKDRVNG---FSCTCPSGFSGSTCQLDVDECA-STPCRNGAKCVDQPDGYEC 533          

HSP 2 Score: 69.3218 bits (168), Expect = 6.048e-11
Identity = 35/108 (32.41%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++D C  +    C++ G+C+       C+C   YTG  CE D + CL+  C N +TC        ++ CIC   F GTFC  D++EC   S C +   C +   G++C
Sbjct:  393 DVDECS-IGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIG---QFTCICMAGFTGTFCEVDIDECQ-SSPCVNGGVCKDRVNGFSC 495          

HSP 3 Score: 68.9366 bits (167), Expect = 7.912e-11
Identity = 41/125 (32.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +++  C   Y   NC S+ID C    +  C++ G CI       C CP  YTG  CE+    C  + C N  TC+ S  S + Y C C   F+G  C  +V++C     C +  TC++    YNC
Sbjct:  143 RYACACPPGYQGRNCRSDIDECRAGAS--CRHGGTCINTPGSFHCLCPLGYTGLLCENPIVPCAPSPCRNGGTCRQS--SDVTYDCACLPGFEGQNCEVNVDDCPGH-RCLNGGTCVDGVNTYNC 262          

HSP 4 Score: 67.0106 bits (162), Expect = 2.438e-10
Identity = 46/156 (29.49%), Postives = 70/156 (44.87%), Query Frame = 2
Query:  422 TVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            T +F   D++    +P    N     + +   S  C   +   +CS+ ID C    T +C +   C  + A   C CP   TG  C  D D+C++N C  ++ C  +P S  +  C CP  F G  C +DV+ECS   + C     C+N  G + C
Sbjct:  269 TGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCA---TAVCFHGATCHDRVASFYCACPMGKTGLLCHLD-DACVSNPCHEDAICDTNPVSG-RAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLC 419          

HSP 5 Score: 66.6254 bits (161), Expect = 3.993e-10
Identity = 39/124 (31.45%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   Y    C S++D C    +  C+  GKC+    K  C CP   TG  CE + D C +N C    T  +      +Y C+C   F G  C+ ++NEC+  S C    +C++   G++C
Sbjct:  568 FSCACAPGYTGIRCESQVDECR---SQPCRYGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPC----TFGVCRDGINRYDCVCQPGFTGPLCNVEINECA-SSPCGEGGSCVDGENGFHC 683          

HSP 6 Score: 66.6254 bits (161), Expect = 4.169e-10
Identity = 40/126 (31.75%), Postives = 56/126 (44.44%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSS------CRSNATCINNYGGYNC 883
            C +  +  +C  E+D C       C++ G C        CECP+ Y+GD CEDD D C +  C N  +C    A    Y C CP    G  C  + ++C    S      C  N TC++  GG+ C
Sbjct: 1074 CPEGRMGSHCEQEVDPC---TAQPCQHGGTCRGYMGGYVCECPTGYSGDSCEDDVDECASQPCQNGGSCIDLVA---HYLCSCPPGTLGVLCEINEDDCGPGPSLDSGLRCLHNGTCVDLVGGFRC 1193          

HSP 7 Score: 64.6994 bits (156), Expect = 1.498e-9
Identity = 37/123 (30.08%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKC----IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C   D C   ++  C   G C    +   A+ SC C   + G  C    D C ++ C + + C +   S  +Y C CP  +QG  C  D++EC   +SCR   TCIN  G ++C
Sbjct:   69 CLPGWVGERCQLEDPC---HSGPCAGRGVCQSSVVAGVARFSCRCLRGFRGPDCSL-PDPCFSSPCAHGAPCSV--GSDGRYACACPPGYQGRNCRSDIDECRAGASCRHGGTCINTPGSFHC 185          

HSP 8 Score: 63.1586 bits (152), Expect = 4.114e-9
Identity = 40/128 (31.25%), Postives = 53/128 (41.41%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDK----SSCRSNA-----TCINNYGGYNC 883
            C   +  P C + D  E    + C  +G C        C C   YTG FC+ D D C  N C+N  +CQ    S   + C C   F G  C  DV+EC        +C  +      TC   YGG++C
Sbjct:  800 CPPGWQGPRCQQ-DVDECAGASPCGPHGTCTNLPGSFRCICHGGYTGPFCDQDIDDCDPNPCLNGGSCQDGVGS---FSCSCLSGFAGPRCARDVDECLSSPCGPGTCTDHVASFTCTCPPGYGGFHC 923          

HSP 9 Score: 61.2326 bits (147), Expect = 1.608e-8
Identity = 32/97 (32.99%), Postives = 46/97 (47.42%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC+  G+CI K     C CP    G  CE + D C    C +  TC+        Y C CP  + G  C +DV+EC+ +  C++  +CI+    Y C
Sbjct: 1056 LCQAGGQCIDKDHSHYCVCPEGRMGSHCEQEVDPCTAQPCQHGGTCRGYMGG---YVCECPTGYSGDSCEDDVDECASQ-PCQNGGSCIDLVAHYLC 1148          

HSP 10 Score: 58.151 bits (139), Expect = 1.762e-7
Identity = 35/128 (27.34%), Postives = 57/128 (44.53%), Query Frame = 2
Query:  509 IQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + +   C   +   NC   +D C       C N G C+      +C+CP E+TG FC +D D C    N+C N  TC         + C+C   + G  C +++++C+  + C   ATC +    + C
Sbjct:  220 VTYDCACLPGFEGQNCEVNVDDCPGHR---CLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGG---HSCVCVNGWTGESCSQNIDDCA-TAVCFHGATCHDRVASFYC 340          

HSP 11 Score: 56.9954 bits (136), Expect = 3.330e-7
Identity = 37/124 (29.84%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +  P C+ ++D C    ++ C   G C    A  +C CP  Y G  CE D   C  +SC N  TC     S   + C+C   + GT C   V+ C  +  C     C   + G+ C
Sbjct:  873 FSCSCLSGFAGPRCARDVDECL---SSPC-GPGTCTDHVASFTCTCPPGYGGFHCETDLLDCSPSSCFNGGTCVDGVNS---FSCLCRPGYTGTHCQYKVDPCFSR-PCLHGGICNPTHSGFEC 988          

HSP 12 Score: 56.6102 bits (135), Expect = 4.236e-7
Identity = 34/123 (27.64%), Postives = 49/123 (39.84%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +  P CS+    +   +  C+  G C        C C   + G  CE     C  + C +   C+  P       C CP  +QG  C +DV+EC+  S C  + TC N  G + C
Sbjct:  718 FQCVCDPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFHCTCAPGFQGHQCEV-LSPCTPSLCEHGGHCESDPDQLTV--CSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGSFRC 837          

HSP 13 Score: 53.5286 bits (127), Expect = 4.778e-6
Identity = 34/124 (27.42%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C  ++D C    +T C+N  KC+ +     C C   + G  CE + D C  + C ++  C    AS   + C C   + G  C   V+EC  +  CR    C++    Y C
Sbjct:  493 FSCTCPSGFSGSTCQLDVDECA---STPCRNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPC-HHGRCVDGIAS---FSCACAPGYTGIRCESQVDECRSQ-PCRYGGKCLDLVDKYLC 608          
BLAST of Hyaluronan binding protein 2 vs. UniProt/SwissProt
Match: sp|Q61982|NOTC3_MOUSE (Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.454e-15
Identity = 41/123 (33.33%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C E D  E L+   C+N   C+ +  + +C C + +TG +CE D D C ++ C+N   C+        + C CP  F G+ C  DV+EC+  + CR+ A C++   GY C
Sbjct:  416 FLCQCGRGYTGPRC-ETDVNECLSGP-CRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNG---FSCTCPSGFSGSMCQLDVDECA-STPCRNGAKCVDQPDGYEC 532          

HSP 2 Score: 72.4034 bits (176), Expect = 6.015e-12
Identity = 41/125 (32.80%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +F+  C   Y   +C S+ID C   + T C++ G C+       C+CP  YTG  CE+    C  + C N  TC+ S  S + Y C C   F+G  C  +V++C     C +  TC++    YNC
Sbjct:  142 RFACACPPGYQGQSCQSDIDECR--SGTTCRHGGTCLNTPGSFRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQS--SDVTYDCACLPGFEGQNCEVNVDDCPGH-RCLNGGTCVDGVNTYNC 261          

HSP 3 Score: 68.1662 bits (165), Expect = 1.199e-10
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++D C  +    C++ G+C+       C+C   YTG  CE D + CL+  C N +TC        ++ CIC   F GT+C  D++EC   S C +   C +   G++C
Sbjct:  392 DVDECS-IGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIG---QFTCICMAGFTGTYCEVDIDECQ-SSPCVNGGVCKDRVNGFSC 494          

HSP 4 Score: 67.3958 bits (163), Expect = 2.051e-10
Identity = 46/156 (29.49%), Postives = 70/156 (44.87%), Query Frame = 2
Query:  422 TVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            T +F   D++    +P    N     + +   S  C   +   +CS+ ID C    T +C +   C  + A   C CP   TG  C  D D+C++N C  ++ C  +P S  +  C CP  F G  C +DV+ECS   + C     C+N  G + C
Sbjct:  268 TGQFCTEDVDECQLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDCA---TAVCFHGATCHDRVASFYCACPMGKTGLLCHLD-DACVSNPCHEDAICDTNPVSG-RAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLC 418          

HSP 5 Score: 67.0106 bits (162), Expect = 2.502e-10
Identity = 34/123 (27.64%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKC----IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C   D C   ++  C   G C    +   A+ SC C   + G  C    D C++  C++ + C + P  +  + C CP  +QG  C  D++EC   ++CR   TC+N  G + C
Sbjct:   68 CLPGWVGERCQLEDPC---HSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQ-PDPCVSRPCVHGAPCSVGPDGR--FACACPPGYQGQSCQSDIDECRSGTTCRHGGTCLNTPGSFRC 184          

HSP 6 Score: 66.6254 bits (161), Expect = 3.272e-10
Identity = 39/124 (31.45%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   Y    C S++D C    +  C+  GKC+    K  C CP   TG  CE + D C +N C    T  +      +Y C+C   F G  C+ ++NEC+  S C    +C++   G++C
Sbjct:  567 FSCACAPGYTGIRCESQVDECR---SQPCRYGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPC----TFGVCRDGINRYDCVCQPGFTGPLCNVEINECA-SSPCGEGGSCVDGENGFHC 682          

HSP 7 Score: 63.1586 bits (152), Expect = 3.940e-9
Identity = 37/114 (32.46%), Postives = 51/114 (44.74%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSS------CRSNATCINNYGGYNC 883
            E+D C       C++ G C        CECP+ Y GD CED+ D C +  C N  +C    A   +Y C CP    G  C  + ++C    S      C  N TC++  GG+ C
Sbjct: 1085 EVDPC---TAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCIDLVA---RYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRC 1192          

HSP 8 Score: 62.3882 bits (150), Expect = 8.204e-9
Identity = 32/97 (32.99%), Postives = 47/97 (48.45%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC+  GKCI K     C CP   TG  CE + D C    C +  TC+        Y C CP  + G  C ++++EC+ +  C++  +CI+    Y C
Sbjct: 1055 LCQEGGKCIDKGRSHYCVCPEGRTGSHCEHEVDPCTAQPCQHGGTCRGYMGG---YVCECPAGYAGDSCEDNIDECASQ-PCQNGGSCIDLVARYLC 1147          

HSP 9 Score: 59.6918 bits (143), Expect = 5.904e-8
Identity = 37/119 (31.09%), Postives = 50/119 (42.02%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +  P C + D  E    + C  +G C        C C   YTG FC+ D D C  N C++  +CQ    S   + C C   F G  C  DV+EC   SS     TC ++   + C
Sbjct:  799 CPPGWQGPRCQQ-DVDECAGASPCGPHGTCTNLPGNFRCICHRGYTGPFCDQDIDDCDPNPCLHGGSCQDGVGS---FSCSCLDGFAGPRCARDVDEC--LSSPCGPGTCTDHVASFTC 911          

HSP 10 Score: 58.151 bits (139), Expect = 1.575e-7
Identity = 35/128 (27.34%), Postives = 57/128 (44.53%), Query Frame = 2
Query:  509 IQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + +   C   +   NC   +D C       C N G C+      +C+CP E+TG FC +D D C    N+C N  TC         + C+C   + G  C +++++C+  + C   ATC +    + C
Sbjct:  219 VTYDCACLPGFEGQNCEVNVDDCPGHR---CLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGG---HSCVCVNGWTGESCSQNIDDCA-TAVCFHGATCHDRVASFYC 339          

HSP 11 Score: 57.7658 bits (138), Expect = 2.057e-7
Identity = 35/123 (28.46%), Postives = 52/123 (42.28%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C+  +  P CS+    +   +  C+  G C        C C   + G  CE     C  + C +   C+  P  +L   C CP  +QG  C +DV+EC+  S C  + TC N  G + C
Sbjct:  717 FRCVCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEV-LSPCTPSLCEHGGHCESDP-DRLTV-CSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRC 836          

HSP 12 Score: 56.9954 bits (136), Expect = 4.164e-7
Identity = 36/124 (29.03%), Postives = 53/124 (42.74%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +  P C+ ++D C    ++ C   G C    A  +C CP  Y G  CE D   C  +SC N  TC    +S   + C+C   + GT C  + + C  +  C     C   + G+ C
Sbjct:  872 FSCSCLDGFAGPRCARDVDECL---SSPC-GPGTCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSCFNGGTCVDGVSS---FSCLCRPGYTGTHCQYEADPCFSR-PCLHGGICNPTHPGFEC 987          

HSP 13 Score: 55.0694 bits (131), Expect = 1.605e-6
Identity = 34/121 (28.10%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGY 877
            F+  C   Y   +C EID  +  + + C N G C+   +  SC C   YTG  C+ + D C +  C++   C     +   ++C C   F G+ C   V+ CS ++ C++   C+   G Y
Sbjct:  909 FTCACPPGYGGFHC-EIDLPD-CSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHCQYEADPCFSRPCLHGGICN---PTHPGFECTCREGFTGSQCQNPVDWCS-QAPCQNGGRCVQT-GAY 1022          

HSP 14 Score: 52.7582 bits (125), Expect = 7.214e-6
Identity = 34/124 (27.42%), Postives = 52/124 (41.94%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C  ++D C    +T C+N  KC+ +     C C   + G  CE + D C  + C ++  C    AS   + C C   + G  C   V+EC  +  CR    C++    Y C
Sbjct:  492 FSCTCPSGFSGSMCQLDVDECA---STPCRNGAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPC-HHGRCVDGIAS---FSCACAPGYTGIRCESQVDECRSQ-PCRYGGKCLDLVDKYLC 607          
BLAST of Hyaluronan binding protein 2 vs. UniProt/SwissProt
Match: sp|Q9UM47|NOTC3_HUMAN (Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 7.604e-15
Identity = 41/123 (33.33%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C E D  E L+   C+N   C+ +  + +C C + +TG +CE D D C ++ C+N   C+        + C CP  F G+ C  DV+EC+  + CR+ A C++   GY C
Sbjct:  415 FLCQCGRGYTGPRC-ETDVNECLSGP-CRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNG---FSCTCPSGFSGSTCQLDVDECA-STPCRNGAKCVDQPDGYEC 531          

HSP 2 Score: 69.707 bits (169), Expect = 3.596e-11
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   Y    C S++D C    +  C++ GKC+    K  C CPS  TG  CE + D C +N C    T  +      +Y C+C   F G  C+ ++NEC+  S C    +C++   G+ C
Sbjct:  566 FSCACAPGYTGTRCESQVDECR---SQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPC----TFGVCRDGINRYDCVCQPGFTGPLCNVEINECA-SSPCGEGGSCVDGENGFRC 681          

HSP 3 Score: 68.9366 bits (167), Expect = 7.193e-11
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +F   C   Y   +C S++D C       C++ G C+       C+CP+ YTG  CE+    C  + C N  TC+ S    L Y C C   F+G  C  +V++C     C +  TC++    YNC
Sbjct:  141 RFLCSCPPGYQGRSCRSDVDECRVGEP--CRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQS--GDLTYDCACLPGFEGQNCEVNVDDCPGH-RCLNGGTCVDGVNTYNC 260          

HSP 4 Score: 68.1662 bits (165), Expect = 1.210e-10
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++D C  +    C++ G+C+       C+C   YTG  CE D + CL+  C N +TC        ++ CIC   F GT+C  D++EC   S C +   C +   G++C
Sbjct:  391 DVDECS-IGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIG---QFTCICMAGFTGTYCEVDIDECQ-SSPCVNGGVCKDRVNGFSC 493          

HSP 5 Score: 66.6254 bits (161), Expect = 3.959e-10
Identity = 37/123 (30.08%), Postives = 55/123 (44.72%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKC----IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C   D C   ++  C   G C    +   A+ SC CP  + G  C    D CL++ C + + C + P    ++ C CP  +QG  C  DV+EC     CR   TC+N  G + C
Sbjct:   67 CPPGWVGERCQLEDPC---HSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSL-PDPCLSSPCAHGARCSVGPDG--RFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGSFRC 183          

HSP 6 Score: 65.4698 bits (158), Expect = 8.044e-10
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  518 SMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            S  C   +   +CS+ ID C    T +C +   C  + A   C CP   TG  C  D D+C++N C  ++ C  +P +  +  C CP  F G  C +DV+ECS   + C     C+N  G + C
Sbjct:  299 SCVCVNGWTGESCSQNIDDCA---TAVCFHGATCHDRVASFYCACPMGKTGLLCHLD-DACVSNPCHEDAICDTNPVNG-RAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLC 417          

HSP 7 Score: 60.8474 bits (146), Expect = 2.495e-8
Identity = 39/128 (30.47%), Postives = 53/128 (41.41%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDK----SSCRSNA-----TCINNYGGYNC 883
            C + +  P C + D  E      C  +G C       SC C   YTG  C+ D + C  N C+N  +CQ    S   + C C   F G  C  DV+EC        +C  +      TC   YGG++C
Sbjct:  798 CPQGWQGPRCQQ-DVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSCQDGVGS---FSCSCLPGFAGPRCARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGFHC 921          

HSP 8 Score: 59.6918 bits (143), Expect = 5.956e-8
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C+      +C+CP E+TG FC +D D C    N+C N  TC  +      + C+C   + G  C +++++C+  + C   ATC +    + C
Sbjct:  245 CLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGG---HSCVCVNGWTGESCSQNIDDCA-TAVCFHGATCHDRVASFYC 338          

HSP 9 Score: 59.3066 bits (142), Expect = 6.272e-8
Identity = 34/123 (27.64%), Postives = 51/123 (41.46%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C+  +  P CS+    +   +  C+  G C        C CP    G  CE     C  N C +   C+ +P       C CP  +QG  C +DV+EC+  + C  +  C N  G ++C
Sbjct:  716 FRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCEL-LSPCTPNPCEHGGRCESAPGQLPV--CSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSC 835          

HSP 10 Score: 59.3066 bits (142), Expect = 6.777e-8
Identity = 31/97 (31.96%), Postives = 47/97 (48.45%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC+  G+C+ + +   C CP   TG  CE + D CL   C +  TC+        Y C C   + G  C +DV+EC+ +  C+   +CI+    Y C
Sbjct: 1054 LCQAGGQCVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGG---YMCECLPGYNGDNCEDDVDECASQ-PCQHGGSCIDLVARYLC 1146          

HSP 11 Score: 57.7658 bits (138), Expect = 2.147e-7
Identity = 32/102 (31.37%), Postives = 44/102 (43.14%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC------SDKSSCRSNATCINNYGGYNC 883
            C++ G C        CEC   Y GD CEDD D C +  C +  +C    A   +Y C CP    G  C  + ++C           C  N TC++  GG+ C
Sbjct: 1093 CQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVA---RYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRC 1191          

HSP 12 Score: 55.4546 bits (132), Expect = 1.072e-6
Identity = 39/134 (29.10%), Postives = 62/134 (46.27%), Query Frame = 2
Query:  503 FMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC-----LNNS--CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNAT--CINNYGG 874
            +M  +  +C   Y   NC + +D C    +  C++ G CI   A+  C CP    G  CE ++D C     L++   C++N TC         ++C CP  + G  C  D+NEC    +C +  T  C+ + GG
Sbjct: 1102 YMGGYMCECLPGYNGDNCEDDVDECA---SQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGG---FRCTCPPGYTGLRCEADINECR-SGACHAAHTRDCLQDPGG 1228          

HSP 13 Score: 55.4546 bits (132), Expect = 1.251e-6
Identity = 35/124 (28.23%), Postives = 50/124 (40.32%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +  P C+ ++D C    +  C   G C    A  +C CP  Y G  CE D   C  +SC N  TC     S   + C+C   + G  C  + + C  +  C     C   + G+ C
Sbjct:  871 FSCSCLPGFAGPRCARDVDECL---SNPC-GPGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNS---FSCLCRPGYTGAHCQHEADPCLSR-PCLHGGVCSAAHPGFRC 986          

HSP 14 Score: 55.0694 bits (131), Expect = 1.473e-6
Identity = 34/117 (29.06%), Postives = 52/117 (44.44%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGY 877
            C++D   P+CS          + C N G C+      SC C   YTG  C+ + D CL+  C++   C    A+   ++C C   F G  C   V+ CS +  C++   C+   G Y
Sbjct:  921 CEQDL--PDCS---------PSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGVCS---AAHPGFRCTCLESFTGPQCQTLVDWCS-RQPCQNGGRCVQT-GAY 1021          

HSP 15 Score: 54.6842 bits (130), Expect = 1.923e-6
Identity = 34/124 (27.42%), Postives = 53/124 (42.74%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C  ++D C    +T C+N  KC+ +     C C   + G  C+ + D C  + C ++  C    AS   + C C   + GT C   V+EC  +  CR    C++    Y C
Sbjct:  491 FSCTCPSGFSGSTCQLDVDECA---STPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCSPDPC-HHGRCVDGIAS---FSCACAPGYTGTRCESQVDECRSQ-PCRHGGKCLDLVDKYLC 606          
BLAST of Hyaluronan binding protein 2 vs. UniProt/SwissProt
Match: sp|Q07008|NOTC1_RAT (Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3)

HSP 1 Score: 78.5666 bits (192), Expect = 7.613e-14
Identity = 45/120 (37.50%), Postives = 60/120 (50.00%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C++ +  PNC + I+ C    +  C N G CI   A   C CP  YTG  CE     C  + C N+  C+ S   +  + C+CP  +QG  C  D+NEC  KS CR  A+C N  G Y C
Sbjct:  779 CREGFSGPNCQTNINECA---SNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYE-SFSCVCPTGWQGQTCEIDINECV-KSPCRHGASCQNTNGSYRC 893          

HSP 2 Score: 72.7886 bits (177), Expect = 4.687e-12
Identity = 38/109 (34.86%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  569 FCEK----LNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FCE+      +  C+N   C       +C CP+ + G  CE++   C  +SC N  TC     S   + C+CP  F G++C  DVNEC D   C    TC ++YG Y C
Sbjct:  941 FCEEDINECASNPCQNGANCTDCVDSYTCTCPTGFNGIHCENNTPDCTESSCFNGGTCVDGINS---FTCLCPPGFTGSYCQYDVNEC-DSRPCLHGGTCQDSYGTYKC 1045          

HSP 3 Score: 71.2478 bits (173), Expect = 1.250e-11
Identity = 40/122 (32.79%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   Y  P CS+ +D C  L    C++ GKC+       C+C   YTG  CE D + C++N C N++TC  QI      +++CIC   ++G +C  + +EC+  S C  N  C++    + C
Sbjct:  400 CPSGYTGPACSQDVDEC-ALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIG-----EFQCICMPGYEGVYCEINTDECA-SSPCLHNGRCVDKINEFLC 514          

HSP 4 Score: 70.4774 bits (171), Expect = 2.295e-11
Identity = 40/120 (33.33%), Postives = 55/120 (45.83%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CQ  Y   NC S+ID C       C N G C        C+C   + G FCE+D + C +N C N + C     S   Y C CP  F G  C  +  +C++ SSC +  TC++    + C
Sbjct:  895 CQAGYTGRNCESDIDDCRP---NPCHNGGSCTDGVNAAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDS---YTCTCPTGFNGIHCENNTPDCTE-SSCFNGGTCVDGINSFTC 1007          

HSP 5 Score: 69.3218 bits (168), Expect = 4.713e-11
Identity = 40/122 (32.79%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +   NC E +D C   N   CKN G C+      +C CP E+TG +C +D D C  + N+C N  TC  S      Y C+C   + G  C E++++C+  ++C   ATC +    + C
Sbjct:  245 CLPGFAGQNCEENVDDCPGNN---CKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNSHGG---YNCVCVNGWTGEDCSENIDDCA-SAACFQGATCHDRVASFYC 359          

HSP 6 Score: 68.9366 bits (167), Expect = 6.382e-11
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDF-CEKLN-------TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            Q+  +C+  +   NC  +   CE          T LC++ G C+ +  K  C C + YTG +CED+ D C  N C N +TC         + C C   + G+ C E++NEC  +  C++  TCI+    Y C
Sbjct: 1080 QYHCECRSGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGG---FSCKCVAGYHGSNCSEEINECLSQ-PCQNGGTCIDLTNTYKC 1207          

HSP 7 Score: 67.3958 bits (163), Expect = 1.984e-10
Identity = 41/127 (32.28%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-------SDKSSCRSNATCINNYGGYNC 883
            CQ  Y    C  E+D C   +   C+N   C       SC+C + Y G  C ++ + CL+  C N  TC     +   YKC CP   QG  C  +V++C       S    C +N TC++  GGY C
Sbjct: 1133 CQAGYTGSYCEDEVDEC---SPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNT---YKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTC 1253          

HSP 8 Score: 65.4698 bits (158), Expect = 8.856e-10
Identity = 38/124 (30.65%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+ +C + Y  P C SE++ C   N+  C + G C        C+C   ++G  C+ + + C +N C+N  TC+   +    Y C C   F G  C  ++NEC+  + C +  TCI++  GY C
Sbjct:  700 FTCRCPEGYHDPTCLSEVNEC---NSNPCIH-GACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSG---YVCTCREGFSGPNCQTNINECA-SNPCLNQGTCIDDVAGYKC 815          

HSP 9 Score: 65.4698 bits (158), Expect = 9.088e-10
Identity = 41/123 (33.33%), Postives = 55/123 (44.72%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C   +    C EID  E + +  C++   C        C C + YTG  CE D D C  N C N  +C     +     C C   FQG FC ED+NEC+  + C++ A C +    Y C
Sbjct:  853 FSCVCPTGWQGQTC-EIDINECVKSP-CRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGVNAAF---CDCLPGFQGAFCEEDINECA-SNPCQNGANCTDCVDSYTC 969          

HSP 10 Score: 64.3142 bits (155), Expect = 1.894e-9
Identity = 39/121 (32.23%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            C   +   +CSE ID C    +  C     C  + A   CECP   TG  C  + D+C++N C   S C  +P +  K  C CP  + G  C +DV+EC+   + C     C+N  G + C
Sbjct:  323 CVNGWTGEDCSENIDDCA---SAACFQGATCHDRVASFYCECPHGRTGLLCHLN-DACISNPCNEGSNCDTNPVNG-KAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFEC 438          

HSP 11 Score: 63.1586 bits (152), Expect = 4.687e-9
Identity = 34/113 (30.09%), Postives = 53/113 (46.90%), Query Frame = 2
Query:  545 SPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +P+C+E         + C N G C+      +C CP  +TG +C+ D + C +  C++  TCQ S  +   YKC CP  + G  C   V  C D + C++   C      Y+C
Sbjct:  984 TPDCTE---------SSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGT---YKCTCPQGYTGLNCQNLVRWC-DSAPCKNGGKCWQTNTQYHC 1083          

HSP 12 Score: 62.7734 bits (151), Expect = 5.968e-9
Identity = 37/135 (27.41%), Postives = 61/135 (45.19%), Query Frame = 2
Query:  482 NSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            N    L F   +   C   +  P C  +++ C + N  LC++ G C  +     C C + +TG  CE     C  + C N  TC+  P     ++C C   F G  C E+V++C   ++C++   C++    YNC
Sbjct:  151 NGGQCLPFESSYICGCPPGFHGPTCRQDVNECSQ-NPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCR--PTGDTTHECACLPGFAGQNCEENVDDCPG-NNCKNGGACVDGVNTYNC 281          

HSP 13 Score: 62.003 bits (149), Expect = 1.045e-8
Identity = 36/124 (29.03%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +F   C   Y    C EI+  ++  ++ C +NG+C+ K  +  C+CP  ++G  C+ D D C +  C N + C   P +   Y C+C   + GT C  D++EC D   C     C +    + C
Sbjct:  473 EFQCICMPGYEGVYC-EIN-TDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQYDVDECASTPCKNGAKCLDGPNT---YTCVCTEGYTGTHCEVDIDEC-DPDPCHY-GLCKDGVATFTC 589          

HSP 14 Score: 56.9954 bits (136), Expect = 3.787e-7
Identity = 39/134 (29.10%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   C + Y   NC   + +C+   +  CKN GKC Q   +  CEC S +TG  C+    SC          +   C +   C      + K+ C C   + G++C ++V+ECS  + C++ ATC +  GG++C
Sbjct: 1043 YKCTCPQGYTGLNCQNLVRWCD---SAPCKNGGKCWQTNTQYHCECRSGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCV---DEEDKHYCHCQAGYTGSYCEDEVDECS-PNPCQNGATCTDYLGGFSC 1169          

HSP 15 Score: 53.9138 bits (128), Expect = 3.445e-6
Identity = 36/123 (29.27%), Postives = 49/123 (39.84%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNN----GKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C K    PNC       ++N   C +N    G C+ K     C C   YTG  C  + D C  + C N  TC+   A    + C CP  +    C  +VNEC+       +  C +   GY C
Sbjct:  629 CLKGTTGPNC-------EINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAG---FTCRCPEGYHDPTCLSEVNECNSNPCI--HGACRDGLNGYKC 739          

HSP 16 Score: 53.5286 bits (127), Expect = 4.457e-6
Identity = 46/163 (28.22%), Postives = 58/163 (35.58%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKC-------IQKYAKISCECPSEYTGDFCEDD-KDSCLNNSCINNSTCQISPASKLK-----------------------------------YKCICPIYFQGTFCHEDVNECSDKSS-CRSNATCINNYGGYNC 883
            C   ++   C +   C    +T CKN G C       I  YA   C CP  ++G  C     ++CL N C N  TC +   ++ K                                   Y C CP  F G  C +DVNECS     CR   TC N  G Y C
Sbjct:   48 CSGAFVGQRCQDPSPCL---STPCKNAGTCYVVDHGGIVDYA---CSCPLGFSGPLCLTPLANACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRC 204          

HSP 17 Score: 52.373 bits (124), Expect = 9.900e-6
Identity = 25/83 (30.12%), Postives = 37/83 (44.58%), Query Frame = 2
Query:  614 CIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCIN 862
            C+Q+     CEC + +TG  CE   + C    C N   C ++  +   + C CP  F+G  C  D   C     C +  TCI+
Sbjct: 1284 CVQRVNDFHCECRAGHTGRRCESVINGCRGKPCRNGGVCAVASNTARGFICRCPAGFEGATCENDARTCG-SLRCLNGGTCIS 1365          
BLAST of Hyaluronan binding protein 2 vs. TrEMBL
Match: A0A3M6TW66 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00010603 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.687e-17
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 2
Query:  554 CSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CS+I+ CE  +   C+N G C   Y    C CPS + G  CE D++ C+N  C N   C  +  S   Y+C CP  +QG  C  DV+EC   + C++ ATC N  G Y C
Sbjct:  201 CSDINECESSDGDPCENGGTCENTYGSFWCACPSGFVGKRCERDRNECVNWPCENGGKCINTRGS---YECSCPETYQGEHCERDVDECLTNNPCKNGATCTNLPGDYKC 307          

HSP 2 Score: 95.9005 bits (237), Expect = 5.576e-17
Identity = 49/124 (39.52%), Postives = 65/124 (52.42%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL-NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   ++   C E D  E +N   C+N GKCI       C CP  Y G+ CE D D CL NN C N +TC   P     YKC CP  ++G  C +DVNEC+  + C++  TC+N +G + C
Sbjct:  228 FWCACPSGFVGKRC-ERDRNECVNWP-CENGGKCINTRGSYECSCPETYQGEHCERDVDECLTNNPCKNGATCTNLPGD---YKCDCPKGWEGKNCDQDVNECT-STPCKNGGTCVNLHGSFEC 345          

HSP 3 Score: 77.7962 bits (190), Expect = 3.569e-11
Identity = 44/129 (34.11%), Postives = 60/129 (46.51%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC----SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC--SDKSSCRSNATCINNYGGYNC 883
            +  KC+  +   +C     E DF    +   C++N  CI   +   C+CPS   G  CE D D C   +C N +TC  +  S   Y C C   F+G  C  D+NEC  SD   C +  TC N YG + C
Sbjct:  109 YECKCRPGFSGKHCDCVVKECDF----DKNPCRHNATCIDMGSDYICKCPSGIKGRHCEIDIDECDALACSNEATCINTVGS---YMCKCRPGFKGKTCCSDINECESSDGDPCENGGTCENTYGSFWC 230          
BLAST of Hyaluronan binding protein 2 vs. TrEMBL
Match: A0A2B4SPX5 (Neurogenic locus Notch protein OS=Stylophora pistillata OX=50429 GN=N PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.050e-16
Identity = 50/124 (40.32%), Postives = 66/124 (53.23%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL-NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C K ++   C E D  E +N   C+N GKCI K     C CP  Y G+ CE D D CL NN C N + C         +KC CP  ++G  C +DVNEC+  S C++  TC+N +GG+ C
Sbjct:  234 FWCACPKGFIGKRC-ERDRDECVNGP-CENGGKCINKRGGYDCSCPDTYQGEHCEQDVDECLANNPCKNGAKCTNLQGD---FKCDCPKGWKGKKCDQDVNECT-SSPCKNGGTCVNLHGGFEC 351          

HSP 2 Score: 91.6633 bits (226), Expect = 1.597e-15
Identity = 40/110 (36.36%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  554 CSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CS+++ CE  N   C+N G C   Y    C CP  + G  CE D+D C+N  C N   C      +  Y C CP  +QG  C +DV+EC   + C++ A C N  G + C
Sbjct:  207 CSDVNECESSNGGPCENGGTCENTYGSFWCACPKGFIGKRCERDRDECVNGPCENGGKC---INKRGGYDCSCPDTYQGEHCEQDVDECLANNPCKNGAKCTNLQGDFKC 313          

HSP 3 Score: 68.9366 bits (167), Expect = 1.895e-8
Identity = 36/98 (36.73%), Postives = 48/98 (48.98%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC--SDKSSCRSNATCINNYGGYNC 883
            C++N  CI       C+CP+   G  CE D + C   +C N +TC  +  S   Y C C   F+G  C  DVNEC  S+   C +  TC N YG + C
Sbjct:  142 CRHNATCIDMGKDYICKCPTGVKGRNCETDINECNTVTCSNGATCINTVGS---YMCKCRPGFEGKKCCSDVNECESSNGGPCENGGTCENTYGSFWC 236          

HSP 4 Score: 66.2402 bits (160), Expect = 1.434e-7
Identity = 39/119 (32.77%), Postives = 55/119 (46.22%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAK-ISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINN 865
            F   C  D     C   ID C +     C N+G C+        C CP   TGD C+   D C  + C+NNSTC  +  +   +KC+CP    G  C   ++ CS+   C +N TC++N
Sbjct: 2639 FKCMCPPDVTGDRCQIRIDPCSEYP---CVNDGTCVDNGDNTFKCTCPPGVTGDRCQVRLDPCSKDPCVNNSTCVDNGGN--TFKCMCPAGVTGDRCQVRLDPCSE-YPCVNNGTCVDN 2751          

HSP 5 Score: 65.4698 bits (158), Expect = 2.962e-7
Identity = 35/98 (35.71%), Postives = 47/98 (47.96%), Query Frame = 2
Query:  596 CKNNGKCIQKYAK-ISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            C NNG C+        C CP   TGD C+   D C    C+N+ TC  +  +   +KC+CP    G  C  D++EC  DK  C+    C+N  G Y C
Sbjct: 2937 CVNNGTCVDNGDNTFKCMCPPGVTGDRCQVRIDPCSEYPCVNDGTCVDNGDN--TFKCMCPPGVTGDRCQVDIDECLDDKGHCQD--ICVNTIGSYYC 3030          

HSP 6 Score: 64.6994 bits (156), Expect = 4.369e-7
Identity = 33/91 (36.26%), Postives = 47/91 (51.65%), Query Frame = 2
Query:  596 CKNNGKCI-QKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINN 865
            C NNG C+  +     C CP   TGD C+   D C  + C+NN TC  +  +   +KC+CP    G  C   ++ CS K  C +N TC++N
Sbjct: 2859 CVNNGTCVDNENNTFKCMCPPGVTGDRCQVRLDPCSKDPCVNNGTCVDNGDN--TFKCMCPPGVTGDRCQVRLDPCS-KDPCVNNGTCVDN 2946          

HSP 7 Score: 63.1586 bits (152), Expect = 1.241e-6
Identity = 32/91 (35.16%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  596 CKNNGKCIQKYAK-ISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINN 865
            C N+G C+        C CP   TGD C+   D C  + C+NN TC  +  +   +KC+CP    G  C   ++ CS K  C +N TC++N
Sbjct: 2820 CVNDGTCVDNGDNTFKCMCPPGVTGDRCQVRPDPCSKDPCVNNGTCVDNENN--TFKCMCPPGVTGDRCQVRLDPCS-KDPCVNNGTCVDN 2907          

HSP 8 Score: 61.6178 bits (148), Expect = 3.708e-6
Identity = 32/93 (34.41%), Postives = 47/93 (50.54%), Query Frame = 2
Query:  596 CKNNGKCIQKYAK-ISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYG 871
            C N+G C+        C CP + TGD C+   D C    C+N+ TC  +  +   +KC CP    G  C   ++ CS K  C +N+TC++N G
Sbjct: 2625 CANDGTCVDNGDNTFKCMCPPDVTGDRCQIRIDPCSEYPCVNDGTCVDNGDNT--FKCTCPPGVTGDRCQVRLDPCS-KDPCVNNSTCVDNGG 2714          

HSP 9 Score: 61.2326 bits (147), Expect = 5.654e-6
Identity = 31/91 (34.07%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  596 CKNNGKCIQKYAK-ISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINN 865
            C NNG C+        C CP   TGD C+   D C  + C+NN TC  +  +   +KC+CP    G  C   ++ CS+   C ++ TC++N
Sbjct: 2898 CVNNGTCVDNGDNTFKCMCPPGVTGDRCQVRLDPCSKDPCVNNGTCVDNGDN--TFKCMCPPGVTGDRCQVRIDPCSE-YPCVNDGTCVDN 2985          
BLAST of Hyaluronan binding protein 2 vs. TrEMBL
Match: A0A4C1YMN5 (Protein crumbs OS=Eumeta variegata OX=151549 GN=crb PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.065e-15
Identity = 41/96 (42.71%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C + G+C       +C CP+ ++GD CE D D CL N C N +TCQ   AS   Y C+CP  F GTFC  D++EC + S C    TC +  GG+ C
Sbjct: 1496 CSHGGRCADVRHSYACSCPAGFSGDRCEIDVDECLQNECRNGATCQDELAS---YTCLCPPGFNGTFCEHDIDEC-ESSPCAHGGTCSDQPGGFEC 1587          

HSP 2 Score: 77.411 bits (189), Expect = 4.128e-11
Identity = 42/109 (38.53%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  557 SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +EID C  +   +C N G CI+      C C   YTGD CE D D CL++ C N  TCQ     +  Y+C C   F G  C  ++NEC + S C   ATC++    Y+C
Sbjct:   99 NEIDVCAVM-PKIC-NQGVCIKGVGSFQCYCKPGYTGDRCEQDIDECLSSPCKNGGTCQ---NLENNYECNCMAGFTGKDCSTNINEC-ESSPCAEGATCVDGIASYSC 201          
BLAST of Hyaluronan binding protein 2 vs. TrEMBL
Match: A0A2G9SJ07 (Uncharacterized protein OS=Lithobates catesbeianus OX=8400 GN=AB205_0191720 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 4.277e-15
Identity = 43/124 (34.68%), Postives = 64/124 (51.61%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +++  C   Y   +C  +D  E   + LC+N G+CI       C CPS +TG FCE +   C  + C+N  TC+  P   L Y+C+C   F G  C  +V++C D   C + ATC++    YNC
Sbjct:  124 RYNCTCPPGYQGRSC-RLDIDECRTSGLCQNGGQCINTPGSFRCRCPSSFTGQFCEANYVPCAPSQCLNGGTCR--PTGDLSYQCVCLPGFDGPNCETNVDDCPDH-KCMNGATCVDGVNTYNC 243          

HSP 2 Score: 78.5666 bits (192), Expect = 1.772e-11
Identity = 43/132 (32.58%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS----DKSSCRS-----NATCINNYGGYNC 883
            F  +C + Y  P C E D  E L+T  C+N+  C+ +  + +C C + +TG FCE + + C ++ C+N   C+        + C CP  F+GT C  ++NECS        CR        TC   Y GY C
Sbjct:  398 FQCQCGRGYTGPRC-ETDVNECLSTP-CQNDATCLDRIGEFTCICMAGFTGTFCELNINECDSSPCVNGGLCKDMVNG---FTCSCPAGFEGTLCERNINECSPDPCHHGKCRDGIASFTCTCDPGYTGYRC 524          

HSP 3 Score: 73.1738 bits (178), Expect = 8.531e-10
Identity = 36/108 (33.33%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++D C  +    C++ G+C+       C+C   YTG  CE D + CL+  C N++TC        ++ CIC   F GTFC  ++NEC D S C +   C +   G+ C
Sbjct:  374 DVDECS-IGANPCEHFGRCVNTQGSFQCQCGRGYTGPRCETDVNECLSTPCQNDATCLDRIG---EFTCICMAGFTGTFCELNINEC-DSSPCVNGGLCKDMVNGFTC 476          

HSP 4 Score: 72.4034 bits (176), Expect = 1.413e-9
Identity = 41/121 (33.88%), Postives = 59/121 (48.76%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            C   +   +CSE ID C    T +C N   C  + A   CECP   TG  C  + D+C++N C  ++ C  +P +  +  C CP  F G  C +DV+ECS   + C     C+N  G + C
Sbjct:  285 CVNGWTGESCSENIDDCA---TAVCFNGATCHDRVASFYCECPMGKTGLLCHLE-DACVSNPCHKDAMCDTNPVNG-RAICTCPPGFTGGACDQDVDECSIGANPCEHFGRCVNTQGSFQC 400          

HSP 5 Score: 65.0846 bits (157), Expect = 2.784e-7
Identity = 36/128 (28.12%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  509 IQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + +   C   +  PNC + +D C       C N   C+      +C+CP E+TG FC +D D C    N+C N  TC  +      + C+C   + G  C E++++C+  + C + ATC +    + C
Sbjct:  201 LSYQCVCLPGFDGPNCETNVDDCPDHK---CMNGATCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTQGG---HTCVCVNGWTGESCSENIDDCA-TAVCFNGATCHDRVASFYC 321          
BLAST of Hyaluronan binding protein 2 vs. TrEMBL
Match: K1RU24 (Neurogenic locus Notch protein OS=Crassostrea gigas OX=29159 GN=CGI_10022703 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.995e-15
Identity = 48/123 (39.02%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS +C + ++ P C +IDF E +    C+N G C        C CP  YTG  C  D + CL+N C + + C  +P S   ++CICP  ++GT C +D NEC + ++C +  TCIN  GGY C
Sbjct: 2861 FSCQCPEGWMGPLC-DIDFNECMQLP-CRNGGTCKNLDGSFECICPEGYTGTLCTGDINECLSNPCQHGARCIDTPGS---FQCICPPQWEGTLCDKDKNECLNPNACLNGGTCININGGYQC 2978          

HSP 2 Score: 80.4925 bits (197), Expect = 5.668e-12
Identity = 43/120 (35.83%), Postives = 61/120 (50.83%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSS-CRSNATCINNYGGYNC 883
            C +     NC E D  E +   +C+N G C  +     C C   +TG  CE D D C+NN C +  TC  +P S   Y+C+CP  + G +C  D++EC +  + C +  TC N  GGY C
Sbjct:  893 CVEGRTGKNC-EHDINECVQENICQNGGTCFNRPGSFYCSCAQGWTGTLCETDVDECVNNVCQHGGTCLNTPGS---YRCLCPTGWTGKYCERDIHECVEYGNVCSNGGTCRNLMGGYIC 1008          

HSP 3 Score: 77.0258 bits (188), Expect = 7.310e-11
Identity = 38/96 (39.58%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CK  G CI       C+CP   +G  C++D D CLNN C+N +TC+    S   +KC CP  F G  C  ++NEC     C++ ATC +++G Y+C
Sbjct: 3157 CKFGGTCIDTVGSYICQCPPGRSGRNCDNDTDECLNNPCLNGATCENLVGS---FKCTCPPGFTGERCESNINECVLYRPCKNGATCYDSFGSYSC 3249          

HSP 4 Score: 76.6406 bits (187), Expect = 9.744e-11
Identity = 41/96 (42.71%), Postives = 50/96 (52.08%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C + G C        CECP +YTG  CE D D C    C NN+TCQ    S   Y+C+C   F+G +C +D+NEC   S C     CIN  GGY C
Sbjct: 2465 CIHGGVCRNTNGSYVCECPEQYTGKNCELDMDECRMIQCQNNATCQNLDGS---YRCVCREGFEGKYCEKDINECLTLSPCLHGGKCINLMGGYRC 2557          

HSP 5 Score: 76.2554 bits (186), Expect = 1.211e-10
Identity = 46/156 (29.49%), Postives = 79/156 (50.64%), Query Frame = 2
Query:  422 TVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS-CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            T E+   D+N          N    ++ +  ++ +C + +   NC+ ++D C+     +CKN   C+      +C CP  + G+ CE DK+ CLN++ C NN+ C  +  S   + C C + ++G +CH D+NEC   + C ++A C N  G Y C
Sbjct: 2985 TGEYCTMDINECIEFVGICQNGGFCINTLGGYTCRCTEQWEGANCTIDVDECK---MQVCKNGATCVNTPGGFTCTCPPGWQGNMCEQDKNECLNSTLCQNNALCINTQGS---FTCQCQVGWEGKYCHIDINECLVNNPCLNDAICENTPGSYIC 3134          

HSP 6 Score: 75.0998 bits (183), Expect = 2.327e-10
Identity = 46/123 (37.40%), Postives = 63/123 (51.22%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  C+  +   NC E+D  E L    C NNG CI  Y    C CP  +TG +C DD + CL  SC N  TC     S   Y+C CP+ + G  C  D +EC  ++ C + ATC N  G ++C
Sbjct: 1899 YTCMCKDGWTGANC-EVDIDECLRNP-CFNNGSCINSYGSYYCRCPVGWTGPYCLDDFNECLQFSCANGGTCINIQGS---YQCRCPVGWTGHNCEIDEDECK-RNPCLNGATCYNTVGSFSC 2015          

HSP 7 Score: 73.1738 bits (178), Expect = 1.141e-9
Identity = 43/108 (39.81%), Postives = 56/108 (51.85%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            E D  E L  + C + GKCI       CECP  + G  C  DKD C+   C +  TC  +  S   Y+CICP  F G  C  D NEC +++ C++N TC N +G Y C
Sbjct: 2530 EKDINECLTLSPCLHGGKCINLMGGYRCECPEGWIGKDCNRDKDECMYFPCKHGGTCVNNDGS---YRCICPPGFTGPTCDLDRNEC-EQNPCQNNGTCRNTHGSYYC 2633          

HSP 8 Score: 72.7886 bits (177), Expect = 1.370e-9
Identity = 42/125 (33.60%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNN--SCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  +C++ +   NC E+D  E +  + C + G C        C CP ++TG+ CE D D C+ +   C++  TC      +  Y C CPI + G  C  DVNEC     CR+  TC N  G Y C
Sbjct: 1704 YRCRCKEGWKGRNC-ELDINECMVASPCLHGGSCFNTMGSFRCTCPPQWTGERCETDVDECMGSFPPCLHGGTCI---NIQGGYTCQCPIGWTGRNCEIDVNECITMKPCRNGGTCQNIDGSYLC 1824          

HSP 9 Score: 72.4034 bits (176), Expect = 1.872e-9
Identity = 45/124 (36.29%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCE-KLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++ KC + +   NC +ID  E  L  ++C++ G+CI      +C CP+ +TG  C  D + CL N C+NN TC  +  S   + C CP  + G  C EDVNEC     C++ A+C N  G + C
Sbjct: 2707 YNCKCTQYWQGENC-QIDVNECALAYSVCEHGGQCINLAGNFTCNCPAGWTGHGCRIDVNECLLNPCMNNGTCINTDGS---FICRCPPGWTGPTCSEDVNECP-MFLCKNGASCQNTLGSFVC 2825          

HSP 10 Score: 72.0182 bits (175), Expect = 2.514e-9
Identity = 43/121 (35.54%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  524 KCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            KC K +  P C  ID  E +N   C+N G C+       C CP  ++G  CE + + CLNN C N  TC  +P S   Y C C   + G+ C +DV+EC  +++ C     C N  G + C
Sbjct: 1318 KCSKGWTGPRC-RIDVDECINRP-CENGGTCVNLPGNYECICPRGFSGPHCEKEHNECLNNPCENGGTCFNTPGS---YYCSCKTGWTGSNCTQDVDECLFERAVCMFGGVCTNTIGSFKC 1433          

HSP 11 Score: 72.0182 bits (175), Expect = 2.581e-9
Identity = 46/140 (32.86%), Postives = 64/140 (45.71%), Query Frame = 2
Query:  470 FHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN--NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   N    ++    +  +C   +   NC EID  ++     C N   C       SC CP  + G  C++D + CL     C N  TC  +  S   YKC CP+ ++G  C  D+NEC D + C + ATCIN  G Y C
Sbjct: 1960 FSCANGGTCINIQGSYQCRCPVGWTGHNC-EIDE-DECKRNPCLNGATCYNTVGSFSCVCPEGFLGHLCDNDTNECLQFPGICRNGGTCFNTEGS---YKCDCPLGWRGKNCGIDINECMDINLCSNGATCINTEGSYKC 2094          

HSP 12 Score: 71.633 bits (174), Expect = 3.069e-9
Identity = 40/124 (32.26%), Postives = 61/124 (49.19%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  KC   +    C+ +I+ C +    +C+N G CI      +C C  ++ G  C  D D C    C N +TC  +P     + C CP  +QG  C +D NEC + + C++NA CIN  G + C
Sbjct: 2976 YQCKCPPGFTGEYCTMDINECIEF-VGICQNGGFCINTLGGYTCRCTEQWEGANCTIDVDECKMQVCKNGATCVNTPGG---FTCTCPPGWQGNMCEQDKNECLNSTLCQNNALCINTQGSFTC 3095          

HSP 13 Score: 71.2478 bits (173), Expect = 4.016e-9
Identity = 47/130 (36.15%), Postives = 64/130 (49.23%), Query Frame = 2
Query:  497 LSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            L+    +   C K+    NC  ++D C   +   CK+ G C+      +C C   +TG  CE D D CL N C NN +C  S  S   Y C CP+ + G +C +D NEC  + SC +  TCIN  G Y C
Sbjct: 1854 LNTRGSYMCTCPKERTGHNCLDDVDECVLFSP--CKHGGTCLNINGGYTCMCKDGWTGANCEVDIDECLRNPCFNNGSCINSYGS---YYCRCPVGWTGPYCLDDFNECL-QFSCANGGTCINIQGSYQC 1977          

HSP 14 Score: 70.4774 bits (171), Expect = 7.692e-9
Identity = 44/123 (35.77%), Postives = 58/123 (47.15%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++ +C   +   NC EID  E +    C+N G C        C+C   +T   C  D D CL N C+ N TC  +  S   Y C CP    G  C +DV+EC   S C+   TC+N  GGY C
Sbjct: 1783 YTCQCPIGWTGRNC-EIDVNECITMKPCRNGGTCQNIDGSYLCQCKEGWTDPDCTTDVDECLRNPCMYNGTCLNTRGS---YMCTCPKERTGHNCLDDVDECVLFSPCKHGGTCLNINGGYTC 1901          

HSP 15 Score: 70.4774 bits (171), Expect = 8.103e-9
Identity = 38/99 (38.38%), Postives = 54/99 (54.55%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN-NSCINNSTC-QISPASKLKYKCICPIYFQGTFCHEDVNECSD-KSSCRSNATCINNYGGYNC 883
            C++  +CI       C CP ++ G  C+ DK+ CLN N+C+N  TC  I+      Y+C CP  F G +C  D+NEC +    C++   CIN  GGY C
Sbjct: 2924 CQHGARCIDTPGSFQCICPPQWEGTLCDKDKNECLNPNACLNGGTCININGG----YQCKCPPGFTGEYCTMDINECIEFVGICQNGGFCINTLGGYTC 3018          

HSP 16 Score: 69.707 bits (169), Expect = 1.282e-8
Identity = 39/97 (40.21%), Postives = 52/97 (53.61%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN-NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CKN   C   +   SC C   +TG  C+ + + CL    C N + C  +P S   YKCICP  + GT C  D+NEC D+  C++ A CINN G + C
Sbjct: 3234 CKNGATCYDSFGSYSCSCAPGWTGKDCDTEINECLVIRPCQNGAECVNTPGS---YKCICPPGWTGTNCEIDINECYDR-PCKNGAQCINNQGSFTC 3326          

HSP 17 Score: 68.9366 bits (167), Expect = 2.064e-8
Identity = 46/143 (32.17%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  464 KPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSD-KSSCRSNATCINNYGGYNC 883
            K +   N    ++ +  +   C   +  P C + D  E LN T+C N G+CI K    +C C   +TG  C  D + C    N C+N +TC     +   + CICP  ++G  C  D+NEC    S C+   TC N  G Y C
Sbjct: 1491 KGYPCRNKGTCVNTVGSYKCNCLPQWTGPIC-DFDVNECLNLTICHNGGECINKVGSYACSCKEGWTGQHCHIDYNECAKDRNPCMNGATCDNRNGT---FNCICPKGWKGVHCDIDINECETLVSPCQFGGTCNNIDGSYYC 1629          

HSP 18 Score: 68.9366 bits (167), Expect = 2.310e-8
Identity = 40/119 (33.61%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C K +  P C+      + +++ C NNGKCI       CEC   +TG+ CE +K+ CLN  C++  +C+ +  S   ++C C   + G  C +DVNEC  ++ C     C N  G Y C
Sbjct: 2368 CAKGWGGPQCNNDT--NECDSSPCLNNGKCINTEGGYLCECTPGWTGNRCERNKNECLNYPCLHGGSCRDTIGS---FRCTCTQGWTGEICKDDVNECL-RNPCIHGGVCRNTNGSYVC 2480          

HSP 19 Score: 68.1662 bits (165), Expect = 3.409e-8
Identity = 46/144 (31.94%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  455 INNKPFHL-TNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +N  P  L  N     + +  F  +C   +  P C +ID  E L    C + G+CI      SC+CP  + G  C+ D + C+   C N  TC+    S   ++CICP  + GT C  D+NEC   + C+  A CI+  G + C
Sbjct: 2802 VNECPMFLCKNGASCQNTLGSFVCQCLLGWEGPLC-DIDINECL-MNPCLHGGRCINSPGSFSCQCPEGWMGPLCDIDFNECMQLPCRNGGTCKNLDGS---FECICPEGYTGTLCTGDINECL-SNPCQHGARCIDTPGSFQC 2939          

HSP 20 Score: 67.781 bits (164), Expect = 5.030e-8
Identity = 42/130 (32.31%), Postives = 65/130 (50.00%), Query Frame = 2
Query:  497 LSFMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++ M  +  +C + ++  +C+ + D C       CK+ G C+       C CP  +TG  C+ D++ C  N C NN TC+ +  S   Y C C   +QG  C +DV+EC + + C    TCIN  G Y C
Sbjct: 2549 INLMGGYRCECPEGWIGKDCNRDKDECMYF---PCKHGGTCVNNDGSYRCICPPGFTGPTCDLDRNECEQNPCQNNGTCRNTHGS---YYCECSYGWQGPLCSDDVDEC-NLNPCLYGGTCINTPGSYVC 2671          

HSP 21 Score: 67.3958 bits (163), Expect = 5.827e-8
Identity = 40/123 (32.52%), Postives = 55/123 (44.72%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +   C   +   NC  ID  E ++  LC N   CI       C CP  + G  C  D + CL+N C+N + C  +P     Y C C   + G  C  D +EC +   C   ++CIN  GGY C
Sbjct: 2053 YKCDCPLGWRGKNCG-IDINECMDINLCSNGATCINTEGSYKCRCPPGFEGPLCSKDINECLSNPCVNGAECINTPGG---YTCNCKEGWTGLNCANDTDECLN-FPCLHGSSCINTPGGYEC 2170          

HSP 22 Score: 67.3958 bits (163), Expect = 6.926e-8
Identity = 44/125 (35.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN-NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS  C + +L   C ++ + C +    +C+N G C        C+CP  + G  C  D + C++ N C N +TC  +  S   YKC CP  F+G  C +D+NEC   + C + A CIN  GGY C
Sbjct: 2013 FSCVCPEGFLGHLCDNDTNECLQF-PGICRNGGTCFNTEGSYKCDCPLGWRGKNCGIDINECMDINLCSNGATCINTEGS---YKCRCPPGFEGPLCSKDINECL-SNPCVNGAECINTPGGYTC 2132          

HSP 23 Score: 67.0106 bits (162), Expect = 9.454e-8
Identity = 41/135 (30.37%), Postives = 64/135 (47.41%), Query Frame = 2
Query:  479 TNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            T     +  M  +   C   +   +C ++D  E      CK+N  CI+      CEC   + G  CE D+  C +N C+N +TC  +  S   + C CP  + G  C+ED +EC   S C++  +C+N  G Y+C
Sbjct: 1072 TGHGECIDTMGSYRCICNPGWTGSHC-DMDIPECSLLKPCKHNSTCIEMQGGYRCECLPGFQGKHCEGDEFECASNPCLNGATCMETFGS---FYCSCPPGWTGPRCNEDPDECL-TSPCKNGGSCVNTRGSYSC 1201          

HSP 24 Score: 64.6994 bits (156), Expect = 5.178e-7
Identity = 41/123 (33.33%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +  P C+E    ++  T+ CKN G C+      SC C   ++G  C    D C+N+ C+N   C++   S  +Y C CP  + G  C  D +EC  + SC +NATC+N  G + C
Sbjct: 1161 FYCSCPPGWTGPRCNEDP--DECLTSPCKNGGSCVNTRGSYSCICVDGWSGMDCTIIDDWCINSPCLNGGVCEMM-NSIGRYTCNCPPGWVGRECSVDDDECLHR-SCLNNATCLNTPGSFVC 1279          

HSP 25 Score: 64.6994 bits (156), Expect = 5.223e-7
Identity = 41/124 (33.06%), Postives = 56/124 (45.16%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C   +  P CSE ++ C      LCKN   C        C+C   + G  C+ D + CL N C++   C  SP S   + C CP  + G  C  D NEC  +  CR+  TC N  G + C
Sbjct: 2785 FICRCPPGWTGPTCSEDVNECPMF---LCKNGASCQNTLGSFVCQCLLGWEGPLCDIDINECLMNPCLHGGRCINSPGS---FSCQCPEGWMGPLCDIDFNECM-QLPCRNGGTCKNLDGSFEC 2901          

HSP 26 Score: 63.5438 bits (153), Expect = 1.175e-6
Identity = 45/137 (32.85%), Postives = 64/137 (46.72%), Query Frame = 2
Query:  479 TNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS--CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +N     + M  +   C   +   NC+ ID  E  N   C+N+  CI+      CECP  YTG  C+ + + CL     C  +  C  +  S   Y+CIC   + G+ C  D+ ECS    C+ N+TCI   GGY C
Sbjct:  994 SNGGTCRNLMGGYICTCPIGWTGDNCT-IDVKECQNNP-CRNSLGCIELEGSYKCECPPGYTGQNCDININECLTMDLPCTGHGECIDTMGS---YRCICNPGWTGSHCDMDIPECSLLKPCKHNSTCIEMQGGYRC 1125          

HSP 27 Score: 63.1586 bits (152), Expect = 1.420e-6
Identity = 39/124 (31.45%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+  C K +   +C  +I+ CE L  + C+  G C        C CP    GD+CE +   CL   C+NN  C      +  ++C C   + G +C  D NEC   + C+   TC+N +G Y C
Sbjct: 1587 FNCICPKGWKGVHCDIDINECETL-VSPCQFGGTCNNIDGSYYCICPPYRGGDYCEINIQECLTMPCMNNGRCI---DLEDGFRCECSQAYTGEYCQNDANECELSNPCQHEGTCVNTHGSYRC 1706          

HSP 28 Score: 62.3882 bits (150), Expect = 2.640e-6
Identity = 44/137 (32.12%), Postives = 64/137 (46.72%), Query Frame = 2
Query:  482 NSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS--CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            N    L F   ++  C   +   +C   D  +    T C NNG+CI +     C+C   + G++C+   + C  N   C N  TC     +   Y+CICP  F G  C E+VNEC +D + C +  TC + YG Y C
Sbjct: 2236 NGATCLDFAGGYNCTCLPGFKGEHC---DIEQSCLHTPCLNNGQCISRNGIYFCKCTDLWKGEYCDTPVNICTENPDICHNGGTCNYLGEN---YECICPPGFNGKHCTENVNECKADINPCFNGGTCFDLYGTYEC 2366          

HSP 29 Score: 62.003 bits (149), Expect = 3.389e-6
Identity = 43/123 (34.96%), Postives = 51/123 (41.46%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C      P C  ID  E L    C N  +CI       C C   +TG  C DD + C    C N  TC  +  S   YKC C   + G  C  DVNEC + + C +   CIN  G Y C
Sbjct: 1431 FKCVCPPGRSGPTCV-IDIDECLLANPCGNGAQCINTDGSYKCLCTPGWTGINCTDDDNECKGYPCRNKGTCVNTVGS---YKCNCLPQWTGPICDFDVNECLNLTICHNGGECINKVGSYAC 1549          

HSP 30 Score: 61.6178 bits (148), Expect = 4.239e-6
Identity = 40/129 (31.01%), Postives = 66/129 (51.16%), Query Frame = 2
Query:  497 LSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++ + +++  C   ++   CS +D  E L+ + C NN  C+       C+C + + G+ CE D++ CLN  C N+ TC  +  S   Y C C   + G  C  DV+EC ++  C +  TC+N  G Y C
Sbjct: 1233 MNSIGRYTCNCPPGWVGRECS-VDDDECLHRS-CLNNATCLNTPGSFVCQCNTGWEGNICERDQNECLNFPCENDGTCTNTLGS---YLCKCSKGWTGPRCRIDVDECINR-PCENGGTCVNLPGNYEC 1355          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Cavefish
Match: notch3 (neurogenic locus notch homolog protein 2 [Source:NCBI gene;Acc:103042072])

HSP 1 Score: 79.7221 bits (195), Expect = 3.092e-15
Identity = 43/123 (34.96%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C EID  E L+   C+N+  C+ +  + +C C   YTG  CE D D C +N C+N+  C+    +   + C C   F GT C  D++EC+  + C++ A CI+   GY C
Sbjct:  391 FQCQCGRGYTGPRC-EIDINECLSMP-CQNDATCLDRIGEFTCICMPGYTGTHCEIDIDECESNPCVNDGICRDLVNA---FTCTCQTGFTGTMCQIDIDECA-STPCQNGAKCIDRPNGYEC 507          

HSP 2 Score: 67.0106 bits (162), Expect = 3.224e-11
Identity = 40/125 (32.00%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
             ++  C   +   NC ++ID C K     C N G CI  +    CEC S Y+G  CE     C  + C+N  TC         Y+C C   F GT C  +V++C     C +  TC++    YNC
Sbjct:  117 HYNCSCPPGFQGKNCRNDIDECRKPGK--CLNGGICINTHGSFRCECVSGYSGRTCEVPTQPCAPSQCLNGGTCH--QTGDHTYECACLPGFGGTNCEVNVDDCPGH-KCMNGGTCVDGVNTYNC 236          

HSP 3 Score: 66.6254 bits (161), Expect = 4.363e-11
Identity = 33/97 (34.02%), Postives = 49/97 (50.52%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC   G C+       C+CP++YTG +CE   D C +  C+N +TC+        Y C C   ++G  C  ++NEC     C++  TCI+  G Y C
Sbjct: 1069 LCHRGGHCVNTGNTHYCKCPNDYTGSYCESQVDHCEDKPCLNGATCRGYVGG---YTCDCMPGYEGQNCEREINECRSH-PCQNGGTCIDLVGHYIC 1161          

HSP 4 Score: 66.6254 bits (161), Expect = 4.716e-11
Identity = 41/121 (33.88%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            C   +   +CSE ID C    T +C N   C  + A   CECP   TG  C  D D+C++N C   + C  +P +  +  C CP  F G  C +D++ECS   + C     C+N  G + C
Sbjct:  278 CVNGWTGDDCSENIDDCA---TAVCFNGATCHDRVASFYCECPVGKTGLLCHLD-DACVSNPCNEGAVCDTNPLNG-RAICTCPAGFIGGACIQDMDECSIGANPCEHFGKCVNTVGSFQC 393          

HSP 5 Score: 63.5438 bits (153), Expect = 3.949e-10
Identity = 38/125 (30.40%), Postives = 54/125 (43.20%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLK-YKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +  P C+ E+D C+   +  CKN G C       +C C   +TG  CE +   C  +SC N  TC      K+  + C C + F G  C  +VNEC D   C +   C +    + C
Sbjct:  884 FYCTCLPGFTGPRCAIEVDECQ---SAPCKNGGTCTDYVNSYTCTCKPGFTGLHCETNAMDCTESSCFNGGTC----VDKINGFSCTCRVGFTGEHCQYEVNEC-DSQPCLNGGVCQDGLESFRC 1000          

HSP 6 Score: 62.3882 bits (150), Expect = 9.357e-10
Identity = 36/123 (29.27%), Postives = 53/123 (43.09%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYA----KISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+  Y+ P C  +D C +   + C N   C  + A    + +C C   + G  C    D+C  + C N + C         Y C CP  FQG  C  D++EC     C +   CIN +G + C
Sbjct:   44 CRPGYIGPLCQHLDPCHR---SPCLNGAACKSQVANGVPQFTCVCQRGFRGQNCSL-IDACATSPCANGARCT---NWNNHYNCSCPPGFQGKNCRNDIDECRKPGKCLNGGICINTHGSFRC 159          

HSP 7 Score: 59.3066 bits (142), Expect = 7.996e-9
Identity = 34/120 (28.33%), Postives = 58/120 (48.33%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C  ++D C  +    C++ GKC+       C+C   YTG  CE D + CL+  C N++TC        ++ CIC   + GT C  D++EC + + C ++  C +    + C
Sbjct:  355 CPAGFIGGACIQDMDECS-IGANPCEHFGKCVNTVGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIG---EFTCICMPGYTGTHCEIDIDEC-ESNPCVNDGICRDLVNAFTC 469          

HSP 8 Score: 58.9214 bits (141), Expect = 9.663e-9
Identity = 31/96 (32.29%), Postives = 51/96 (53.12%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N GKC+    K  C+C    +G  CE + D C +N C     C+       +Y C+C   F G  C+ +++ECS  + CR+  TC+++  G++C
Sbjct:  567 CQNGGKCVDLVNKYICQCQHGTSGTNCEINYDDCASNPC-EYGMCKDGIN---RYDCVCKPGFTGPQCNVELDECS-SNPCRNGGTCVDDENGFHC 657          

HSP 9 Score: 58.151 bits (139), Expect = 1.907e-8
Identity = 30/98 (30.61%), Postives = 51/98 (52.04%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C+      +C+CP E+TG +C +D + CL   N+C N  TC  +      + C+C   + G  C E++++C+  + C + ATC +    + C
Sbjct:  221 CMNGGTCVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGG---HTCVCVNGWTGDDCSENIDDCA-TAVCFNGATCHDRVASFYC 314          

HSP 10 Score: 57.7658 bits (138), Expect = 2.447e-8
Identity = 40/160 (25.00%), Postives = 69/160 (43.12%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC----------------------QISPASK---------------LKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  +C+  ++  NC ++D  + L    C+N G CI +    +C+C   + G+ C+ + + C ++ C+N  TC                       ++P S                  Y+C C   +QG  C+ DVNEC+  + C++  TC N  GGY C
Sbjct:  692 YRCECEPGWVGKNC-DLDRNDCLPNP-CQNAGTCIDQLNGFTCKCRQGFRGNQCQVNINECASSPCLNQGTCVDGVASFTCLCEAPYSGPTCAEVLTPCSPNPCSNHAVCTHTPDYFGYQCNCQPGWQGHLCNIDVNECA-SNPCKNRGTCTNTLGGYVC 848          

HSP 11 Score: 56.9954 bits (136), Expect = 4.100e-8
Identity = 28/96 (29.17%), Postives = 45/96 (46.88%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C+ K    SC C   +TG+ C+ + + C +  C+N   CQ    S   ++C CP  + G+ C   V+ C   + C++   C    G  +C
Sbjct:  947 CFNGGTCVDKINGFSCTCRVGFTGEHCQYEVNECDSQPCLNGGVCQDGLES---FRCSCPKGYTGSRCQVRVDWCRHSNPCQNGGRCRPKDGSCDC 1039          

HSP 12 Score: 56.6102 bits (135), Expect = 5.635e-8
Identity = 30/96 (31.25%), Postives = 43/96 (44.79%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CKN G C        C C   Y+G  CE D + CL N C++  +C     +   + C C   F G  C  +V+EC   + C++  TC +    Y C
Sbjct:  833 CKNRGTCTNTLGGYVCSCRGGYSGPNCETDINDCLPNPCMSGGSCTDGINT---FYCTCLPGFTGPRCAIEVDECQ-SAPCKNGGTCTDYVNSYTC 924          

HSP 13 Score: 56.225 bits (134), Expect = 6.986e-8
Identity = 33/120 (27.50%), Postives = 58/120 (48.33%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+  +  P C+ E+D C   ++  C+N G C+       C CP+ +   +C    D C ++ C++ + C+  P     Y+C C   + G  C  D N+C   + C++  TCI+   G+ C
Sbjct:  621 CKPGFTGPQCNVELDEC---SSNPCRNGGTCVDDENGFHCLCPAGFHEPYCFSHVDECSSSPCVHGA-CREDPDG---YRCECEPGWVGKNCDLDRNDCL-PNPCQNAGTCIDQLNGFTC 732          

HSP 14 Score: 55.8398 bits (133), Expect = 1.028e-7
Identity = 37/124 (29.84%), Postives = 56/124 (45.16%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+  CQ  +    C  +ID C    +T C+N  KCI +     C C   + G  CE + D+C  + C ++ TC    AS   Y C C   + G  C   +NEC   + C++   C++    Y C
Sbjct:  467 FTCTCQTGFTGTMCQIDIDECA---STPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCQPDPC-HHGTCVDGIAS---YTCNCVPGYTGYRCENQLNECH-SNPCQNGGKCVDLVNKYIC 582          

HSP 15 Score: 55.4546 bits (132), Expect = 1.342e-7
Identity = 33/116 (28.45%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHED----VNECSDKSSCRSN 847
            ++ +C  ++    C+E ++ C  +    C N G C       +C C + +TGD C ++ D C    C N +TC    AS   + C CP+   G  CH D     N C++ + C +N
Sbjct:  234 YNCQCPPEWTGQYCAEDVNEC-LMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVAS---FYCECPVGKTGLLCHLDDACVSNPCNEGAVCDTN 345          

HSP 16 Score: 55.0694 bits (131), Expect = 1.650e-7
Identity = 31/92 (33.70%), Postives = 41/92 (44.57%), Query Frame = 2
Query:  587 TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSC--INNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            T  C+NNG C+ +     C CP  YTGD CE D + C +N C   N+  C   P     Y C+C   F G  C      C +   C++   C
Sbjct: 1188 TPKCQNNGTCVDRVGGYRCNCPPGYTGDRCEGDINECHSNPCNAANSLDCIQLPND---YLCVCKPGFTGRGCQNRFGVC-ESQPCKNGGAC 1275          

HSP 17 Score: 55.0694 bits (131), Expect = 1.782e-7
Identity = 40/132 (30.30%), Postives = 55/132 (41.67%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS-------CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            ++  C   Y   NC  EI+ C    +  C+N G CI       C CP    G  CE ++D C   +       C NN TC         Y+C CP  + G  C  D+NEC S+  +  ++  CI     Y C
Sbjct: 1121 YTCDCMPGYEGQNCEREINECR---SHPCQNGGTCIDLVGHYICSCPPGTMGVLCEINEDDCATPTRPRGTPKCQNNGTCVDRVGG---YRCNCPPGYTGDRCEGDINECHSNPCNAANSLDCIQLPNDYLC 1246          

HSP 18 Score: 54.299 bits (129), Expect = 2.810e-7
Identity = 37/126 (29.37%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +  P C S +D C   +++ C + G C +      CEC   + G  C+ D++ CL N C N  TC  Q++      + C C   F+G  C  ++NEC+  S C +  TC++    + C
Sbjct:  655 FHCLCPAGFHEPYCFSHVDEC---SSSPCVH-GACREDPDGYRCECEPGWVGKNCDLDRNDCLPNPCQNAGTCIDQLN-----GFTCKCRQGFRGNQCQVNINECA-SSPCLNQGTCVDGVASFTC 770          

HSP 19 Score: 53.5286 bits (127), Expect = 5.081e-7
Identity = 39/134 (29.10%), Postives = 57/134 (42.54%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C K Y    C   +D+C   N   C+N G+C  K    SC+C   ++G +C+    SC           +  C     C  +  +   + C CP  + G++C   V+ C DK  C + ATC    GGY C
Sbjct:  998 FRCSCPKGYTGSRCQVRVDWCRHSNP--CQNGGRCRPKDG--SCDCVGGWSGRYCDIPGVSCEMAAMQRGLQTDELCHRGGHCVNTGNT---HYCKCPNDYTGSYCESQVDHCEDK-PCLNGATCRGYVGGYTC 1123          

HSP 20 Score: 52.7582 bits (125), Expect = 7.871e-7
Identity = 33/125 (26.40%), Postives = 50/125 (40.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQK--YAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+  C+  Y  P C+E+      +   C N+  C     Y    C C   + G  C  D + C +N C N  TC  +      Y C C   + G  C  D+N+C   + C S  +C +    + C
Sbjct:  768 FTCLCEAPYSGPTCAEV--LTPCSPNPCSNHAVCTHTPDYFGYQCNCQPGWQGHLCNIDVNECASNPCKNRGTCTNTLGG---YVCSCRGGYSGPNCETDINDCL-PNPCMSGGSCTDGINTFYC 886          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Cavefish
Match: notch3 (neurogenic locus notch homolog protein 2 [Source:NCBI gene;Acc:103042072])

HSP 1 Score: 79.7221 bits (195), Expect = 3.170e-15
Identity = 43/123 (34.96%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C EID  E L+   C+N+  C+ +  + +C C   YTG  CE D D C +N C+N+  C+    +   + C C   F GT C  D++EC+  + C++ A CI+   GY C
Sbjct:  332 FQCQCGRGYTGPRC-EIDINECLSMP-CQNDATCLDRIGEFTCICMPGYTGTHCEIDIDECESNPCVNDGICRDLVNA---FTCTCQTGFTGTMCQIDIDECA-STPCQNGAKCIDRPNGYEC 448          

HSP 2 Score: 67.0106 bits (162), Expect = 3.309e-11
Identity = 40/125 (32.00%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
             ++  C   +   NC ++ID C K     C N G CI  +    CEC S Y+G  CE     C  + C+N  TC         Y+C C   F GT C  +V++C     C +  TC++    YNC
Sbjct:   58 HYNCSCPPGFQGKNCRNDIDECRKPGK--CLNGGICINTHGSFRCECVSGYSGRTCEVPTQPCAPSQCLNGGTCH--QTGDHTYECACLPGFGGTNCEVNVDDCPGH-KCMNGGTCVDGVNTYNC 177          

HSP 3 Score: 66.6254 bits (161), Expect = 4.364e-11
Identity = 33/97 (34.02%), Postives = 49/97 (50.52%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC   G C+       C+CP++YTG +CE   D C +  C+N +TC+        Y C C   ++G  C  ++NEC     C++  TCI+  G Y C
Sbjct:  972 LCHRGGHCVNTGNTHYCKCPNDYTGSYCESQVDHCEDKPCLNGATCRGYVGG---YTCDCMPGYEGQNCEREINECRSH-PCQNGGTCIDLVGHYIC 1064          

HSP 4 Score: 66.2402 bits (160), Expect = 4.883e-11
Identity = 41/121 (33.88%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            C   +   +CSE ID C    T +C N   C  + A   CECP   TG  C  D D+C++N C   + C  +P +  +  C CP  F G  C +D++ECS   + C     C+N  G + C
Sbjct:  219 CVNGWTGDDCSENIDDCA---TAVCFNGATCHDRVASFYCECPVGKTGLLCHLD-DACVSNPCNEGAVCDTNPLNG-RAICTCPAGFIGGACIQDMDECSIGANPCEHFGKCVNTVGSFQC 334          

HSP 5 Score: 63.5438 bits (153), Expect = 4.020e-10
Identity = 38/125 (30.40%), Postives = 54/125 (43.20%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLK-YKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +  P C+ E+D C+   +  CKN G C       +C C   +TG  CE +   C  +SC N  TC      K+  + C C + F G  C  +VNEC D   C +   C +    + C
Sbjct:  789 FYCTCLPGFTGPRCAIEVDECQ---SAPCKNGGTCTDYVNSYTCTCKPGFTGLHCETNAMDCTESSCFNGGTC----VDKINGFSCTCRVGFTGEHCQYEVNEC-DSQPCLNGGVCQDGLESFRC 905          

HSP 6 Score: 62.3882 bits (150), Expect = 8.299e-10
Identity = 35/101 (34.65%), Postives = 45/101 (44.55%), Query Frame = 2
Query:  587 TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSC--INNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            T  C+NNG C+ +     C CP  YTGD CE D + C +N C   N+  C   P     Y C+C   F G  C      C +   C++   C   Y G NC
Sbjct: 1091 TPKCQNNGTCVDRVGGYRCNCPPGYTGDRCEGDINECHSNPCNAANSLDCIQLPND---YLCVCKPGFTGRGCQNRFGVC-ESQPCKNGGACSGGYTGTNC 1187          

HSP 7 Score: 59.3066 bits (142), Expect = 7.869e-9
Identity = 34/120 (28.33%), Postives = 58/120 (48.33%), Query Frame = 2
Query:  527 CQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C  ++D C  +    C++ GKC+       C+C   YTG  CE D + CL+  C N++TC        ++ CIC   + GT C  D++EC + + C ++  C +    + C
Sbjct:  296 CPAGFIGGACIQDMDECS-IGANPCEHFGKCVNTVGSFQCQCGRGYTGPRCEIDINECLSMPCQNDATCLDRIG---EFTCICMPGYTGTHCEIDIDEC-ESNPCVNDGICRDLVNAFTC 410          

HSP 8 Score: 58.9214 bits (141), Expect = 9.592e-9
Identity = 31/96 (32.29%), Postives = 51/96 (53.12%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N GKC+    K  C+C    +G  CE + D C +N C     C+       +Y C+C   F G  C+ +++ECS  + CR+  TC+++  G++C
Sbjct:  508 CQNGGKCVDLVNKYICQCQHGTSGTNCEINYDDCASNPC-EYGMCKDGIN---RYDCVCKPGFTGPQCNVELDECS-SNPCRNGGTCVDDENGFHC 598          

HSP 9 Score: 58.151 bits (139), Expect = 1.960e-8
Identity = 30/98 (30.61%), Postives = 51/98 (52.04%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C+      +C+CP E+TG +C +D + CL   N+C N  TC  +      + C+C   + G  C E++++C+  + C + ATC +    + C
Sbjct:  162 CMNGGTCVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGG---HTCVCVNGWTGDDCSENIDDCA-TAVCFNGATCHDRVASFYC 255          

HSP 10 Score: 56.9954 bits (136), Expect = 4.142e-8
Identity = 28/96 (29.17%), Postives = 45/96 (46.88%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C+ K    SC C   +TG+ C+ + + C +  C+N   CQ    S   ++C CP  + G+ C   V+ C   + C++   C    G  +C
Sbjct:  852 CFNGGTCVDKINGFSCTCRVGFTGEHCQYEVNECDSQPCLNGGVCQDGLES---FRCSCPKGYTGSRCQVRVDWCRHSNPCQNGGRCRPKDGSCDC 944          

HSP 11 Score: 56.6102 bits (135), Expect = 5.644e-8
Identity = 30/96 (31.25%), Postives = 43/96 (44.79%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CKN G C        C C   Y+G  CE D + CL N C++  +C     +   + C C   F G  C  +V+EC   + C++  TC +    Y C
Sbjct:  738 CKNRGTCTNTLGGYVCSCRGGYSGPNCETDINDCLPNPCMSGGSCTDGINT---FYCTCLPGFTGPRCAIEVDECQ-SAPCKNGGTCTDYVNSYTC 829          

HSP 12 Score: 56.225 bits (134), Expect = 7.243e-8
Identity = 33/120 (27.50%), Postives = 58/120 (48.33%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+  +  P C+ E+D C   ++  C+N G C+       C CP+ +   +C    D C ++ C++ + C+  P     Y+C C   + G  C  D N+C   + C++  TCI+   G+ C
Sbjct:  562 CKPGFTGPQCNVELDEC---SSNPCRNGGTCVDDENGFHCLCPAGFHEPYCFSHVDECSSSPCVHGA-CREDPDG---YRCECEPGWVGKNCDLDRNDCL-PNPCQNAGTCIDQLNGFTC 673          

HSP 13 Score: 55.8398 bits (133), Expect = 1.048e-7
Identity = 37/124 (29.84%), Postives = 56/124 (45.16%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+  CQ  +    C  +ID C    +T C+N  KCI +     C C   + G  CE + D+C  + C ++ TC    AS   Y C C   + G  C   +NEC   + C++   C++    Y C
Sbjct:  408 FTCTCQTGFTGTMCQIDIDECA---STPCQNGAKCIDRPNGYECRCAEGFEGRLCESNIDNCQPDPC-HHGTCVDGIAS---YTCNCVPGYTGYRCENQLNECH-SNPCQNGGKCVDLVNKYIC 523          

HSP 14 Score: 55.4546 bits (132), Expect = 1.404e-7
Identity = 33/116 (28.45%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHED----VNECSDKSSCRSN 847
            ++ +C  ++    C+E ++ C  +    C N G C       +C C + +TGD C ++ D C    C N +TC    AS   + C CP+   G  CH D     N C++ + C +N
Sbjct:  175 YNCQCPPEWTGQYCAEDVNEC-LMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVAS---FYCECPVGKTGLLCHLDDACVSNPCNEGAVCDTN 286          

HSP 15 Score: 54.6842 bits (130), Expect = 1.880e-7
Identity = 40/132 (30.30%), Postives = 55/132 (41.67%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS-------CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            ++  C   Y   NC  EI+ C    +  C+N G CI       C CP    G  CE ++D C   +       C NN TC         Y+C CP  + G  C  D+NEC S+  +  ++  CI     Y C
Sbjct: 1024 YTCDCMPGYEGQNCEREINECR---SHPCQNGGTCIDLVGHYICSCPPGTMGVLCEINEDDCATPTRPRGTPKCQNNGTCVDRVGG---YRCNCPPGYTGDRCEGDINECHSNPCNAANSLDCIQLPNDYLC 1149          

HSP 16 Score: 54.6842 bits (130), Expect = 1.896e-7
Identity = 40/132 (30.30%), Postives = 57/132 (43.18%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C K Y    C   +D+C   N   C+N G+C  K    SC+C   ++G +C+    SC        L   C     C  +  +   + C CP  + G++C   V+ C DK  C + ATC    GGY C
Sbjct:  903 FRCSCPKGYTGSRCQVRVDWCRHSNP--CQNGGRCRPKDG--SCDCVGGWSGRYCDIPGVSCEMAAMQRGLYELCHRGGHCVNTGNT---HYCKCPNDYTGSYCESQVDHCEDK-PCLNGATCRGYVGGYTC 1026          

HSP 17 Score: 53.1434 bits (126), Expect = 6.935e-7
Identity = 44/163 (26.99%), Postives = 64/163 (39.26%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC------------------------QISPASK---------------LKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F   C   +  P C S +D C   +++ C + G C +      CEC   + G  C+ D++ CL N C N  TC                         ++P S                  Y+C C   +QG  C+ DVNEC+  + C++  TC N  GGY C
Sbjct:  596 FHCLCPAGFHEPYCFSHVDEC---SSSPCVH-GACREDPDGYRCECEPGWVGKNCDLDRNDCLPNPCQNAGTCIDQLNGFTCKCRQGFRGGGPTCAEVLTPCSPNPCSNHAVCTHTPDYFGYQCNCQPGWQGHLCNIDVNECA-SNPCKNRGTCTNTLGGYVC 753          

HSP 18 Score: 52.7582 bits (125), Expect = 8.744e-7
Identity = 30/100 (30.00%), Postives = 42/100 (42.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYA----KISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N   C  + A    + +C C   + G  C    D+C  + C N + C         Y C CP  FQG  C  D++EC     C +   CIN +G + C
Sbjct:    5 CLNGAACKSQVANGVPQFTCVCQRGFRGQNCSL-IDACATSPCANGARCT---NWNNHYNCSCPPGFQGKNCRNDIDECRKPGKCLNGGICINTHGSFRC 100          

HSP 19 Score: 49.6766 bits (117), Expect = 7.926e-6
Identity = 33/127 (25.98%), Postives = 52/127 (40.94%), Query Frame = 2
Query:  515 FSMKCQKDYLS--PNCSEIDFCEKLNTTLCKNNGKCIQK--YAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+ KC++ +    P C+E+      +   C N+  C     Y    C C   + G  C  D + C +N C N  TC  +      Y C C   + G  C  D+N+C   + C S  +C +    + C
Sbjct:  671 FTCKCRQGFRGGGPTCAEV--LTPCSPNPCSNHAVCTHTPDYFGYQCNCQPGWQGHLCNIDVNECASNPCKNRGTCTNTLGG---YVCSCRGGYSGPNCETDINDCL-PNPCMSGGSCTDGINTFYC 791          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 77.411 bits (189), Expect = 1.527e-14
Identity = 37/105 (35.24%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  572 CEKLNTTLCKNNGKCIQKY-AKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C     T C+NNG C+        C CP  Y G  CE   ++CL+  CIN  TC ++P  +  + C+CP  F+G  C  + N+C D + C +N+TC++    Y C
Sbjct:  894 CAPCLATPCQNNGTCVSDVTGSYHCTCPFGYKGRNCEIAANACLSQPCINGGTCHLTPGQEGHFSCVCPPGFEGQRCEVNPNDCED-NDCENNSTCVDGINNYTC 997          

HSP 2 Score: 59.3066 bits (142), Expect = 7.617e-9
Identity = 33/98 (33.67%), Postives = 52/98 (53.06%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN--NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+NN  C+      +C CP  Y GD CE+  D+CL   + C ++S C   P ++  Y+C C   + G  C +D N+C + + C+  A C++   GY C
Sbjct:  982 CENNSTCVDGINNYTCVCPPNYRGDLCEEVVDACLPGFDPCQHDSKC--VPLTR-GYRCECLPGYVGQHCEQDYNDCLE-NKCQHGAECVDAINGYTC 1075          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 77.411 bits (189), Expect = 1.596e-14
Identity = 37/105 (35.24%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  572 CEKLNTTLCKNNGKCIQKY-AKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C     T C+NNG C+        C CP  Y G  CE   ++CL+  CIN  TC ++P  +  + C+CP  F+G  C  + N+C D + C +N+TC++    Y C
Sbjct:  894 CAPCLATPCQNNGTCVSDVTGSYHCTCPFGYKGRNCEIAANACLSQPCINGGTCHLTPGQEGHFSCVCPPGFEGQRCEVNPNDCED-NDCENNSTCVDGINNYTC 997          

HSP 2 Score: 59.3066 bits (142), Expect = 7.750e-9
Identity = 33/98 (33.67%), Postives = 52/98 (53.06%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN--NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+NN  C+      +C CP  Y GD CE+  D+CL   + C ++S C   P ++  Y+C C   + G  C +D N+C + + C+  A C++   GY C
Sbjct:  982 CENNSTCVDGINNYTCVCPPNYRGDLCEEVVDACLPGFDPCQHDSKC--VPLTR-GYRCECLPGYVGQHCEQDYNDCLE-NKCQHGAECVDAINGYTC 1075          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 77.411 bits (189), Expect = 1.711e-14
Identity = 37/105 (35.24%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  572 CEKLNTTLCKNNGKCIQKY-AKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C     T C+NNG C+        C CP  Y G  CE   ++CL+  CIN  TC ++P  +  + C+CP  F+G  C  + N+C D + C +N+TC++    Y C
Sbjct:  894 CAPCLATPCQNNGTCVSDVTGSYHCTCPFGYKGRNCEIAANACLSQPCINGGTCHLTPGQEGHFSCVCPPGFEGQRCEVNPNDCED-NDCENNSTCVDGINNYTC 997          

HSP 2 Score: 59.3066 bits (142), Expect = 8.232e-9
Identity = 33/98 (33.67%), Postives = 52/98 (53.06%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN--NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+NN  C+      +C CP  Y GD CE+  D+CL   + C ++S C   P ++  Y+C C   + G  C +D N+C + + C+  A C++   GY C
Sbjct:  982 CENNSTCVDGINNYTCVCPPNYRGDLCEEVVDACLPGFDPCQHDSKC--VPLTR-GYRCECLPGYVGQHCEQDYNDCLE-NKCQHGAECVDAINGYTC 1075          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 2.722e-13
Identity = 38/119 (31.93%), Postives = 52/119 (43.70%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   Y    C E D  E L+T  C++ G C       +C C   ++G  CE D D CL   C N   C  +      + C C   F G  C   V+ C+  S C +N +C+N   GY+C
Sbjct: 1519 CTAGYAGTWC-EADMDECLSTP-CRHGGSCQNLPGGFACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQGG---FACDCSAGFSGKICDVTVDNCA-SSPCYNNGSCVNTATGYSC 1631          

HSP 2 Score: 67.3958 bits (163), Expect = 4.628e-12
Identity = 30/81 (37.04%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  641 CECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C C + Y G +CE D D CL+  C +  +CQ  P     + C C   F GT C  DV+EC +   C++   C N  GG+ C
Sbjct: 1517 CTCTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGG---FACRCLPGFSGTACETDVDECLE-GPCQNGGLCHNTQGGFAC 1593          

HSP 3 Score: 53.5286 bits (127), Expect = 1.047e-7
Identity = 28/95 (29.47%), Postives = 45/95 (47.37%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFC 799
            F+ +C   +    C E D  E L    C+N G C       +C+C + ++G  C+   D+C ++ C NN +C ++ A+   Y C CP    G  C
Sbjct: 1553 FACRCLPGFSGTAC-ETDVDECLEGP-CQNGGLCHNTQGGFACDCSAGFSGKICDVTVDNCASSPCYNNGSC-VNTAT--GYSCRCPFGMSGARC 1642          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 2.724e-13
Identity = 38/119 (31.93%), Postives = 52/119 (43.70%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   Y    C E D  E L+T  C++ G C       +C C   ++G  CE D D CL   C N   C  +      + C C   F G  C   V+ C+  S C +N +C+N   GY+C
Sbjct: 1519 CTAGYAGTWC-EADMDECLSTP-CRHGGSCQNLPGGFACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQGG---FACDCSAGFSGKICDVTVDNCA-SSPCYNNGSCVNTATGYSC 1631          

HSP 2 Score: 67.3958 bits (163), Expect = 4.632e-12
Identity = 30/81 (37.04%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  641 CECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C C + Y G +CE D D CL+  C +  +CQ  P     + C C   F GT C  DV+EC +   C++   C N  GG+ C
Sbjct: 1517 CTCTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGG---FACRCLPGFSGTACETDVDECLE-GPCQNGGLCHNTQGGFAC 1593          

HSP 3 Score: 53.5286 bits (127), Expect = 1.047e-7
Identity = 28/95 (29.47%), Postives = 45/95 (47.37%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFC 799
            F+ +C   +    C E D  E L    C+N G C       +C+C + ++G  C+   D+C ++ C NN +C ++ A+   Y C CP    G  C
Sbjct: 1553 FACRCLPGFSGTAC-ETDVDECLEGP-CQNGGLCHNTQGGFACDCSAGFSGKICDVTVDNCASSPCYNNGSC-VNTAT--GYSCRCPFGMSGARC 1642          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002014.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 6.346e-12
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            D++   + P    N    ++    F+  C   Y    C S+ID C    +  C+N G+C+      +C C + YTG  C+ D + C ++ C+N   C+   A+   + C C   F GT C  DVNEC+  S C +   C +    + C
Sbjct:   49 DIDECTSDPCQ--NGGQCVNGAGSFTCSCLAGYTGTLCDSDIDEC---TSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAA---FTCECAPGFTGTRCETDVNECA-SSPCLNGGRCRDGVAAFTC 187          

HSP 2 Score: 61.6178 bits (148), Expect = 3.225e-11
Identity = 32/96 (33.33%), Postives = 48/96 (50.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N G+CI   A  +C+C   +TG  CE D D C ++ C N   C     S   + C C   + GT C  D++EC+    C++   C+N  G + C
Sbjct:   20 CQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGS---FTCSCLAGYTGTLCDSDIDECT-SDPCQNGGQCVNGAGSFTC 111          

HSP 3 Score: 51.2174 bits (121), Expect = 9.748e-8
Identity = 35/128 (27.34%), Postives = 58/128 (45.31%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS 823
            D++   + P    N    ++    F+  C   Y    C S+++ C    ++ C N G+C    A  +CEC   +TG  CE D + C ++ C+N   C+   A+   + C C   F GT C   +N C+
Sbjct:   87 DIDECTSDPCQ--NGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECA---SSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAA---FTCECAPGFTGTRCETVLNPCT 206          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005361.1 (pep scaffold:Pmarinus_7.0:GL479377:6554:13965:1 gene:ENSPMAG00000004883.1 transcript:ENSPMAT00000005361.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.571e-11
Identity = 40/127 (31.50%), Postives = 64/127 (50.39%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSN-ATCINNYGGYNC 883
             F   C++ +    C + ID C      LC+N   C+      +C C + +TG +C+++ D C+ N C N + C        +Y CICP  + G +C  D++ECS  +SSC +    C N+ G Y+C
Sbjct:  100 AFFCSCEEGWSGTTCDTNIDDCVG---NLCRNGATCVDLVKAFNCSCAAGFTGQYCQNNIDDCIGNQCTNQAIC---IDGINRYSCICPDGWSGEYCAVDIDECSTGRSSCHTTLGVCSNSPGSYSC 220          

HSP 2 Score: 49.2914 bits (116), Expect = 5.813e-7
Identity = 29/76 (38.16%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS 823
            C+NNG C+ +  K  C+C S +TG FCE D D C +  C    TC  +  S   + C C + F G  C  +VN+C+
Sbjct:   13 CQNNGICLNRNNKFLCQCSSGFTGTFCEIDVDECNSRPCRQWGTCVNTDGS---FYCSCVLGFNGPLCTNNVNDCA 85          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002017.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:11907:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002017.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 2.017e-11
Identity = 32/96 (33.33%), Postives = 48/96 (50.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N G+CI   A  +C+C   +TG  CE D D C ++ C N   C     S   + C C   + GT C  D++EC+    C++   C+N  G + C
Sbjct:    8 CQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGS---FTCSCLAGYTGTLCDSDIDECT-SDPCQNGGQCVNGAGSFTC 99          

HSP 2 Score: 48.1358 bits (113), Expect = 1.455e-6
Identity = 26/76 (34.21%), Postives = 38/76 (50.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS 823
            C N G+C    A  +CEC   +TG  CE D + C ++ C+N   C+   A+   + C C   F GT C   +N C+
Sbjct:  162 CLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAA---FTCECAPGFTGTRCETVLNPCT 234          

HSP 3 Score: 46.9802 bits (110), Expect = 3.201e-6
Identity = 43/188 (22.87%), Postives = 67/188 (35.64%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKD----------------------------------------SCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            D++   + P    N    ++    F+  C   Y    C S+ID C    +  C+N G+C+      +C C + YTG  C+ D D                                         C ++ C+N   C+   A+   + C C   F GT C  DVNEC+  S C +   C +    + C
Sbjct:   37 DIDECTSDPCQ--NGGQCVNGAGSFTCSCLAGYTGTLCDSDIDEC---TSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDVYASNPWQIGGRCVDLLGAISSEHPPGFSKLLSVDVADVNECASSPCLNGGRCRDGVAA---FTCECAPGFTGTRCETDVNECA-SSPCLNGGRCRDGVAAFTC 215          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Nematostella
Match: EDO34703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM7])

HSP 1 Score: 79.337 bits (194), Expect = 1.345e-15
Identity = 48/149 (32.21%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  452 SINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCK-----NNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +++ KP    N+   +     F   C   Y      E DFCE +NT  CK     N GKC       +C CP+ Y+G  CED  + C  +SC+N +TC     +   ++C C   F G  C  D+NEC+  + C +N  C++  GG+ C
Sbjct:  992 TVDCKPGACRNNGKCVEIPGGFQCLCSDGY------EGDFCE-VNTNECKSSPCLNGGKCTDGVNSFTCNCPAGYSGGRCEDKTNGCRPDSCLNGATCT---ETSYGHRCACVAGFSGNRCETDINECA-STPCANNGLCVDKEGGFTC 1129          

HSP 2 Score: 62.7734 bits (151), Expect = 2.191e-10
Identity = 39/120 (32.50%), Postives = 53/120 (44.17%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+  +   NC  E D C    T  C N G C+ K     C CPS +TG FCE     C   +C NN  C   P     ++C+C   ++G FC  + NEC   S C +   C +    + C
Sbjct:  941 CKSGFTGKNCEVEEDEC---TTNPCANGGACVDKINGFVCTCPSGFTGQFCEKATVDCKPGACRNNGKCVEIPGG---FQCLCSDGYEGDFCEVNTNECK-SSPCLNGGKCTDGVNSFTC 1053          

HSP 3 Score: 56.225 bits (134), Expect = 2.076e-8
Identity = 35/108 (32.41%), Postives = 50/108 (46.30%), Query Frame = 2
Query:  563 IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKL-KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            I+FC+   +  C N  +C        C C S +TG  CE ++D C  N C N   C      K+  + C CP  F G FC +   +C    +CR+N  C+   GG+ C
Sbjct:  916 INFCD---SNPCNNGAQCNNMVDGYRCMCKSGFTGKNCEVEEDECTTNPCANGGAC----VDKINGFVCTCPSGFTGQFCEKATVDCK-PGACRNNGKCVEIPGGFQC 1015          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Nematostella
Match: EDO48149 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKD5])

HSP 1 Score: 77.411 bits (189), Expect = 2.999e-15
Identity = 51/155 (32.90%), Postives = 73/155 (47.10%), Query Frame = 2
Query:  440 FDLNSINNKPF--HLTNSKHNLSFMIQFSMKCQKDYLSPNC-----SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
              ++S + KP     T      +F  Q ++     Y    C     ++ID C+  N   C N G C+ +    SC+C   +TG  C+ D D C    C+N  TC+   +S   Y C CP  F G  CH DV+EC   +SC ++  C+N YGGY C
Sbjct:  284 LGMDSCSAKPCKNGATCEPAGATFSCQCAVGYTGRYCENGCINRLIADIDECQPSNP--CYNGGTCVNEEGAYSCQCSDGFTGKHCDLDVDHCWALPCLNGGTCK---SSLFNYTCACPDNFSGINCHLDVDECKSNNSCSADQMCVNTYGGYKC 433          

HSP 2 Score: 51.2174 bits (121), Expect = 6.396e-7
Identity = 43/145 (29.66%), Postives = 63/145 (43.45%), Query Frame = 2
Query:  461 NKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKC--IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSS-CRSNATCINNYGGYNC 883
            +KP     +   +S    ++  C   Y   NC +E D C    +  C N G C  I   +  +C C + YTG  C    D C +  C+N  +C    ++   Y C C +   G  C   V+ECS  +  C+   TC N  GGY+C
Sbjct:   38 SKPCANGGTCSPISSGSDYTCACAAGYTGKNCTAEPDPCL---SKPCANGGTCSPISSGSDYTCACAAGYTGKNCTAASDHCSSKPCLNGGSCT---SANNSYICTCALSHTGRNCEIHVDECSSSAERCQYGGTCQNLDGGYSC 176          

HSP 3 Score: 47.7506 bits (112), Expect = 9.069e-6
Identity = 39/131 (29.77%), Postives = 54/131 (41.22%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNN-SCINNSTC---------------QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            +S KC   Y+  +C   +D C +     C+N G C  +     C+CP  YTG  C  D D C     C++  +C               Q S      Y C CP  F G  C   ++ CS K  C++ ATC
Sbjct:  174 YSCKCVAGYVGSSCEIAVDKCSRF---PCENGGTCSNRGGDFVCQCPPTYTGKNCSQDVDECKTLFPCLHGGSCENVAGSYRCSCTANYQGSNCETGNYTCQCPSGFTGQNCQLGMDSCSAK-PCKNGATC 300          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Nematostella
Match: EDO46969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ6])

HSP 1 Score: 74.3294 bits (181), Expect = 1.926e-14
Identity = 48/124 (38.71%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN-NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S KC   Y   NC E D  E  ++  CKN G C       SC+C S YTG  CE D + C + N C N   C  SP    +Y C C   + G  C  DVNEC+  + C++   C N+ GGY+C
Sbjct:  216 YSCKCASGYTGKNC-EKDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCANSPG---RYSCECASGYTGKNCEIDVNECASSNPCKNGGVCTNSPGGYSC 335          

HSP 2 Score: 68.5514 bits (166), Expect = 1.450e-12
Identity = 46/124 (37.10%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL-NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FS KC   Y    C + D  E  ++  CKN G C       SC+C S YTG  CE D + C  +N C N   C  SP     Y C C   + G  C +DVNEC+  + C++   C N+ G Y+C
Sbjct:  177 FSCKCASGYTGKECKK-DVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCTNSPGG---YSCKCASGYTGKNCEKDVNECASSNPCKNGGVCANSPGRYSC 296          

HSP 3 Score: 67.3958 bits (163), Expect = 3.683e-12
Identity = 48/124 (38.71%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL-NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S KC   Y   NC E D  E  ++  CKN G C     + SCEC S YTG  CE D + C  +N C N   C  SP     Y C C   + G  C +D ++C   S C++   CIN+ GGY+C
Sbjct:  255 YSCKCASGYTGKNC-EKDVNECASSNPCKNGGVCANSPGRYSCECASGYTGKNCEIDVNECASSNPCKNGGVCTNSPGG---YSCKCASGYTGKNCEKDEDKC-KVSPCQNGGKCINSDGGYSC 373          

HSP 4 Score: 67.0106 bits (162), Expect = 4.648e-12
Identity = 44/120 (36.67%), Postives = 60/120 (50.00%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN-NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+  +   NC E D  E  ++  CKN G C       SC+C S YTG  C+ D + C + N C N   C  SP     Y C C   + G  C +DVNEC+  + C++   C N+ GGY+C
Sbjct:  142 CKLGWTGRNCEE-DVNECASSNPCKNGGVCTNTPGGFSCKCASGYTGKECKKDVNECASSNPCKNGGVCTNSPGG---YSCKCASGYTGKNCEKDVNECASSNPCKNGGVCTNSPGGYSC 257          

HSP 5 Score: 60.4622 bits (145), Expect = 4.991e-10
Identity = 41/132 (31.06%), Postives = 65/132 (49.24%), Query Frame = 2
Query:  494 NLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL-NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +L     +   C+  +    C S+I+ C+K     C+N G C+ K+    C C   +TG  CE+D + C  +N C N   C  +P     + C C   + G  C +DVNEC+  + C++   C N+ GGY+C
Sbjct:   93 DLGQDSGYRCVCRSGFSGARCQSDINECKK---NPCQNGGDCVNKHGSHLCNCKLGWTGRNCEEDVNECASSNPCKNGGVCTNTPGG---FSCKCASGYTGKECKKDVNECASSNPCKNGGVCTNSPGGYSC 218          

HSP 6 Score: 55.0694 bits (131), Expect = 2.951e-8
Identity = 45/146 (30.82%), Postives = 62/146 (42.47%), Query Frame = 2
Query:  455 INNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKIS---CECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +N    HL N K     +      C+K   SPN              C+N GKC     + S   C C S ++G  C+ D + C  N C N   C     S L   C C + + G  C EDVNEC+  + C++   C N  GG++C
Sbjct:   55 VNKHGSHLCNCK-----LGWTGKNCEKAPCSPN-------------PCENGGKCADDLGQDSGYRCVCRSGFSGARCQSDINECKKNPCQNGGDCVNKHGSHL---CNCKLGWTGRNCEEDVNECASSNPCKNGGVCTNTPGGFSC 179          

HSP 7 Score: 54.299 bits (129), Expect = 5.678e-8
Identity = 36/105 (34.29%), Postives = 51/105 (48.57%), Query Frame = 2
Query:  557 SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYG 871
            S+I+ C+K     C+N G C+ K+    C C   +TG  CE  K  C  N C N   C         Y+C+C   F G  C  D+NEC  K+ C++   C+N +G
Sbjct:   38 SDINECKK---NPCQNGGDCVNKHGSHLCNCKLGWTGKNCE--KAPCSPNPCENGGKCADDLGQDSGYRCVCRSGFSGARCQSDINEC-KKNPCQNGGDCVNKHG 136          

HSP 8 Score: 51.9878 bits (123), Expect = 3.348e-7
Identity = 35/97 (36.08%), Postives = 44/97 (45.36%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCH 802
            ++S +C   Y   NC EID  E  ++  CKN G C       SC+C S YTG  CE D+D C  + C N   C  S      Y C C   + G  C 
Sbjct:  293 RYSCECASGYTGKNC-EIDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDEDKCKVSPCQNGGKCINSDGG---YSCECKGGYSGKHCE 385          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 74.3294 bits (181), Expect = 5.073e-14
Identity = 39/125 (31.20%), Postives = 53/125 (42.40%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + +  C+  +    C E ++ C   N   C+N G C        C C   YTG  CE D D CL N C + S C  +P     Y C C   + G  C  D+N C   S C  N+TC +    + C
Sbjct: 1391 KITCSCKPGFTGSQCEESVNDC---NPNPCRNEGTCTDNNGSFKCSCIPGYTGRLCESDIDECLTNPCKHASACDNTPGG---YTCTCKPGYTGQNCDVDINYCQ-SSPCMYNSTCKDLPTSFEC 1508          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Nematostella
Match: EDO48851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH9])

HSP 1 Score: 73.559 bits (179), Expect = 8.723e-14
Identity = 44/124 (35.48%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C+  +   NC + ++ C K     CKN G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNECS K+ C++   C N +GGY+C
Sbjct: 1200 YSCACKAGFTGKNCEQDVNECSK---NPCKNGGVCKNEHGGYSCTCKAGFTGKICEQDVNECSKNPCKNGGVCKNEHGG---YSCTCKAGFTGKNCEQDVNECS-KNPCKNGGVCKNEHGGYSC 1316          

HSP 2 Score: 73.1738 bits (178), Expect = 1.280e-13
Identity = 44/124 (35.48%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C+  +   NC + ++ C K     CKN G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNECS K+ C++   C N +GGY+C
Sbjct: 1124 YSCACKAGFTGKNCEQDVNECSK---NPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNKHGG---YSCACKAGFTGKNCEQDVNECS-KNPCKNGGVCKNEHGGYSC 1240          

HSP 3 Score: 73.1738 bits (178), Expect = 1.433e-13
Identity = 44/124 (35.48%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C+  +   NC + ++ C K     CKN G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNECS K+ C++   C N +GGY+C
Sbjct:  390 YSCACKAGFTGKNCEQDVNECSK---NPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKNEHGG---YSCACKAGFMGKNCEQDVNECS-KNPCKNGGVCKNEHGGYSC 506          

HSP 4 Score: 72.4034 bits (176), Expect = 1.960e-13
Identity = 44/123 (35.77%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C+  +   NC E D   + N   C+N G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNECS K+ C++   C N +GGY+C
Sbjct: 1048 YSCACKAGFTGKNC-EQDV-NECNKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHGG---YSCACKAGFTGKNCEQDVNECS-KNPCKNGGVCKNEHGGYSC 1164          

HSP 5 Score: 72.4034 bits (176), Expect = 2.353e-13
Identity = 44/124 (35.48%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C+  +   NC + ++ C K     CKN G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNECS K+ C++   C N +GGY+C
Sbjct: 1276 YSCTCKAGFTGKNCEQDVNECSK---NPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGG---YSCTCKAGFTGKNCEQDVNECS-KNPCKNGGVCKNEHGGYSC 1392          

HSP 6 Score: 71.2478 bits (173), Expect = 4.636e-13
Identity = 49/147 (33.33%), Postives = 68/147 (46.26%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            D+N  N  P    N     +    +S  C+  +   NC E D   + N   C+N G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNECS K+ C++   C N +GGY+C
Sbjct:  764 DVNECNKNP--CQNGGVCKNEHGGYSCTCKAGFTGKNC-EQDV-NECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGG---YSCTCKAGFTGKNCEQDVNECS-KNPCKNGGVCKNEHGGYSC 902          

HSP 7 Score: 70.8626 bits (172), Expect = 7.675e-13
Identity = 44/123 (35.77%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C+  +   NC E D   + +   CKN G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNECS K+ C++   C N +GGY+C
Sbjct:  314 YSCACKVGFTGKNC-EQDV-NECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGG---YSCACKAGFTGKNCEQDVNECS-KNPCKNGGVCKNEHGGYSC 430          

HSP 8 Score: 68.9366 bits (167), Expect = 3.052e-12
Identity = 48/148 (32.43%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  440 FDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            FD+N  +  P    N     +    +S  C+  +   NC E D   + +   CKN G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C + F G  C +DVNECS  + C++   C N +GGY+C
Sbjct:  215 FDVNECSKNP--CKNGGVCKNEHGGYSCACKVGFTGKNC-EQDV-NECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGG---YSCACKVGFTGKNCEQDVNECS-VNPCKNGGVCKNEHGGYSC 354          

HSP 9 Score: 68.1662 bits (165), Expect = 4.243e-12
Identity = 41/110 (37.27%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  554 CSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +F E  ++  CKN G C +     SC C S +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNEC +K+ C++   C N +GGY+C
Sbjct:  984 CGNAEF-ETCSSKPCKNGGTCREVNGAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHGG---YSCACKAGFTGKNCEQDVNEC-NKNPCQNGGVCKNEHGGYSC 1088          

HSP 10 Score: 67.0106 bits (162), Expect = 1.201e-11
Identity = 39/109 (35.78%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  557 SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            S+++ C K     C+N G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +DVNEC +K+ C++   C N +GGY+C
Sbjct:  725 SDVNECSK---NPCQNGGVCKNEHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCKNEHGG---YSCTCKAGFTGKNCEQDVNEC-NKNPCQNGGVCKNEHGGYSC 826          

HSP 11 Score: 58.151 bits (139), Expect = 5.539e-9
Identity = 46/160 (28.75%), Postives = 65/160 (40.62%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQ-----ISPASKLK-------------------------------YKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +S  C+  ++  NC + ++ C K     CKN G C  ++   SC C + +TG  CE D + C  N C N   C+      S A K                                 Y C C   F G  C +DVNECS  + C++   C N +GGY+C
Sbjct:  466 YSCACKAGFMGKNCEQDVNECSK---NPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDGLKTIIHLQSIKCGVCKNEHGGYSCACKAGFTGKNCEQDVNECS-VNPCKNGGVCKNEHGGYSC 621          

HSP 12 Score: 50.8322 bits (120), Expect = 1.219e-6
Identity = 36/125 (28.80%), Postives = 52/125 (41.60%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNE 817
            D+N  N  P    N     +    +S  C+  +   NC E D   + N   C+N G C  ++   SC C + +TG  CE D + C  N C N   C+        Y C C   F G  C +++ E
Sbjct:  802 DVNECNKNP--CQNGGVCKNEHGGYSCTCKAGFTGKNC-EQDV-NECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGG---YSCACKAGFTGKICEQEICE 919          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Medaka
Match: slit3 (slit homolog 3 protein [Source:NCBI gene;Acc:101170687])

HSP 1 Score: 73.559 bits (179), Expect = 2.715e-13
Identity = 34/97 (35.05%), Postives = 54/97 (55.67%), Query Frame = 2
Query:  596 CKNNGKCIQKYA-KISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+NNG C+   A    C CP  + G  CE   ++C++  C+N  TC I P  K ++ C+CP  F+G  C  + ++C D + C +N+TC++    Y C
Sbjct:  924 CQNNGTCVSDAAGSYRCNCPYGFKGQDCEIPINACVSFPCLNGGTCHIQPGHKEEFSCVCPAGFEGQRCEMNPDDCED-NDCENNSTCVDGVNNYTC 1019          

HSP 2 Score: 63.5438 bits (153), Expect = 3.766e-10
Identity = 42/127 (33.07%), Postives = 63/127 (49.61%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN--NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +FS  C   +    C    D CE  +   C+NN  C+      +C CP  YTGD C++  D CL+  +SC ++S C   P  +  Y+C C   + G  C +D N+C + + CR  A C++   GY C
Sbjct:  978 EFSCVCPAGFEGQRCEMNPDDCEDND---CENNSTCVDGVNNYTCVCPPNYTGDLCDEVVDPCLSGFHSCQHDSKC--IPVGR-SYRCECLPGYVGQHCEQDFNDCLE-NKCRHGAECVDAVNGYTC 1097          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Medaka
Match: slit3 (slit homolog 3 protein [Source:NCBI gene;Acc:101170687])

HSP 1 Score: 73.559 bits (179), Expect = 2.848e-13
Identity = 34/97 (35.05%), Postives = 54/97 (55.67%), Query Frame = 2
Query:  596 CKNNGKCIQKYA-KISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+NNG C+   A    C CP  + G  CE   ++C++  C+N  TC I P  K ++ C+CP  F+G  C  + ++C D + C +N+TC++    Y C
Sbjct:  898 CQNNGTCVSDAAGSYRCNCPYGFKGQDCEIPINACVSFPCLNGGTCHIQPGHKEEFSCVCPAGFEGQRCEMNPDDCED-NDCENNSTCVDGVNNYTC 993          

HSP 2 Score: 63.5438 bits (153), Expect = 3.952e-10
Identity = 42/127 (33.07%), Postives = 63/127 (49.61%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLN--NSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +FS  C   +    C    D CE  +   C+NN  C+      +C CP  YTGD C++  D CL+  +SC ++S C   P  +  Y+C C   + G  C +D N+C + + CR  A C++   GY C
Sbjct:  952 EFSCVCPAGFEGQRCEMNPDDCEDND---CENNSTCVDGVNNYTCVCPPNYTGDLCDEVVDPCLSGFHSCQHDSKC--IPVGR-SYRCECLPGYVGQHCEQDFNDCLE-NKCRHGAECVDAVNGYTC 1071          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Medaka
Match: ENSORLT00000012788.2 (eyes shut homolog [Source:NCBI gene;Acc:105355817])

HSP 1 Score: 72.4034 bits (176), Expect = 6.453e-13
Identity = 48/144 (33.33%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  467 PFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEI-DFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            P    N+   +S    +  +C   +   NC EI D+C +LN  +C N G C+       C C   + G+ C+   D+C    NSC+N +TC     P S  +Y C C   F GT C  ++ EC D S C+ N TC +  G Y C
Sbjct:  336 PSPCLNNGTCVSRGTDYVCRCLSGFSGRNCEEIIDYCRQLNI-ICLNEGLCLSVIGGHQCVCGPGWIGELCQHVGDACAMGTNSCLNGATCITMSQPTSPPQYTCKCLPGFIGTMCEIEIYEC-DSSPCQHNGTCYDLVGDYEC 477          

HSP 2 Score: 66.2402 bits (160), Expect = 6.090e-11
Identity = 36/96 (37.50%), Postives = 51/96 (53.12%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N   C+ +    SC CPS YTG FCE+D D C+ +SC  +  C      +  + C C + F+G FC  + NEC +   C S ATC++    Y C
Sbjct:  569 CQNRATCVDEIDGYSCLCPSGYTGVFCEEDIDYCVGHSCSEHGICL---DHQYNFTCRCMLGFEGPFCEVETNEC-NSFPCSSGATCVDLISDYRC 660          

HSP 3 Score: 64.6994 bits (156), Expect = 1.888e-10
Identity = 44/137 (32.12%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  482 NSKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCE--KLNTTLCKNNGKCIQ-KYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYN 880
            N    +  + +F+  CQ  Y    C  ++D C+    N +LC N   C+  + A  +C CP+ +TGDFCE D + C +  C N++ CQ    S   Y C C   + G  C +D+NEC  +   +    CI N  GY 
Sbjct: 1534 NRGSCVDLIDKFACFCQDGYTGKTCENDVDICKDTAFNASLCFNGATCLDGEGANFTCSCPAGFTGDFCEVDVNECCSAPCHNSAVCQDLINS---YVCHCRSGWTGLHCEDDINECLPQPCIQ--GICIQNDPGYG 1665          

HSP 4 Score: 63.929 bits (154), Expect = 3.087e-10
Identity = 35/96 (36.46%), Postives = 54/96 (56.25%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N G C  +    SC+CP   TG++CE + + C ++ C++NSTC         YKC+C   F G  C  D++EC+  S C++  TC++  G Y C
Sbjct:  992 CQNGGSCTDELNSFSCQCPVGITGNYCEVNIEECASSPCLHNSTCFDLVDG---YKCVCQPGFTGPKCELDIDECA-SSPCKNRGTCVDLPGNYFC 1083          

HSP 5 Score: 60.077 bits (144), Expect = 4.909e-9
Identity = 39/131 (29.77%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  503 FMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNN----GKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F + F   C++ +  P C       ++N   C +N    G C        C C   Y G  CE+D D CL+N C +NS C+        Y+C+C   ++G  C ++++EC  +  C++NATC +    Y C
Sbjct: 1120 FPLGFRCLCRRGFSGPRC-------EINVDECSSNPCFHGFCYDVVDGFHCLCSPGYAGPRCEEDIDDCLSNLCTSNSACK---DLHEGYECVCHSGWEGADCQQEIDECLSQ-PCKNNATCTDLLNNYRC 1239          

HSP 6 Score: 59.6918 bits (143), Expect = 6.634e-9
Identity = 35/96 (36.46%), Postives = 48/96 (50.00%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C+N G C  +     C+C   ++G  CE D + C ++ C N  TC+        + CICP  + GT C  DVNEC + S C     CIN  GG+ C
Sbjct: 1343 CQNQGHCEDQVNGYRCDCKMGFSGLHCEQDINECASSPCSNAGTCK---DLVNMFHCICPAGYFGTLCDLDVNEC-EVSPCLHEGICINMPGGFKC 1434          

HSP 7 Score: 56.9954 bits (136), Expect = 4.400e-8
Identity = 37/99 (37.37%), Postives = 49/99 (49.49%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS-----CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC---INNY 868
            C N G C+    K +C C   YTG  CE+D D C + +     C N +TC     +   + C CP  F G FC  DVNEC   + C ++A C   IN+Y
Sbjct: 1532 CLNRGSCVDLIDKFACFCQDGYTGKTCENDVDICKDTAFNASLCFNGATCLDGEGA--NFTCSCPAGFTGDFCEVDVNECC-SAPCHNSAVCQDLINSY 1627          

HSP 8 Score: 56.225 bits (134), Expect = 6.938e-8
Identity = 41/117 (35.04%), Postives = 53/117 (45.30%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKL--KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATC 856
            F   C   Y  P C E ID C    + LC +N  C   +    C C S + G  C+ + D CL+  C NN+TC     + L   Y+C C   + G  C EDV EC D   C + A C
Sbjct: 1161 FHCLCSPGYAGPRCEEDIDDCL---SNLCTSNSACKDLHEGYECVCHSGWEGADCQQEIDECLSQPCKNNATC-----TDLLNNYRCFCLPGWTGVDCAEDVREC-DSGPCLNGAQC 1268          

HSP 9 Score: 51.6026 bits (122), Expect = 1.971e-6
Identity = 38/127 (29.92%), Postives = 56/127 (44.09%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC 820
            D+N   + P     +  +L  M  F   C   Y    C  +++ CE    + C + G CI       C C   YTG  CE + + C++N C N   C   P    +Y C+CP+ F G  C  +V+EC
Sbjct: 1372 DINECASSPCSNAGTCKDLVNM--FHCICPAGYFGTLCDLDVNECE---VSPCLHEGICINMPGGFKCVCRPGYTGLRCEVNVNECVSNPCQNTGRCIDGPN---QYHCLCPVGFIGLHCETNVDEC 1490          

HSP 10 Score: 50.8322 bits (120), Expect = 3.268e-6
Identity = 43/154 (27.92%), Postives = 68/154 (44.16%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC-LNNS-----------------------------CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            Q++ KC   ++   C EI+  E  +++ C++NG C        C+CP+ + G  CE D D+C L  S                             C N   C ++ AS   Y CIC   + G  C  +VN+C  +  C++ ATC++   GY+C
Sbjct:  436 QYTCKCLPGFIGTMC-EIEIYE-CDSSPCQHNGTCYDLVGDYECQCPAGFQGKNCEVDIDACGLPTSTCSTKTLCLDLPKGFEYSCHVPCPQDFQPCANGGHCVLNNAS--SYTCICTRGWTGQTCRINVNDCI-QHWCQNRATCVDEIDGYSC 584          

HSP 11 Score: 50.8322 bits (120), Expect = 3.622e-6
Identity = 35/95 (36.84%), Postives = 45/95 (47.37%), Query Frame = 2
Query:  593 LCKNNGKCIQKY--AKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPAS---KLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCIN 862
            LC  NG C   +      C C   Y+G FCE   DSCL N C N   C  + ++   K  YKC+CP +F G  C E V + +    C  N TC+ 
Sbjct:  176 LCSGNGVCQTSFLEGAYHCRCHHHYSGRFCE-KFDSCLENPCQNKGVCLSNGSTDPNKRTYKCLCPPHFTGPNCSEIVGKANCVRVCE-NGTCVQ 268          

HSP 12 Score: 50.0618 bits (118), Expect = 5.418e-6
Identity = 26/70 (37.14%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  593 LCKNNGKC-IQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFC 799
            +C+N G+C        +C CPS +TG  C +   SC N++C + S C  +P++   Y+C+CP+  +GTFC
Sbjct: 2760 VCQNGGQCKSMGVDSFTCICPSLWTGPVC-NQSVSCANHTCSHGSLC--APSTATSYRCMCPLGRRGTFC 2826          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Medaka
Match: notch1b (notch receptor 1 [Source:NCBI gene;Acc:101161732])

HSP 1 Score: 72.0182 bits (175), Expect = 8.349e-13
Identity = 45/148 (30.41%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKL-KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            D++  +  P    ++   L+    F  KCQ+ Y+ P C E+D  E + +  CKN   C+ +     C C   Y G+FCE + D C N  C+N+  C      K+  + C CP  F G+ C  D++EC+  + C++ A C +    Y C
Sbjct:  412 DVDECSLGPNPCEHAGKCLNTKGSFQCKCQRGYVGPRC-EMDVNECI-SNPCKNEATCLDQIGDFQCICMPGYEGEFCEINTDECANGPCLNSGKC----IDKINGFHCECPTGFTGSLCQTDIDECA-STPCKNGAKCTDGPNKYTC 552          

HSP 2 Score: 63.5438 bits (153), Expect = 4.138e-10
Identity = 39/122 (31.97%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  527 CQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   Y  P+C  ++D C  L    C++ GKC+       C+C   Y G  CE D + C++N C N +TC  QI       ++CIC   ++G FC  + +EC++   C ++  CI+   G++C
Sbjct:  400 CPPGYFGPSCDKDVDEC-SLGPNPCEHAGKCLNTKGSFQCKCQRGYVGPRCEMDVNECISNPCKNEATCLDQIG-----DFQCICMPGYEGEFCEINTDECAN-GPCLNSGKCIDKINGFHC 514          

HSP 3 Score: 62.003 bits (149), Expect = 1.165e-9
Identity = 36/108 (33.33%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  560 EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +I+ C+ +   LCKN G CI +     C+CP+EY G  CE     C  + C+N  TC      +  Y+C C   F G  C  ++N+C     C++  TC++    YNC
Sbjct:  178 DINECD-IQPPLCKNGGLCINEVGGYRCQCPAEYNGKHCETRYLPCNPSPCLNGGTCIQK--GETSYECSCVPGFTGKNCSSNINDCPGH-ECQNGGTCVDGVNTYNC 281          

HSP 4 Score: 60.077 bits (144), Expect = 4.430e-9
Identity = 36/113 (31.86%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  545 SPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +P+C+E         + C N G C+      +C CP  +TG++C+ D + C +  C+N  TCQ S  +   YKC CP  + G  C + VN C + S C++  +C  +   Y C
Sbjct:  984 TPDCTE---------SSCFNGGTCVDGINAFTCLCPPGFTGNYCQHDINECDSKPCMNGGTCQDSYGT---YKCTCPHGYTGLNCQDLVNWC-NSSPCKNGGSCSQSGTTYRC 1083          

HSP 5 Score: 59.6918 bits (143), Expect = 6.198e-9
Identity = 34/97 (35.05%), Postives = 47/97 (48.45%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDS-CLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCH 802
            F  +C   +    C E D  +   +  C+N G CI  +    C CP  +TG  C    DS C +N C N  TC+++P +   Y+CICP  F G  CH
Sbjct: 1332 FICRCPPGFTGSTC-EYDS-QTCGSLRCRNGGTCISGHKSPKCLCPPSFTGPECRHPTDSACNSNPCYNGGTCELTPEAPY-YRCICPFKFNGLLCH 1425          

HSP 6 Score: 59.3066 bits (142), Expect = 7.753e-9
Identity = 36/99 (36.36%), Postives = 49/99 (49.49%), Query Frame = 2
Query:  587 TTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            T LC+N G+C+       C C + YTG +CE+  D C  N C N +TC         Y C C   F GT C  ++NEC  +  C++  TCI+    Y C
Sbjct: 1113 TQLCRNAGRCLDAGNVHRCHCQAGYTGSYCEEQVDECTPNPCQNGATCTDFLGG---YSCKCLPGFLGTNCSVEINECFSQ-PCQNGGTCIDLIDTYKC 1207          

HSP 7 Score: 55.8398 bits (133), Expect = 1.014e-7
Identity = 39/124 (31.45%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F+ KC   Y  P C S+++ C   N  +   +G C  K     C C S ++G  C+ + + C +N C+N  TC+   +    Y C C + F G  C  ++NEC+  + C +  TCI++  GY C
Sbjct:  700 FTCKCPDGYQDPTCFSQVNECLS-NPCI---HGHCEDKINGYKCLCDSGWSGKNCDINNNECESNPCMNGGTCKDMTSG---YVCTCRMGFTGPNCQTNINECA-SNPCLNQGTCIDDVAGYKC 815          

HSP 8 Score: 55.8398 bits (133), Expect = 1.023e-7
Identity = 43/158 (27.22%), Postives = 71/158 (44.94%), Query Frame = 2
Query:  443 DLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC----------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            D+N  ++KP    N          +   C   Y   NC + +++C   N++ CKN G C Q      C C + +TG +C+    SC          +   C N   C     +   ++C C   + G++C E V+EC+  + C++ ATC +  GGY+C
Sbjct: 1021 DINECDSKP--CMNGGTCQDSYGTYKCTCPHGYTGLNCQDLVNWC---NSSPCKNGGSCSQSGTTYRCNCETGWTGLYCDVPSVSCEVAAKQRGVDITQLCRNAGRCL---DAGNVHRCHCQAGYTGSYCEEQVDECT-PNPCQNGATCTDFLGGYSC 1169          

HSP 9 Score: 55.4546 bits (132), Expect = 1.382e-7
Identity = 41/125 (32.80%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  512 QFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +++ +C + Y   +C +EI+ C   ++  C + G C    A  SC+C   YTG  CE + + CL+  C N  TCQ  P +   Y C CP    G  C  ++++C  K++   N TCI+   GY C
Sbjct:  549 KYTCECTEGYAGQHCETEINEC---SSDPC-HYGTCKDGLASFSCDCTPGYTGRLCETNINECLSLPCRNGGTCQDRPNA---YICSCPKGTGGINCEINIDDC--KNNLCKNGTCIDRINGYEC 664          

HSP 10 Score: 55.4546 bits (132), Expect = 1.406e-7
Identity = 39/121 (32.23%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            C   +   +CS+ ID C       C     C  + A   CECP   TG  C+ D D+C++N C   S C  +P +   + C CP  + G  C +DV+ECS   + C     C+N  G + C
Sbjct:  323 CVNGWTGNDCSKNIDDCAD---AACYKGSTCHDRVASFYCECPKGRTGLLCQLD-DACISNPCQKGSNCDTNPITGNHF-CTCPPGYFGPSCDKDVDECSLGPNPCEHAGKCLNTKGSFQC 438          

HSP 11 Score: 53.1434 bits (126), Expect = 6.596e-7
Identity = 29/85 (34.12%), Postives = 40/85 (47.06%), Query Frame = 2
Query:  614 CIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNY 868
            CIQ      CEC + YTG  C+   D C +  C N  TC ++  +   + C CP  F G+ C  D   C     CR+  TCI+ +
Sbjct: 1284 CIQLTNNYRCECRAGYTGQRCDTVFDGCKSRPCRNGGTCAVASNTPHGFICRCPPGFTGSTCEYDSQTCG-SLRCRNGGTCISGH 1367          

HSP 12 Score: 52.7582 bits (125), Expect = 9.138e-7
Identity = 38/133 (28.57%), Postives = 53/133 (39.85%), Query Frame = 2
Query:  596 CKNNGKCIQK--YAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKL-----------------------------------KYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            CK+ G C +   Y   SC CP  + G  CE D   C+ N C+N +TCQ +  S                                      + C C + F+GT C ED+NEC + S C++ A C +    Y C
Sbjct:  838 CKHGGVCRESEDYLSFSCACPEGWQGQTCEVDIKECVKNPCLNGATCQNTLGSYHCSCKPGFTGRNCEANMDDCKPNPCNNGGLCKDEVNDFLCTCLLGFRGTTCEEDINEC-ESSPCKNGANCTDCVNSYTC 969          

HSP 13 Score: 51.6026 bits (122), Expect = 1.862e-6
Identity = 47/149 (31.54%), Postives = 57/149 (38.26%), Query Frame = 2
Query:  467 PFHLTNSKHNLSFMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--------NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
            P    N      F+  +S KC   +L  NCS EI+ C    +  C+N G CI       C CP    G  CE + D C            C N   C         Y CICP  + G  C  DVNEC S+    R   +CI     Y C
Sbjct: 1151 PNPCQNGATCTDFLGGYSCKCLPGFLGTNCSVEINECF---SQPCQNGGTCIDLIDTYKCSCPRGTQGVHCEVNVDDCSPFTDPLTKEPKCFNKGKCVDRVGG---YHCICPSGYVGERCEGDVNECLSNPCDPRGTLSCIQLTNNYRC 1293          
BLAST of Hyaluronan binding protein 2 vs. Ensembl Medaka
Match: notch3 (neurogenic locus notch homolog protein 2 [Source:NCBI gene;Acc:101162450])

HSP 1 Score: 70.8626 bits (172), Expect = 1.898e-12
Identity = 40/123 (32.52%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  +C + Y  P C EID  E L +  C+N+  C+ +  + +C C   YTG +C+ D D C +N C+N+  C+    +   + C C   F GT C  D++EC+  + C++ A C +   G+ C
Sbjct:  362 FQCQCGRGYAGPRC-EIDINECL-SMPCQNDATCLDRIGEFTCICMPGYTGTYCQTDIDDCESNPCVNDGVCR---DTVNGFTCTCQPGFSGTMCQIDIDECA-STPCQNGAKCHDRPNGFEC 478          

HSP 2 Score: 63.5438 bits (153), Expect = 4.307e-10
Identity = 44/159 (27.67%), Postives = 74/159 (46.54%), Query Frame = 2
Query:  440 FDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS----------CINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +++N  N++P    N       +  F   C K Y    C + +D+C +  ++ C+N G+C Q  A  +CEC + ++G +C+  + SC   +          C +   C  +  +     C CP  + G++C   V+ C DK  CR+ ATC    GGY C
Sbjct:  946 YEVNECNSQP--CLNGGVCQDGLESFRCTCPKGYTGNRCQTPVDWCRR--SSPCQNGGRCRQNDASFTCECKNGWSGHYCDIPRVSCETAARQRGIQTDELCHHGGHCVNTGNTHF---CKCPADYTGSYCESQVDHCEDK-PCRNGATCRPYVGGYQC 1096          

HSP 3 Score: 62.7734 bits (151), Expect = 6.864e-10
Identity = 46/156 (29.49%), Postives = 71/156 (45.51%), Query Frame = 2
Query:  422 TVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECS-DKSSCRSNATCINNYGGYNC 883
            T ++   D+N    +P    N     + +   +  C   +   +CSE ID C    T +C N   C  + A   CECP   TG  C  D D+C++N C   + C  +P +  +  C CP  F G  C++D++ECS   + C     C+N  G + C
Sbjct:  214 TGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCA---TAVCFNGATCHDRVASFFCECPVGKTGLLCHLD-DACVSNPCNEGAVCDTNPLNG-RAICTCPAGFVGGACNQDMDECSIGANPCEHFGKCVNTEGSFQC 364          

HSP 4 Score: 61.6178 bits (148), Expect = 1.571e-9
Identity = 34/97 (35.05%), Postives = 49/97 (50.52%), Query Frame = 2
Query:  593 LCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            LC + G C+       C+CP++YTG +CE   D C +  C N +TC+        Y+C C   F G  C  ++NEC     C++  TCI+  G Y C
Sbjct: 1042 LCHHGGHCVNTGNTHFCKCPADYTGSYCESQVDHCEDKPCRNGATCRPYVGG---YQCDCMPGFMGQNCEREINECQSH-PCQNGGTCIDLVGHYIC 1134          

HSP 5 Score: 61.2326 bits (147), Expect = 1.982e-9
Identity = 46/173 (26.59%), Postives = 68/173 (39.31%), Query Frame = 2
Query:  479 TNSKHNLSFMIQFSMKCQKDYLSPNC-SEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQIS-------------------------PASKL-----------KYKCICPIYFQGTFCHEDVNEC-SDKSSCRSNATCINNYGGYNC 883
             N    +++  Q++  C   +   NC ++I+ C K    +C NNG CI       C+C   Y+G  CE     C  + C+N  TC+ +                         P  K             Y C CP  + G +C EDVNEC    ++C +  TC N  GG+ C
Sbjct:   77 ANGARCVNWNDQYNCSCPPGFQGKNCHNDINECRKPG--VCLNNGLCINMKGSFRCQCQPGYSGRICEVPTLPCAPSQCLNGGTCRQTSDHSYECACLPGFEGHNCEKNVDDCPGHKCMNGGLCVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGGHTC 247          

HSP 6 Score: 55.4546 bits (132), Expect = 1.191e-7
Identity = 34/122 (27.87%), Postives = 62/122 (50.82%), Query Frame = 2
Query:  527 CQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTC--QISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   ++   C++ +D C  +    C++ GKC+       C+C   Y G  CE D + CL+  C N++TC  +I      ++ CIC   + GT+C  D+++C + + C ++  C +   G+ C
Sbjct:  326 CPAGFVGGACNQDMDEC-SIGANPCEHFGKCVNTEGSFQCQCGRGYAGPRCEIDINECLSMPCQNDATCLDRIG-----EFTCICMPGYTGTYCQTDIDDC-ESNPCVNDGVCRDTVNGFTC 440          

HSP 7 Score: 54.6842 bits (130), Expect = 1.961e-7
Identity = 37/125 (29.60%), Postives = 65/125 (52.00%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCIN--NYGGYNC 883
            +   C+  ++  NC ++D  + L  + C+N G CI K    +C+C   + G+ C+ + + C +N C+N  TC    AS   + C+C + + G  C E +  CS  + C ++A C +  +Y GY C
Sbjct:  663 YRCDCEPGWVGKNC-DLDRNDCL-PSPCQNAGTCIDKLNGFTCKCRQGFIGNLCQVNINECASNPCLNKGTCVDGVAS---FTCVCELPYSGPTCAEVLTPCS-PNPCANHAVCTHTADYLGYQC 781          

HSP 8 Score: 53.9138 bits (128), Expect = 3.607e-7
Identity = 30/96 (31.25%), Postives = 43/96 (44.79%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C  K    SC C S +TG  C+ + + C +  C+N   CQ    S   ++C CP  + G  C   V+ C   S C++   C  N   + C
Sbjct:  918 CFNGGTCTDKINGYSCTCRSGFTGSHCQYEVNECNSQPCLNGGVCQDGLES---FRCTCPKGYTGNRCQTPVDWCRRSSPCQNGGRCRQNDASFTC 1010          

HSP 9 Score: 52.7582 bits (125), Expect = 9.194e-7
Identity = 37/125 (29.60%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  509 IQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            + +   CQ  +    C+ ID  E + +  CKN G C        C C + +TG  CE D + C+ N C++  +C     S   Y C C   F G+ C  ++NEC   + C++  TC +    Y C
Sbjct:  777 LGYQCNCQPGWQGQLCN-IDVNECI-SNPCKNRGTCTNTLGGFVCSCRAGFTGLTCETDINDCVPNPCLSGGSCTDGVNS---YHCSCLPGFTGSRCALEINEC-QSNPCKNGGTCTDYVNSYTC 895          

HSP 10 Score: 51.9878 bits (123), Expect = 1.487e-6
Identity = 35/115 (30.43%), Postives = 49/115 (42.61%), Query Frame = 2
Query:  503 FMIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC--------LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNEC 820
            ++  +   C   ++  NC  EI+ C+   +  C+N G CI       C CP    G  CE ++D C            C+NN TC         Y+C CP  F G  C  D+NEC
Sbjct: 1090 YVGGYQCDCMPGFMGQNCEREINECQ---SHPCQNGGTCIDLVGHYICSCPPGTLGVLCEINEDDCNTPVRPRNAPPKCLNNGTCVDRVGG---YRCNCPPGFTGERCEGDINEC 1198          

HSP 11 Score: 50.8322 bits (120), Expect = 3.082e-6
Identity = 43/168 (25.60%), Postives = 70/168 (41.67%), Query Frame = 2
Query:  422 TVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKD--YLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNS-CINNSTCQISPASKLKYKCICPIYFQGTFCHEDV-----NECSDKSSCRSNA------TCINNYGGYNC 883
            T ++     +S   KP   T    N +F  +F+   QK     S +CS ID C    T+ C N  +C+    + +C CP  + G  C +D + C     C+NN  C      K  ++C C   + G  C         ++C +  +CR  +       C+  + G+NC
Sbjct:   19 TGDYQNMTWHSCWTKPLCTTAMSSNRTFSKEFTAVEQKHSTLWSQDCSRIDACA---TSPCANGARCVNWNDQYNCSCPPGFQGKNCHNDINECRKPGVCLNNGLCI---NMKGSFRCQCQPGYSGRICEVPTLPCAPSQCLNGGTCRQTSDHSYECACLPGFEGHNC 180          

HSP 12 Score: 50.447 bits (119), Expect = 4.089e-6
Identity = 30/98 (30.61%), Postives = 51/98 (52.04%), Query Frame = 2
Query:  596 CKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCL--NNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C N G C+      +C+CP E+TG +C +D + CL   N+C N  TC  +      + C+C   + G  C E++++C+  + C + ATC +    + C
Sbjct:  192 CMNGGLCVDGVNTYNCQCPPEWTGQYCAEDVNECLMQPNACHNGGTCFNTIGG---HTCVCVNGWTGDDCSENIDDCA-TAVCFNGATCHDRVASFFC 285          

HSP 13 Score: 49.6766 bits (117), Expect = 7.580e-6
Identity = 34/128 (26.56%), Postives = 53/128 (41.41%), Query Frame = 2
Query:  506 MIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQK--YAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            +  F+  C+  Y  P C+E+      +   C N+  C     Y    C C   + G  C  D + C++N C N  TC  +      + C C   F G  C  D+N+C   + C S  +C +    Y+C
Sbjct:  736 VASFTCVCELPYSGPTCAEV--LTPCSPNPCANHAVCTHTADYLGYQCNCQPGWQGQLCNIDVNECISNPCKNRGTCTNTLGG---FVCSCRAGFTGLTCETDINDCV-PNPCLSGGSCTDGVNSYHC 857          

HSP 14 Score: 49.2914 bits (116), Expect = 9.232e-6
Identity = 33/116 (28.45%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSE-IDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHED----VNECSDKSSCRSN 847
            ++ +C  ++    C+E ++ C  +    C N G C       +C C + +TGD C ++ D C    C N +TC    AS   + C CP+   G  CH D     N C++ + C +N
Sbjct:  205 YNCQCPPEWTGQYCAEDVNEC-LMQPNACHNGGTCFNTIGGHTCVCVNGWTGDDCSENIDDCATAVCFNGATCHDRVAS---FFCECPVGKTGLLCHLDDACVSNPCNEGAVCDTN 316          
BLAST of Hyaluronan binding protein 2 vs. Planmine SMEST
Match: SMESG000061109.1 (SMESG000061109.1)

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 390/391 (99.74%), Postives = 391/391 (100.00%), Query Frame = 2
Query:  128 MLFILIVIPLFFSVKAGNFNVTIIKTEIKYKNDENLMVYCDKNNFTVNPICVINISVCFHKNCLKSRDGTFPRVPILIYGEKTKIVXXXXXXXXXXXXTVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNCXXXXXXXXXXXXXXXXXXXXXXQISNFIKWNLPDFATXXXXXXXXXXXXXXXXXXXXXXXKNCPTKRKKSKFLVDDSSLFIKSKEKTQNDYDGNFGRSHLLPDERHQSLVPMFDLHXXXXXXXXXXXXXXPGMSTFGRR 1300
            MLFILIVIPLFFSVKAGNFNVTIIKTEIKYKNDENLMVYCDKNNFTVNPICVINI+VCFHKNCLKSRDGTFPRVPILIYGEKTKIVSNLSLSEGSNNLTVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNCSIEVSSQTTTSTSSPSVEISTTQISNFIKWNLPDFATLLIVSIEAAIIIILIFVLIFVQVKNCPTKRKKSKFLVDDSSLFIKSKEKTQNDYDGNFGRSHLLPDERHQSLVPMFDLHELENTFNNNLSNNSPGMSTFGRR
Sbjct:    1 MLFILIVIPLFFSVKAGNFNVTIIKTEIKYKNDENLMVYCDKNNFTVNPICVINITVCFHKNCLKSRDGTFPRVPILIYGEKTKIVSNLSLSEGSNNLTVEFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNCSIEVSSQTTTSTSSPSVEISTTQISNFIKWNLPDFATLLIVSIEAAIIIILIFVLIFVQVKNCPTKRKKSKFLVDDSSLFIKSKEKTQNDYDGNFGRSHLLPDERHQSLVPMFDLHELENTFNNNLSNNSPGMSTFGRR 391          
BLAST of Hyaluronan binding protein 2 vs. Planmine SMEST
Match: SMESG000025423.1 (SMESG000025423.1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.070e-13
Identity = 38/123 (30.89%), Postives = 59/123 (47.97%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPAS----KLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +   NC++ D C   N   C  +  C    + ++C CP    G +C+  K  C ++ C+N   C + P        K  C+CP  F G  C  D NEC + S C+++A C+N +G Y+C
Sbjct:  212 CLIGWTGTNCTQRDMCVLDNP--CHGSASCSMNESVVNCICPDSLEGQYCQTSKRPCGSSPCLNGGLCVLHPIDSNEVSRKTVCVCPRNFTGETCQHDFNECKN-SPCKNDANCVNVFGSYDC 331          
BLAST of Hyaluronan binding protein 2 vs. Planmine SMEST
Match: SMESG000025423.1 (SMESG000025423.1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.125e-13
Identity = 38/123 (30.89%), Postives = 59/123 (47.97%), Query Frame = 2
Query:  527 CQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPAS----KLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            C   +   NC++ D C   N   C  +  C    + ++C CP    G +C+  K  C ++ C+N   C + P        K  C+CP  F G  C  D NEC + S C+++A C+N +G Y+C
Sbjct:  211 CLIGWTGTNCTQRDMCVLDNP--CHGSASCSMNESVVNCICPDSLEGQYCQTSKRPCGSSPCLNGGLCVLHPIDSNEVSRKTVCVCPRNFTGETCQHDFNECKN-SPCKNDANCVNVFGSYDC 330          
BLAST of Hyaluronan binding protein 2 vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.772e-11
Identity = 40/123 (32.52%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  KC   +   NC EID  ++ ++  C N G CI + +   C CP  ++GD C+ +K+ C   SC+N + C +  A+++   C C   + G  C++++NEC+    C +N  CI+  G Y C
Sbjct:  380 FKCKCPPGFTGRNC-EIDE-DECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKC-MDRANRI--DCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRC 497          

HSP 2 Score: 56.9954 bits (136), Expect = 2.278e-8
Identity = 43/150 (28.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  506 MIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCI--------QKYA---------------KISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  +  C+K +    C+ ++++C   N  +C+N G+C+        Q+Y                K  C+CP  + GD C+ ++ SC +N C+ NS C     S   +KC CP  F G  C  D +ECS K  C +   CI+   G+ C
Sbjct:  275 LLPLTCNCKKKWGGMFCNIDLNYCSN-NPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTS--GFKCKCPPGFTGRNCEIDEDECSSK-PCLNGGMCIDRPSGFLC 420          

HSP 3 Score: 55.0694 bits (131), Expect = 1.107e-7
Identity = 36/107 (33.64%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  572 CEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC-LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCH-----EDVNECSDK---SSCRSNATCINN 865
            C+KL+   C N  KC+ +  +I CEC + +TG  C  + + C +N  C+NN  C  +P S   Y+C C   + G FC+      ++N    K   + CR+N  CI N
Sbjct:  438 CQKLS---CMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGS---YRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILN 538          
BLAST of Hyaluronan binding protein 2 vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.848e-11
Identity = 40/123 (32.52%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  515 FSMKCQKDYLSPNCSEIDFCEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            F  KC   +   NC EID  ++ ++  C N G CI + +   C CP  ++GD C+ +K+ C   SC+N + C +  A+++   C C   + G  C++++NEC+    C +N  CI+  G Y C
Sbjct:  375 FKCKCPPGFTGRNC-EIDE-DECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKC-MDRANRI--DCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRC 492          

HSP 2 Score: 56.9954 bits (136), Expect = 2.255e-8
Identity = 43/150 (28.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  506 MIQFSMKCQKDYLSPNCS-EIDFCEKLNTTLCKNNGKCI--------QKYA---------------KISCECPSEYTGDFCEDDKDSCLNNSCINNSTCQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGYNC 883
            ++  +  C+K +    C+ ++++C   N  +C+N G+C+        Q+Y                K  C+CP  + GD C+ ++ SC +N C+ NS C     S   +KC CP  F G  C  D +ECS K  C +   CI+   G+ C
Sbjct:  270 LLPLTCNCKKKWGGMFCNIDLNYCSN-NPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTS--GFKCKCPPGFTGRNCEIDEDECSSK-PCLNGGMCIDRPSGFLC 415          

HSP 3 Score: 55.0694 bits (131), Expect = 1.174e-7
Identity = 36/107 (33.64%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  572 CEKLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSC-LNNSCINNSTCQISPASKLKYKCICPIYFQGTFCH-----EDVNECSDK---SSCRSNATCINN 865
            C+KL+   C N  KC+ +  +I CEC + +TG  C  + + C +N  C+NN  C  +P S   Y+C C   + G FC+      ++N    K   + CR+N  CI N
Sbjct:  433 CQKLS---CMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGS---YRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILN 533          
The following BLAST results are available for this feature:
BLAST of Hyaluronan binding protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOTCH31.583e-1533.33notch receptor 3 [Source:HGNC Symbol;Acc:HGNC:7883... [more]
NOTCH15.003e-1332.28notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881... [more]
FAT46.087e-1333.33FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HG... [more]
NOTCH41.105e-1231.97notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884... [more]
NOTCH41.124e-1231.97notch receptor 4 [Source:HGNC Symbol;Acc:HGNC:7884... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-125.906e-1132.56pep chromosome:WBcel235:III:9060096:9071760:-1 gen... [more]
clec-782.294e-931.78C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
ZC116.33.880e-942.03Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc... [more]
egas-44.894e-930.30EGF plus ASC domain ion channel [Source:UniProtKB... [more]
slt-15.007e-930.07Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
N2.935e-1438.40gene:FBgn0004647 transcript:FBtr0304659[more]
N2.935e-1438.40gene:FBgn0004647 transcript:FBtr0070507[more]
CG422555.657e-1437.38gene:FBgn0259140 transcript:FBtr0332131[more]
uif3.378e-1235.42gene:FBgn0031879 transcript:FBtr0307072[more]
uif3.378e-1235.42gene:FBgn0031879 transcript:FBtr0302162[more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LO018022.11.929e-1433.06FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
LO018022.11.929e-1433.06FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
LO018022.13.859e-1433.06FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
notch1a1.181e-1333.06notch receptor 1a [Source:NCBI gene;Acc:30718][more]
notch38.993e-1334.15notch receptor 3 [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNED17.471e-1537.72sushi, nidogen and EGF-like domains 1 [Source:NCBI... [more]
SNED17.671e-1537.72sushi, nidogen and EGF-like domains 1 [Source:NCBI... [more]
SNED18.191e-1537.72sushi, nidogen and EGF-like domains 1 [Source:NCBI... [more]
NOTCH32.799e-1431.09notch 3 [Source:NCBI gene;Acc:100494244][more]
FAT46.854e-1333.06FAT atypical cadherin 4 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Notch36.367e-1633.33notch 3 [Source:MGI Symbol;Acc:MGI:99460][more]
Notch11.117e-1437.50notch 1 [Source:MGI Symbol;Acc:MGI:97363][more]
Svep11.284e-1332.28sushi, von Willebrand factor type A, EGF and pentr... [more]
Slit13.306e-1232.38slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Notch43.458e-1232.26notch 4 [Source:MGI Symbol;Acc:MGI:107471][more]
back to top
BLAST of Hyaluronan binding protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C6B8|SVEP1_RAT2.304e-1538.33Sushi, von Willebrand factor type A, EGF and pentr... [more]
sp|Q9R172|NOTC3_RAT4.080e-1534.15Neurogenic locus notch homolog protein 3 OS=Rattus... [more]
sp|Q61982|NOTC3_MOUSE4.454e-1533.33Neurogenic locus notch homolog protein 3 OS=Mus mu... [more]
sp|Q9UM47|NOTC3_HUMAN7.604e-1533.33Neurogenic locus notch homolog protein 3 OS=Homo s... [more]
sp|Q07008|NOTC1_RAT7.613e-1437.50Neurogenic locus notch homolog protein 1 OS=Rattus... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6TW662.687e-1739.09Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A2B4SPX55.050e-1640.32Neurogenic locus Notch protein OS=Stylophora pisti... [more]
A0A4C1YMN53.065e-1542.71Protein crumbs OS=Eumeta variegata OX=151549 GN=cr... [more]
A0A2G9SJ074.277e-1534.68Uncharacterized protein OS=Lithobates catesbeianus... [more]
K1RU249.995e-1539.02Neurogenic locus Notch protein OS=Crassostrea giga... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch33.092e-1534.96neurogenic locus notch homolog protein 2 [Source:N... [more]
notch33.170e-1534.96neurogenic locus notch homolog protein 2 [Source:N... [more]
slit31.527e-1435.24slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
slit31.596e-1435.24slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
slit31.711e-1435.24slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004043.12.722e-1331.93pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.12.724e-1331.93pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000002014.16.346e-1228.38pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 g... [more]
ENSPMAT00000005361.11.571e-1131.50pep scaffold:Pmarinus_7.0:GL479377:6554:13965:1 ge... [more]
ENSPMAT00000002017.12.017e-1133.33pep scaffold:Pmarinus_7.0:GL482490:2146:11907:-1 g... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO347031.345e-1532.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481492.999e-1532.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469691.926e-1438.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354135.073e-1431.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488518.723e-1435.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slit32.715e-1335.05slit homolog 3 protein [Source:NCBI gene;Acc:10117... [more]
slit32.848e-1335.05slit homolog 3 protein [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000012788.26.453e-1333.33eyes shut homolog [Source:NCBI gene;Acc:105355817][more]
notch1b8.349e-1330.41notch receptor 1 [Source:NCBI gene;Acc:101161732][more]
notch31.898e-1232.52neurogenic locus notch homolog protein 2 [Source:N... [more]
back to top
BLAST of Hyaluronan binding protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061109.10.000e+099.74SMESG000061109.1[more]
SMESG000025423.17.070e-1330.89SMESG000025423.1[more]
SMESG000025423.18.125e-1330.89SMESG000025423.1[more]
SMESG000022173.11.772e-1132.52SMESG000022173.1[more]
SMESG000022173.11.848e-1132.52SMESG000022173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022385 ID=SMED30022385|Name=Hyaluronan binding protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1464bp
AAAATATTTCACTCCATATTTTCAAGATAAAATTAATTTTTTTTAAGATA
ACTAAATTAGTTATTTTCTATTTAAAGTATTATCGACAGTATTATTAAAT
AATTTAATTATTTTTAATTATATTAAAATGCTTTTTATTTTGATTGTTAT
ACCATTATTTTTTTCAGTCAAGGCTGGCAATTTTAATGTCACAATTATAA
AAACCGAGATAAAATATAAAAATGACGAAAATCTTATGGTTTACTGTGAC
AAGAATAACTTTACAGTGAATCCCATTTGTGTAATTAATATTTCAGTTTG
TTTTCATAAAAATTGTCTAAAGTCGAGAGACGGAACATTTCCTCGTGTTC
CAATTCTAATTTATGGTGAAAAAACTAAGATAGTTTCGAATTTAAGTTTG
TCTGAGGGTAGTAATAATTTAACAGTTGAATTTGATCCGTTTGATCTCAA
CTCGATCAATAATAAGCCGTTCCACCTAACAAATTCAAAGCACAATCTTA
GTTTTATGATACAGTTCTCCATGAAATGCCAAAAAGATTATTTATCGCCA
AATTGCTCTGAAATCGATTTCTGTGAAAAACTCAACACTACTCTGTGTAA
AAATAACGGAAAATGTATTCAAAAATACGCAAAAATCAGTTGCGAGTGTC
CTTCCGAATACACAGGGGATTTCTGTGAAGATGATAAAGATTCTTGCCTC
AATAACTCATGCATCAATAATTCAACTTGTCAAATAAGTCCAGCTTCAAA
GTTGAAGTACAAATGCATTTGCCCAATATATTTCCAAGGGACATTTTGTC
ATGAAGATGTAAATGAATGCTCTGATAAATCTTCCTGCCGCTCAAATGCC
ACATGCATTAATAATTATGGCGGATACAATTGCTCGATTGAGGTCTCATC
TCAAACGACTACCTCGACTTCATCGCCTTCAGTAGAAATATCTACTACAC
AAATTTCAAATTTCATTAAATGGAATTTGCCAGATTTTGCCACTTTGCTC
ATTGTATCTATCGAAGCTGCAATAATAATTATACTTATTTTTGTATTGAT
ATTCGTTCAAGTCAAAAACTGTCCAACGAAAAGAAAGAAATCTAAATTTC
TTGTCGATGATTCTTCTTTATTCATTAAATCGAAAGAAAAGACACAAAAC
GATTATGATGGAAATTTTGGACGATCTCATTTGCTTCCAGATGAACGCCA
TCAAAGTTTAGTTCCAATGTTTGACCTTCATGAACTCGAAAACACATTCA
ACAATAATCTATCAAACAATTCACCGGGAATGAGCACATTTGGACGTAGA
TAAAATATATGCAACGATTTTTATTTTGGAATAATTGACTTAAACCAATC
AAAGCAACAATGCCATCTAGTGATTATTATTTGTCAATATCCTTTATGAT
GATGCCAATATATGTATCCGATTATTTATTTGAATATATTTGTAATTGTT
TTGTTAAAAAAAAA
back to top

protein sequence of SMED30022385-orf-1

>SMED30022385-orf-1 ID=SMED30022385-orf-1|Name=SMED30022385-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
MLFILIVIPLFFSVKAGNFNVTIIKTEIKYKNDENLMVYCDKNNFTVNPI
CVINISVCFHKNCLKSRDGTFPRVPILIYGEKTKIVSNLSLSEGSNNLTV
EFDPFDLNSINNKPFHLTNSKHNLSFMIQFSMKCQKDYLSPNCSEIDFCE
KLNTTLCKNNGKCIQKYAKISCECPSEYTGDFCEDDKDSCLNNSCINNST
CQISPASKLKYKCICPIYFQGTFCHEDVNECSDKSSCRSNATCINNYGGY
NCSIEVSSQTTTSTSSPSVEISTTQISNFIKWNLPDFATLLIVSIEAAII
IILIFVLIFVQVKNCPTKRKKSKFLVDDSSLFIKSKEKTQNDYDGNFGRS
HLLPDERHQSLVPMFDLHELENTFNNNLSNNSPGMSTFGRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR001881EGF-like_Ca-bd_dom
IPR013032EGF-like_CS
IPR018097EGF_Ca-bd_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 189..225
e-value: 0.12
score: 21.4
coord: 148..184
e-value: 0.0068
score: 25.6
IPR000742EGF-like domainPFAMPF00008EGFcoord: 149..181
e-value: 7.7E-6
score: 26.1
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 227..253
score: 7.726
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 145..184
score: 16.403
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 186..225
score: 15.351
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 145..184
e-value: 0.0078
score: 18.8
coord: 186..225
e-value: 0.59
score: 3.7
coord: 227..264
e-value: 0.022
score: 15.3
IPR001881EGF-like calcium-binding domainPFAMPF07645EGF_CAcoord: 227..255
e-value: 8.0E-7
score: 29.2
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 189..227
e-value: 3.3E-6
score: 29.0
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 228..286
e-value: 1.3E-7
score: 34.2
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 110..188
e-value: 1.0E-8
score: 37.2
NoneNo IPR availablePANTHERPTHR24044FAMILY NOT NAMEDcoord: 43..253
NoneNo IPR availableCDDcd00054EGF_CAcoord: 227..253
e-value: 4.20947E-5
score: 38.3866
NoneNo IPR availableCDDcd00054EGF_CAcoord: 146..184
e-value: 6.55679E-4
score: 34.9198
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.846
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 186..233
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 145..190
NoneNo IPR availableTMHMMTMhelixcoord: 288..310
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 172..183
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 213..224
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 227..252