TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30022383
Length (bp)1433
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30022383) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30022383) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30022383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30022383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022383SMESG000047778.1 Contig3134GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30022383SMESG000047778.1 dd_Smed_v4_3201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022383SMESG000047778.1 dd_Smed_v4_3201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022383SMESG000047778.1 dd_Smed_v4_3201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022383SMESG000047778.1 dd_Smed_v6_3201_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022383SMESG000047778.1 dd_Smed_v4_3201_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022383SMESG000047778.1 dd_Smed_v4_3201_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022383SMESG000047778.1 dd_Smed_v4_3201_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 169.859 bits (429), Expect = 1.598e-46
Identity = 127/441 (28.80%), Postives = 221/441 (50.11%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPA-------FQYENIHLN----------------IENPLELCENFTRSCPY-----KCSDEKYHNIKRHLIEYHN--KEENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTD-------------SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN-KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            ++ ++ C+ C+ ++  P Q  CG RFC+ C        S KC +  C++  +K K+  D   ++E+  + I C N++  C  ++ L +L  HL+  C    + C +  C  K+L K   DH    C  R  TC+ C+  +P         Q E++  N                IE   E+  N      +         EK   + + +  +    +E +S+K+S    +E +     ++++++KS  ++ RNT              SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q  + + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA--CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSS----VESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 477          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 143.28 bits (360), Expect = 1.191e-36
Identity = 68/172 (39.53%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN-KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q  + + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  368 SVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 535          

HSP 2 Score: 60.077 bits (144), Expect = 5.207e-9
Identity = 48/171 (28.07%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS 716
            ++ ++ C+ C+ ++  P Q  CG RFC+ C        S KC +  C++  +K K+  D   ++E+  + I C N++  C  ++ L +L  HL+  C    + C +  C  K+L K   DH    C  R  TC+ C+  +P    +  H + +     C     SCP+KCS
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA--CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-HEDTD-----CPCVVVSCPHKCS 209          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 143.28 bits (360), Expect = 1.191e-36
Identity = 68/172 (39.53%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN-KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q  + + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  368 SVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 535          

HSP 2 Score: 60.077 bits (144), Expect = 5.207e-9
Identity = 48/171 (28.07%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS 716
            ++ ++ C+ C+ ++  P Q  CG RFC+ C        S KC +  C++  +K K+  D   ++E+  + I C N++  C  ++ L +L  HL+  C    + C +  C  K+L K   DH    C  R  TC+ C+  +P    +  H + +     C     SCP+KCS
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA--CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-HEDTD-----CPCVVVSCPHKCS 209          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 143.665 bits (361), Expect = 1.392e-36
Identity = 68/172 (39.53%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN-KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q  + + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  393 SVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 560          

HSP 2 Score: 59.6918 bits (143), Expect = 6.392e-9
Identity = 48/171 (28.07%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS 716
            ++ ++ C+ C+ ++  P Q  CG RFC+ C        S KC +  C++  +K K+  D   ++E+  + I C N++  C  ++ L +L  HL+  C    + C +  C  K+L K   DH    C  R  TC+ C+  +P    +  H + +     C     SCP+KCS
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA--CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-HEDTD-----CPCVVVSCPHKCS 209          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 143.665 bits (361), Expect = 1.392e-36
Identity = 68/172 (39.53%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN-KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q  + + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  393 SVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 560          

HSP 2 Score: 59.6918 bits (143), Expect = 6.392e-9
Identity = 48/171 (28.07%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS 716
            ++ ++ C+ C+ ++  P Q  CG RFC+ C        S KC +  C++  +K K+  D   ++E+  + I C N++  C  ++ L +L  HL+  C    + C +  C  K+L K   DH    C  R  TC+ C+  +P    +  H + +     C     SCP+KCS
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA--CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-HEDTD-----CPCVVVSCPHKCS 209          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 120.553 bits (301), Expect = 1.745e-29
Identity = 109/415 (26.27%), Postives = 189/415 (45.54%), Query Frame = 3
Query:  240 CKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDI---EIKQKIPDRAIEKEMSKISISCI--NDNCQVKMFLPNLHRHLQQCP-ESVINCKKCFVKILLKTQFDHENVNC-INRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENSLKN-----------SSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELL--NIEKTNLKQ---LISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKD----ITECFKPT---SESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            C +C   +  P+++NC   +C +C +N  + R+  C +  C+ I   E+ Q   DRA +K++  + + C   +  C     L  LH HL +C  +S + C+KC  +   K   +     C +NR+V C+ C K +     E       +P + C     SCP++C      +  R  IE H     ++ N           +  +   +     + ++++   C E+     + EL+  ++   N +Q   L +  +C +  G   +WKI+       ++KSG + ++ S PF +   GYKM      FGDG   G  +S+Y+ + KG++D  L WPF +  KIS+L+QN   +    IT    P    +      RP GE N A G+  F  L  L    ++ KDD +++++ V
Sbjct:   18 CPICEQALRDPIKLNCDHHYCRQCFEN--ENRTPGCAA--CQTIIQPELCQH--DRAKQKQILALPVVCTFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCG-RQFAKNDLEKHRAKCELNRAV-CSFCNKTIRDSDRER------HP-KTCPQVIISCPFQCG---LTDRPRLEIEAHCPSCPNVDNVCPFVPYGCTFAGGKESIQQHLSDEPVRHLMYLCDEITDLKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAIL---QNYVKDDKIYVQIDV 411          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 72.4034 bits (176), Expect = 9.308e-14
Identity = 47/158 (29.75%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  939 SCYKHVGSTFVWKIEHFTDTV-KKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECF----KPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVVL 1397
            S ++  GS   ++I     TV K +K+  + S+ SQPFY+   GYKM      +GDG+    + S+++ + KG++D +L WPF      SIL+ +  + +T+       P  +    +RP+G   L  G   F +   L +  +F  D  +FI++ VL
Sbjct:  151 SAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEMPEIQEF-LERPEG---LRNGTFGFQNFLPLAKVTEFAADGDIFIQIKVL 304          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 122.479 bits (306), Expect = 6.317e-30
Identity = 89/327 (27.22%), Postives = 151/327 (46.18%), Query Frame = 3
Query:  450 CQVKMFLPNLHRHLQQCPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEEN-------SLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN---GNKDITECFKPTSESLSYQRPDGEIN-LATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            CQ +     L  H   C +  + C+ KC  +IL      H++ +C  R   CA CQ+    F  + + L+       C     +CP +C       I R  +E H ++E        S K +              +++   + + L     S +   I+   LK  +SK+S   + G T +WKI  ++  + +++    L L+S PFYT + GYK+   ++  G+G G+ TH+S+Y+ +  G+YD+LL WPFS     ++  Q    G   + E F P     ++QRP  E + L  G PRF+  + L+ +  F K D +F+++ V
Sbjct:  158 CQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQR---EFSADTLPLHAAQ----CPRAPLACPQRCDAGP---IPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQM--LKSAVSKLS-INYTG-TLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLH-SRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 122.094 bits (305), Expect = 9.338e-30
Identity = 89/327 (27.22%), Postives = 151/327 (46.18%), Query Frame = 3
Query:  450 CQVKMFLPNLHRHLQQCPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEEN-------SLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN---GNKDITECFKPTSESLSYQRPDGEIN-LATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            CQ +     L  H   C +  + C+ KC  +IL      H++ +C  R   CA CQ+    F  + + L+       C     +CP +C       I R  +E H ++E        S K +              +++   + + L     S +   I+   LK  +SK+S   + G T +WKI  ++  + +++    L L+S PFYT + GYK+   ++  G+G G+ TH+S+Y+ +  G+YD+LL WPFS     ++  Q    G   + E F P     ++QRP  E + L  G PRF+  + L+ +  F K D +F+++ V
Sbjct:  167 CQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQR---EFSADTLPLHAAQ----CPRAPLACPQRCDAGP---IPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQM--LKSAVSKLS-INYTG-TLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLH-SRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 55.0694 bits (131), Expect = 6.707e-8
Identity = 27/95 (28.42%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  933 KVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQ 1217
            +++  +++    +W+I+ ++  +++SK    + L S  F  K  GY + L IY  G G  KG ++   + +  G+YD LL WP   + +I I +Q
Sbjct:  246 RIASVQNIRGHLIWRIKDYSKKLEESKQYDTI-LHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 339          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 55.0694 bits (131), Expect = 6.707e-8
Identity = 27/95 (28.42%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  933 KVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQ 1217
            +++  +++    +W+I+ ++  +++SK    + L S  F  K  GY + L IY  G G  KG ++   + +  G+YD LL WP   + +I I +Q
Sbjct:  246 RIASVQNIRGHLIWRIKDYSKKLEESKQYDTI-LHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 339          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0334036)

HSP 1 Score: 55.0694 bits (131), Expect = 6.707e-8
Identity = 27/95 (28.42%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  933 KVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQ 1217
            +++  +++    +W+I+ ++  +++SK    + L S  F  K  GY + L IY  G G  KG ++   + +  G+YD LL WP   + +I I +Q
Sbjct:  246 RIASVQNIRGHLIWRIKDYSKKLEESKQYDTI-LHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ 339          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 146.362 bits (368), Expect = 9.853e-38
Identity = 71/181 (39.23%), Postives = 113/181 (62.43%), Query Frame = 3
Query:  861 ELNRNTD--SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +L R+ D  SV  + + + +LK  + + + +     T +WKI  +    +++   + LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  + +G+YD+LL WPF QK  + +++Q    K + + FKP   S S++RP GE+N+A+G P FV  +T+ +N  + KDD +FIK+ V
Sbjct:  389 QLTRHDDLMSVHDVRLAEMDLKLQVLETASF---NGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMNIASGCPLFV-AQTVLENGTYIKDDTIFIKVTV 565          

HSP 2 Score: 54.299 bits (129), Expect = 2.259e-7
Identity = 48/196 (24.49%), Postives = 85/196 (43.37%), Query Frame = 3
Query:  195 KDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIND--NCQVKMFLPNLHRHLQQCPESVINCK--KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKE 770
            +D+  +T + K  + C+ C  ++  P Q  CG RFC+ C +      +  CP +D   +   +   D    +E+  + + C ++   C+ +M L  +  HL  CP   + C   KC  K++ K   +H +  C +R VTC  C   M   + +     +      C  F  +CP  CS   + +I R  +  H  +
Sbjct:   43 RDHFVTTPEPK--YCCETCRLVLCNPRQTECGHRFCESCINELLSKPNPVCP-ADLLPLFEDKIFRDVCCNREIMALKVYCRSEKNGCKEQMCLQQVMEHLVICPYFEVPCPLGKCKEKMMRKDMPEHLSRKCKHREVTCEFCSLKMALTELQKHKETV------CPAFPVACPNHCS---FSSILRSELSSHQHD 226          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 141.739 bits (356), Expect = 1.008e-36
Identity = 119/466 (25.54%), Postives = 189/466 (40.56%), Query Frame = 3
Query:  219 KLKTRFFCKLCNSLMNVPVQMN-CGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIN--DNCQVKMFLPNLHRHLQQCPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYEN-----------------------------------------------IHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKE------------ENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNG-----NKDITECFKPTSESLSYQRPDG------EINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            K K RF C LC+  M  PVQ++ CG RFCD C   +      KCP  D   ++  +  PD  +E+++  + I CI+  + C+    +  L  H   C  +VI C  +C VK+  +   +H   +C  R V C  C        YEN                                               ++  I+N    C  F   CP +C      NI R  +  H KE            E   K+   ++            ++   C  + R    +  L  E   L           H G   +WK+  ++  ++++K   N    S PFYT   GYK+ +  +  G+G G+G+HLSIY+ +  G+YD+LL WPFS K   SIL+Q+       + ITE F P     ++Q+P        E  L  G P+F+  + + +  ++ +D+ +F+K  +
Sbjct:   11 KPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE-DQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTP---NIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSLVGRQRQEILELRREMEELS--------VSHDG-VLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEI-KKRNYIRDNSIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 141.739 bits (356), Expect = 1.008e-36
Identity = 119/466 (25.54%), Postives = 189/466 (40.56%), Query Frame = 3
Query:  219 KLKTRFFCKLCNSLMNVPVQMN-CGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIN--DNCQVKMFLPNLHRHLQQCPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYEN-----------------------------------------------IHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKE------------ENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNG-----NKDITECFKPTSESLSYQRPDG------EINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            K K RF C LC+  M  PVQ++ CG RFCD C   +      KCP  D   ++  +  PD  +E+++  + I CI+  + C+    +  L  H   C  +VI C  +C VK+  +   +H   +C  R V C  C        YEN                                               ++  I+N    C  F   CP +C      NI R  +  H KE            E   K+   ++            ++   C  + R    +  L  E   L           H G   +WK+  ++  ++++K   N    S PFYT   GYK+ +  +  G+G G+G+HLSIY+ +  G+YD+LL WPFS K   SIL+Q+       + ITE F P     ++Q+P        E  L  G P+F+  + + +  ++ +D+ +F+K  +
Sbjct:   11 KPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE-DQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTP---NIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSLVGRQRQEILELRREMEELS--------VSHDG-VLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEI-KKRNYIRDNSIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 142.895 bits (359), Expect = 1.050e-36
Identity = 61/145 (42.07%), Postives = 93/145 (64.14%), Query Frame = 3
Query:  960 STFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
              F+WKI  F+   + + +G+  ++ S  FY+ + GYKM L++Y  GDG G+G+HLS++  + KGKYD+LL WPFSQK  + +L+QN  + I + F+P   S S+QRP  E+N+A+G P F  L  L     + +DD +FIK +V
Sbjct:  383 GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          

HSP 2 Score: 62.7734 bits (151), Expect = 4.387e-10
Identity = 52/205 (25.37%), Postives = 87/205 (42.44%), Query Frame = 3
Query:  189 LSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTK-CPSSDCRD----------IEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNL-HRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNK 767
            +S++ L  +  ++ ++ C+ C  ++  P Q  CG RFC  C   + QL S+   P   CR           + I    PD A  +E+  +   C N+ C     L +  ++H  +C    + C+ C V ILL  +  H    C  R++ C  C+     F ++ I  +     E+C+ F    P +C D     I R   + H K
Sbjct:   30 ISREVL--SVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFC---FKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVT---FNFKEIKAHD----EICQKF----PMQCKDCGKKKIPREKFQEHTK 218          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 142.895 bits (359), Expect = 1.050e-36
Identity = 61/145 (42.07%), Postives = 93/145 (64.14%), Query Frame = 3
Query:  960 STFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
              F+WKI  F+   + + +G+  ++ S  FY+ + GYKM L++Y  GDG G+G+HLS++  + KGKYD+LL WPFSQK  + +L+QN  + I + F+P   S S+QRP  E+N+A+G P F  L  L     + +DD +FIK +V
Sbjct:  383 GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          

HSP 2 Score: 62.7734 bits (151), Expect = 4.387e-10
Identity = 52/205 (25.37%), Postives = 87/205 (42.44%), Query Frame = 3
Query:  189 LSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTK-CPSSDCRD----------IEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNL-HRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNK 767
            +S++ L  +  ++ ++ C+ C  ++  P Q  CG RFC  C   + QL S+   P   CR           + I    PD A  +E+  +   C N+ C     L +  ++H  +C    + C+ C V ILL  +  H    C  R++ C  C+     F ++ I  +     E+C+ F    P +C D     I R   + H K
Sbjct:   30 ISREVL--SVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFC---FKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVT---FNFKEIKAHD----EICQKF----PMQCKDCGKKKIPREKFQEHTK 218          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 150.214 bits (378), Expect = 1.928e-39
Identity = 122/459 (26.58%), Postives = 206/459 (44.88%), Query Frame = 3
Query:  219 KLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRS------TKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMC-QKVMPAFQYENIHLNIENPLELCENFTRSCP--------------YKCSDEKYHNIKRHL------IEYHNKEENSL----------------------KNSSLXXXXXXXXXXXXXXXXXXS--CVELNRNTDSVELLN-----IEKT-NLKQLI----------SKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            KL+ ++ C  C +L+  P+Q  CG R+C  C +   +  +       +CP+  C   +    +     E +   +   C      ++    +LH   ++CPE  +NC+ C +         H+ + C    +TC  C +K +P    E + L +        N T S P               KC + +  ++  HL      I++  KE+N L                      KN++ E I  +     +  +        +L    + VE L      +E+T   K+LI          S++S Y  V   F+WKI  F    + + +G+  ++ S PFYT + GYKM L+IY  GDG G+ THLS++  + KG  D+LL WPF+QK  + +L+QN  + + + F+P   S S+QRP  E+N+A+G P F  +  L   + + +DD +F+K++V
Sbjct:   30 KLEVKYLCSDCKNLLRRPLQAQCGHRYCSHCLNKIIRWVARNWGGVPECPAV-CERSDWTGALISVGHEGKCPYLLAPCPACKTIIRAANRDLHSE-RECPERKLNCRYCKLSFYFPDIKAHDEI-CPKFPMTCEGCGRKKIP---REKVRLFV---CSFSRNITLSLPCRYAAVGCTEMVENDKCLEHENKSLAEHLAKVWDYIQHGRKEQNDLSVRMGSLSVQGSPAPPFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAAQEKVEALTTKVRQLERTLGQKELIVAELETRMQESELSTYDGV---FIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 143.665 bits (361), Expect = 9.402e-37
Identity = 70/182 (38.46%), Postives = 114/182 (62.64%), Query Frame = 3
Query:  858 VELNRNTD--SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
             ++NR+    SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q    + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  351 TQINRHDQMLSVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 528          

HSP 2 Score: 53.5286 bits (127), Expect = 5.464e-7
Identity = 45/171 (26.32%), Postives = 79/171 (46.20%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCIND--NCQVKMFLPNLHRHLQQ-CPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS 716
            ++ ++ C+ C  ++  P Q  CG RFC+ C +      S +C +  C D   K K+  D    +E+  + + C N+   C+  + L NL  HL+  C    ++C +  C  K++ K   DH    C  R   C  C+  +P  + +  H +++     C +   SCP+ CS
Sbjct:   42 VEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMA--CEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQK-HEDVD-----CPSVVISCPHMCS 204          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 143.665 bits (361), Expect = 1.223e-36
Identity = 70/182 (38.46%), Postives = 114/182 (62.64%), Query Frame = 3
Query:  858 VELNRNTD--SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
             ++NR+    SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q    + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  376 TQINRHDQMLSVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 553          

HSP 2 Score: 53.5286 bits (127), Expect = 5.805e-7
Identity = 48/186 (25.81%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCIND--NCQVKMFLPNLHRHLQQ-CPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKY--HNIKRHLIE 755
            ++ ++ C+ C  ++  P Q  CG RFC+ C +      S +C +  C D   K K+  D    +E+  + + C N+   C+  + L NL  HL+  C    ++C +  C  K++ K   DH    C  R   C  C+  +P  + +  H +++     C +   SCP+ CS +      +  HL+E
Sbjct:   42 VEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMA--CEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQK-HEDVD-----CPSVVISCPHMCSVKSLLRSELNAHLLE 219          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 140.198 bits (352), Expect = 4.123e-36
Identity = 111/415 (26.75%), Postives = 190/415 (45.78%), Query Frame = 3
Query:  270 PVQMNCGCRFCDKCCDNYFQLRS------TKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMC-QKVMPAFQYENIHLNIENPLELCENFTRSCPY-----KCSDEKYHNIKRHLIE------YHNKEENSLKNSSLXXXXXXXXXXXXXXXXXXSCV--ELNRNTDSVELL---------NIEKT-NLKQLI----------SKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            P+Q  CG R+C  C +   +  +       +CP+  C   +    +     E +   +   C      ++    +LH   ++CPE  +NC+ C +         H+ + C    +TC  C +K +P    E + L +  P   C      C       KC + +  ++  HL +       +    NS K + + +                S +  E+ R++ + E L          +E+T   K+LI          S++S Y  V   F+WKI  F    + + +G+  ++ S PFYT + GYKM L+IY  GDG G+ THLS++  + KG  D+LL WPF+QK  + +L+QN  + + + F+P   S S+QRP  E+N+A+G P F  +  L   + + +DD +F+K++V
Sbjct:   47 PLQAQCGHRYCSHCLNKIIRWVARNWGGVPECPAV-CERSDWTGALISVGHEGKCPYLLAPCPACKTIIRAANRDLHSE-RECPERKLNCRYCKLSFYFPDIKAHDEI-CPKFPMTCEGCGRKKIP---REKVRLFVCMP---CRYAAVGCTEMVENDKCLEHENKSLAEHLAKGSPAPPANAPPNNSAKVAEMLLKFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAADTRLERTLGQKELIVAELETRMQESELSTYDGV---FIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 449          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 140.584 bits (353), Expect = 4.873e-36
Identity = 113/468 (24.15%), Postives = 199/468 (42.52%), Query Frame = 3
Query:  219 KLKTRFFCKLCNSLMNVPVQMN-CGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIN-----------------------------DNCQVKMFLPNLHRHLQQ---------------------------CPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENS-------LKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNG-----NKDITECFKPTSESLSYQRPDG------EINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            KL+ +F C LC   M  PVQ++ CG RFCD C   +      KCP  D   ++  +  PDR +E ++  +SI CI+                             + C  K+   +L  H+Q                            CP+  + C+ KC  +++ +    H  V C  R+  C  C K       E +   I++    C  +   CP +C      +I R  +  H K+  S        K+S  +         + ++   ++   L+  +  V     E   L++ + ++S         +WKI  ++  V+++K   N    S PFYT + GYK+ +  +  G+G G+G++LS+Y+ +  G+YD+LL WPFS +   S+L+Q+       + ITE F P     ++Q+P G      E  L  G P+F+  + + +  ++ +D+ +F++  V
Sbjct:   11 KLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE-DQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADFTGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHSLVECPKRTQPCPYCNK-------EFVFDTIQSHQYQCPRYPTPCPNQCG---IASIAREDLSNHLKDSCSSALVLCPFKDSGCKHRGPKITISRHLEENMRA--HLSMMSSLVSRQRQEILELRKQVEELSVSSE--GVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDI-RKRNYVRDNAIFLRASV 462          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 141.739 bits (356), Expect = 1.369e-38
Identity = 71/169 (42.01%), Postives = 106/169 (62.72%), Query Frame = 3
Query:  894 LNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKD-ITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDD-FTKDDILFIKLVV 1394
            LN  +   KQL  + +CY       +WK+  +    +++  G  +S+ SQPFYT   GY++  + Y  GDG GKGTHLS+Y  + +G++DSLL WPF Q+  + +L+Q+G K+ I E FK    S S++RPDGE+N+A+G PRFV   TL  + + + KDD LF+K+ V
Sbjct:   79 LNKNEERFKQL--EGACY---SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 242          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 141.739 bits (356), Expect = 1.369e-38
Identity = 71/169 (42.01%), Postives = 106/169 (62.72%), Query Frame = 3
Query:  894 LNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKD-ITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDD-FTKDDILFIKLVV 1394
            LN  +   KQL  + +CY       +WK+  +    +++  G  +S+ SQPFYT   GY++  + Y  GDG GKGTHLS+Y  + +G++DSLL WPF Q+  + +L+Q+G K+ I E FK    S S++RPDGE+N+A+G PRFV   TL  + + + KDD LF+K+ V
Sbjct:   79 LNKNEERFKQL--EGACY---SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 242          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 145.591 bits (366), Expect = 1.655e-37
Identity = 71/169 (42.01%), Postives = 106/169 (62.72%), Query Frame = 3
Query:  894 LNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKD-ITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDD-FTKDDILFIKLVV 1394
            LN  +   KQL  + +CY       +WK+  +    +++  G  +S+ SQPFYT   GY++  + Y  GDG GKGTHLS+Y  + +G++DSLL WPF Q+  + +L+Q+G K+ I E FK    S S++RPDGE+N+A+G PRFV   TL  + + + KDD LF+K+ V
Sbjct:  381 LNKNEERFKQL--EGACY---SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          

HSP 2 Score: 60.8474 bits (146), Expect = 1.943e-9
Identity = 45/172 (26.16%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  207 QSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIND-NCQVKMFLPNLHRHLQQCPESVINC--KKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKC 713
            Q   +L+ R+ C  C+S+++ P Q  CG RFC +C  +  +L S      D   I+ ++   D   ++E+  + + C N   C  ++ L     HLQ C    + C  + C   +L K   +H +  C  R   C  C++ +      N+  + EN    C  +  SCP +C
Sbjct:   34 QFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVV---TNLQDHEENS---CPAYPVSCPNRC 199          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 145.591 bits (366), Expect = 1.655e-37
Identity = 71/169 (42.01%), Postives = 106/169 (62.72%), Query Frame = 3
Query:  894 LNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKD-ITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDD-FTKDDILFIKLVV 1394
            LN  +   KQL  + +CY       +WK+  +    +++  G  +S+ SQPFYT   GY++  + Y  GDG GKGTHLS+Y  + +G++DSLL WPF Q+  + +L+Q+G K+ I E FK    S S++RPDGE+N+A+G PRFV   TL  + + + KDD LF+K+ V
Sbjct:  381 LNKNEERFKQL--EGACY---SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          

HSP 2 Score: 60.8474 bits (146), Expect = 1.943e-9
Identity = 45/172 (26.16%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  207 QSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIND-NCQVKMFLPNLHRHLQQCPESVINC--KKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKC 713
            Q   +L+ R+ C  C+S+++ P Q  CG RFC +C  +  +L S      D   I+ ++   D   ++E+  + + C N   C  ++ L     HLQ C    + C  + C   +L K   +H +  C  R   C  C++ +      N+  + EN    C  +  SCP +C
Sbjct:   34 QFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVV---TNLQDHEENS---CPAYPVSCPNRC 199          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 143.28 bits (360), Expect = 9.185e-37
Identity = 68/172 (39.53%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN-KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q  + + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  367 SVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 534          

HSP 2 Score: 59.6918 bits (143), Expect = 4.765e-9
Identity = 48/171 (28.07%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCIND--NCQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS 716
            ++ ++ C+ C  ++  P Q  CG RFC+ C        S KC +  C++  IK K+  D   ++E+  + + C N+   C  ++ L +L  HL+ +C    + C +  C  K+L K   DH    C  R  TC+ C+  +P  + +  H + +     C     SCP+KCS
Sbjct:   46 VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTA--CQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQK-HEDTD-----CPCVVVSCPHKCS 208          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.941e-36
Identity = 71/169 (42.01%), Postives = 106/169 (62.72%), Query Frame = 3
Query:  894 LNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKD-ITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDD-FTKDDILFIKLVV 1394
            LN  +   KQL  + +CY       +WK+  +    +++  G  +S+ SQPFYT   GY++  + Y  GDG GKGTHLS+Y  + +G++DSLL WPF Q+  + +L+Q+G K+ I E FK    S S++RPDGE+N+A+G PRFV   TL  + + + KDD LF+K+ V
Sbjct:  387 LNKNEERFKQL--EGACY---SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 550          

HSP 2 Score: 61.2326 bits (147), Expect = 1.129e-8
Identity = 45/172 (26.16%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  207 QSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIND-NCQVKMFLPNLHRHLQQCPESVINC--KKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKC 713
            Q   +L+ R+ C  C+S+++ P Q  CG RFC +C  +  +L S      D   I+ ++   D   ++E+  + + C N   C  ++ L     HLQ C    + C  + C   +L K   +H +  C  R   C  C++ +      N+  + EN    C  +  SCP +C
Sbjct:   34 QFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVV---TNLQDHEENS---CPAYPVSCPNRC 199          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 6.687e-36
Identity = 68/172 (39.53%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN-KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q  + + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  393 SVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 560          

HSP 2 Score: 59.6918 bits (143), Expect = 3.070e-8
Identity = 48/171 (28.07%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS 716
            ++ ++ C+ C+ ++  P Q  CG RFC+ C        S KC +  C++  +K K+  D   ++E+  + I C N++  C  ++ L +L  HL+  C    + C +  C  K+L K   DH    C  R  TC+ C+  +P    +  H + +     C     SCP+KCS
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA--CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-HEDTD-----CPCVVVSCPHKCS 209          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 6.817e-36
Identity = 68/172 (39.53%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN-KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q  + + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:  392 SVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 559          

HSP 2 Score: 59.3066 bits (142), Expect = 4.163e-8
Identity = 48/171 (28.07%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCIND--NCQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS 716
            ++ ++ C+ C  ++  P Q  CG RFC+ C        S KC +  C++  IK K+  D   ++E+  + + C N+   C  ++ L +L  HL+ +C    + C +  C  K+L K   DH    C  R  TC+ C+  +P  + +  H + +     C     SCP+KCS
Sbjct:   46 VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTA--CQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQK-HEDTD-----CPCVVVSCPHKCS 208          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.785e-35
Identity = 62/171 (36.26%), Postives = 106/171 (61.99%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            S+ L ++   +L+Q +S++    + G  F+WKI  FT   +++ +G+  ++ S  FYT   GYKM L++Y  GDG G+GTHLS++  + KG  D+LL WPF+QK  + +L+ N  + + + F+P   S S+QRP  ++N+A+G P F  +  +   + + +DD +FIK +V
Sbjct:  327 SIGLKDLAMADLEQKVSELEVSTYDG-VFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          

HSP 2 Score: 60.077 bits (144), Expect = 2.481e-8
Identity = 40/170 (23.53%), Postives = 65/170 (38.24%), Query Frame = 3
Query:  219 KLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPS--------SDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHR-HLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSC 701
            +L+ ++ C  C +++  P Q  CG R+C  C  +        C +             +E     PD A  +E+  +   C ND C  K  L      H   CP  +  C  C   + L  +  H    C  RS++C  C+           H+++E   E+C  F  +C
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCS-------HVDLEVHYEVCPKFPLTC 189          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 1.802e-35
Identity = 63/153 (41.18%), Postives = 97/153 (63.40%), Query Frame = 3
Query:  939 SCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLY-QNDDFTKDDILFIKLVV 1394
            +CY       +WK+  +    +++  G  +S+ SQ FYT   GY++  + Y  GDG G+G+HLS+Y  + +G++DSLL WPF Q+  + +L+Q+G K+I E FKP   S S++RPDGE+N+A+G PRFV    L    + + KDD LF+K+ V
Sbjct:  400 TCY---NGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          

HSP 2 Score: 64.6994 bits (156), Expect = 8.215e-10
Identity = 48/174 (27.59%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  207 QSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIND-NCQVKMFLPNLHRHLQQCPESVINC--KKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLE-LCENFTRSCPYKCS 716
            Q   +L+ R+ C  C+S+++ P Q  CG RFC  C  +  +L +      D   I+ ++   D   ++E+  + + C N   C  K+ L     HLQQC    + C  +KC   +L K   +H + +C  R   C  C+K       + + +N++N  E LC  +   CP  C+
Sbjct:   34 QFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKK-------DVVVINLQNHEENLCPEYPVFCPNNCA 200          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.026e-58
Identity = 139/460 (30.22%), Postives = 216/460 (46.96%), Query Frame = 3
Query:  117 TNIPENYKFYSKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKC---FVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRH--------------------------LIEYHNKEENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLK-QLISKVSCYKHV---------------------GSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQ-NGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTL 1340
            +N+P N K Y K     +++DN +                 C +C+ L+   +Q +CGCR+C +C   Y     TKC +  C D+     IPD A+ +E+ K+++ C+   C+    L ++  HL  C    INCK C     KI LK   +H    C  R V+C  C + M       +HLN+    +LC      CPYKC + K  N+  H                          LI+++N+E  SL++S L + E I               EL   T    +L IE +  + +++ K+   + +                        F+WKIE F++   +++ G  +S+ S  FYTKE GYKM +KIY  GDG+GKGTHLS++  + +G++D LL WPF  K  ++IL+Q N   D ++ FKP   S  YQ+P  + N+A+G+P+F+    L
Sbjct:    6 SNLPTNIKRYRKKHFPFNISDNLK-----------------CIICSQLLLEALQTDCGCRYCKECLKEYQAKGKTKCLTDGCGDL--GNIIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDSCIHQTINCKSCNEELTKIELK---EHTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVHTE-KLCAKLVGKCPYKCDNGKEVNLLDHRKSCSKKPVTCLFSEIGCNRVMTKEDLIKHNNEE--SLQHSRLLMKEIITMKNDIS--------ELKMKTLEFNILKIEFSKFQSEILDKIKSLEKIPRHTSPSTSSVRSSEEKTVYRNGVFIWKIERFSELKSEAERGNRISITSDYFYTKEFGYKMSMKIYPAGDGVGKGTHLSVFFTLMRGEFDDLLQWPFKNKVTLTILDQKNKTNDHSDTFKPDVRSTCYQQPTDDYNIASGSPKFITFSQL 432          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 6.845e-55
Identity = 125/423 (29.55%), Postives = 209/423 (49.41%), Query Frame = 3
Query:  240 CKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSS--DCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNK------------------EENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNT---------DSVELLNIEKTNLKQLISKVSCYKHVGST------FVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQ-NGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVVLG 1400
            C +C  ++   +Q +CGCR+C +C DNY +    +C +   DCR + I   I DRA  KE+S + + C+ + C  +  L ++  HL  C      C  C ++ ++K + +H    C+ R V C  C+ ++   +Y   HL  E+  +LC  +   CPY C+ E   N+  H     NK                  +     N+S            +    +   +E   N           ++E++ ++       IS+ +  K    T      ++WKI+ F+   + +  G+N ++LS+ FYT + GYKM +KIY  GDG+GKGTHLSI+  I KG YD +L WPF  K  I+I +  + + ++++ FKP  +S+ YQRP+ E N+A+G+P+F+    L    +F K D L+I++ V+ 
Sbjct:   31 CVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSV-ITSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRTLLTFKEYNESHLCFESR-DLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQLIPKDQMTEHLNTSSYEHTLTIVTELRKLEKQNKHMEERMNILIEENQLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSEL---KNFLKKDTLYIQINVIA 448          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A493U4B7 (TNF receptor-associated factor OS=Anas platyrhynchos platyrhynchos OX=8840 GN=TRAF3 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.649e-49
Identity = 137/456 (30.04%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  123 IPENYKFYSKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS--------------DEKYHNIKRHLIEY-HNKEE--------NSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTD--SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +PE   +  KF N V+                    ++ C+ C+ ++  P Q  CG RFC+ C +      S KC +  C++  +K K+  D    +E+  + I C N+N  C+ ++ L  L  HL+  C    + C +  C  KIL K   DH    C  R  TC  C+  +P    +  H + + P  +      SCP+KCS               EK   + + +  +  N EE         SL+N   E+        +  +N      +LNR+    SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q    + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:   32 VPEQGGYKEKFVNAVE-------------------DKYKCEKCHLILCNPKQTECGHRFCETCMNALLSSSSPKCTA--CQESIVKDKVFKDNCCRRELLALQIYCRNENKGCKEQLSLGQLLMHLKTDCQFEELACPRADCKEKILRKDLPDHVEKTCKYRETTCKYCKSQVPMIMLQK-HEDTDCPCVMV-----SCPHKCSVKTLMRSERVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKTAGQGARNTSLLETQLNRHDQMLSVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 456          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A192YFZ6 (TNF receptor-associated factor OS=Anas platyrhynchos OX=8839 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.093e-49
Identity = 137/456 (30.04%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  123 IPENYKFYSKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS--------------DEKYHNIKRHLIEY-HNKEE--------NSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTD--SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +PE   +  KF N V+                    ++ C+ C+ ++  P Q  CG RFC+ C +      S KC +  C++  +K K+  D    +E+  + I C N+N  C+ ++ L  L  HL+  C    + C +  C  KIL K   DH    C  R  TC  C+  +P    +  H + + P  +      SCP+KCS               EK   + + +  +  N EE         SL+N   E+        +  +N      +LNR+    SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q    + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:   32 VPEQGGYKEKFVNAVE-------------------DKYKCEKCHLILCNPKQTECGHRFCETCMNALLSSSSPKCTA--CQEGIVKDKVFKDNCCRRELLALQIYCRNENKGCKEQLSLGQLLMHLKTDCQFEELACPRADCKEKILRKDLPDHVEKTCKYRETTCKYCKSQVPMIMLQK-HEDTDCPCVMV-----SCPHKCSVKTLMRSERVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKTAGQGARNTSLLETQLNRHDQMLSVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 456          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3Q2UB30 (TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF3 PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 9.305e-49
Identity = 136/456 (29.82%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  123 IPENYKFYSKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKI-PDRAIEKEMSKISISCINDN--CQVKMFLPNLHRHLQ-QCPESVINCKK--CFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCS--------------DEKYHNIKRHLIEY-HNKEE--------NSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTD--SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +PE   +  KF N V+                    ++ C+ C+ ++  P Q  CG RFC+ C +      S KC  + C++  +K K+  D    +E+  + I C N+N  C+ ++ L  L  HL+  C    + C +  C  KIL K   DH    C  R  TC  C+  +P    +  H + + P  +      SCP+KCS               EK   + + +  +  N EE         SL+N   E+        +  +N      +L+R+    SV  + +   +L+  + + + Y  V    +WKI  +    +++  G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  I +G+YD+LL WPF QK  + +++Q    + + + FKP   S S+++P GE+N+A+G P FV  +T+ +N  + KDD +FIK++V
Sbjct:   32 VPEQGGYKEKFVNAVE-------------------DKYKCEKCHFILCNPKQTECGHRFCETCMNALLSTPSPKC--TACQESIVKDKVFKDNCCRRELLALQIYCRNENKGCKEQLSLGQLLMHLKTDCQFEELPCPRADCKEKILRKDLPDHVEKTCKYRETTCKYCKSQVPMIMLQK-HEDTDCPCVMV-----SCPHKCSVKTLMRSERVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKTAGQGARNTSMLETQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGV---LIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIV 456          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 6.140e-38
Identity = 64/146 (43.84%), Postives = 96/146 (65.75%), Query Frame = 3
Query:  960 STFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
             T +WKI  +     ++ + + LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  + +G+YD+LL WPF QK  + +++Q    K + + FKP   S S++RP GE+N+A+G P FV  +T+ +N  + KDD +FIK+ V
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPTGEMNIASGCPLFV-AQTVLENGTYIKDDTIFIKVTV 148          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 141.739 bits (356), Expect = 1.987e-36
Identity = 61/145 (42.07%), Postives = 93/145 (64.14%), Query Frame = 3
Query:  960 STFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
              FVWKI  F+   + + +G+  ++ S  FY+ + GYKM L++Y  GDG G+G+HLS++  + +GKYD+LL WPFSQK  + +L+QN  + I + F+P   S S+QRP  E+N+A+G P F  L  L     + +DD +FIK +V
Sbjct:  382 GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 526          

HSP 2 Score: 63.929 bits (154), Expect = 1.571e-10
Identity = 52/197 (26.40%), Postives = 83/197 (42.13%), Query Frame = 3
Query:  213 TYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTK-CPSSDCRD----------IEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLH-RHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNK 767
            +  ++ ++ C+ C  ++  P Q  CG RFC  C   + QL S+   P   CR           + I +  PD A  +E+  +   C ND C     L     +H  +C    + C+ C + ILL  +  H    C  R++ C  C KV  +F+      +I+   E+C+ F    P +C D     I R     H+K
Sbjct:   33 SVSMEPKYQCQQCKGVLRKPFQAQCGHRFCVFC---FKQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKCEACQMMILLSDKDRHNERECEARTLNCKYC-KVTFSFK------DIKAHDEICQKF----PMQCKDCGKKKIPREKFAEHSK 215          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 140.198 bits (352), Expect = 3.330e-36
Identity = 116/466 (24.89%), Postives = 188/466 (40.34%), Query Frame = 3
Query:  219 KLKTRFFCKLCNSLMNVPVQMN-CGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIN--DNCQVKMFLPNLHRHLQQCPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYEN-----------------------------------------------IHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKE------------ENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNG-----NKDITECFKPTSESLSYQRPDG------EINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            K K RF C LC+  M  PVQ++ CG RFCD C   +      KCP  D   ++  +  PD  +E+++  + I CI+  + C+    +  L  H   C  +VI C  +C VK+  +   +H   +C  R V C  C        +EN                                               ++  I+N    C  F   CP +C      NI R  +  H KE            +   K+   ++            ++   C  + R    +  L  E   L           H G   +WK+  ++  ++++K   N    S PFYT   GYK+ +  +  G+G G+G+HLSIY+ +  G+YD+LL WPF+ K   SIL+Q+       + ITE F P     ++Q+P        E  L  G P+F+    + +  ++ +D+ +F+K  +
Sbjct:   11 KPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE-DQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAFENHQGICPQESVYCENKCGARMMRRLLAQHTMAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTP---NIAREDLATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRHLEETTKSHLTMMCSLVGRQRQEIIELRREMEELS--------VSHDG-VLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEI-RKRNYIRDNAIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 138.272 bits (347), Expect = 1.503e-35
Identity = 64/171 (37.43%), Postives = 105/171 (61.40%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +V L ++    ++  + ++S   + G  FVWKI  F+   + + +G+  ++ S  FYT + GYKM L+IY  GDG G+GTHLS++  + +G  D+LL WPF+QK  + +L+QN  + I + F+P   S S+QRP  ++N+A+G P F  L  L   + + +DD +FIK +V
Sbjct:  285 TVGLRDLSIVEMEGKMREMSAATYDG-VFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 454          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 138.272 bits (347), Expect = 3.174e-35
Identity = 67/167 (40.12%), Postives = 104/167 (62.28%), Query Frame = 3
Query:  897 NIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQ-NDDFTKDDILFIKLVV 1394
            +++ ++L+Q IS      + G TF+W+I   +  +K++ +GQ  S  S  FYT   G+K+ +++Y +GDG+GKGTH+S++  I KG YD LL+WPF QK    +++QN  + + + F+P   S S+QRP  E+N+A+G P F  L  L      + KDD LFIK VV
Sbjct:  349 DLQISSLQQSISAQQDVSYDG-TFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVV 514          

HSP 2 Score: 62.7734 bits (151), Expect = 3.575e-10
Identity = 42/151 (27.81%), Postives = 66/151 (43.71%), Query Frame = 3
Query:  228 TRFFCKLCNSLMNVPVQMNCGCRFCDKCC----DNYFQLRSTKC---PSSDCRD---IEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENI 647
              F C  CN+++N   Q  CG R+C  C      N   L  TKC   P S+      + +     D AI KE+ ++ + C+N  C  +  L +   H  QC  ++I C   C + +L KT   H    C N   TC +C   +   + +++
Sbjct:   25 VHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQSV 175          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 8.793e-38
Identity = 60/144 (41.67%), Postives = 95/144 (65.97%), Query Frame = 3
Query:  966 FVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
             VWKI  +    +++ SG+ LSL SQPFYT   GYKM  + Y  GDG+G+GTHLS++  + +G+YD+LL WPF ++  +S+L+Q    + +++ F P   S S++RPDG++N+A+G P FV    L +   +  DD +F+++VV
Sbjct:  270 LVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVAL-EGSSYLVDDTVFVRVVV 412          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 1.948e-36
Identity = 60/144 (41.67%), Postives = 95/144 (65.97%), Query Frame = 3
Query:  966 FVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
             VWKI  +    + + SG+ LSL SQPFYT   GY+M  + Y  GDG+G+GTHLS++  + +G+YD+LL WPF Q+  +++L+Q    + +++ FKP   S S++RP  ++N+A+G P FV    L ++  + +DD +FIK+VV
Sbjct:  327 LVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVAL-ESASYLQDDTIFIKVVV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 2.253e-16
Identity = 87/406 (21.43%), Postives = 157/406 (38.67%), Query Frame = 3
Query:  228 TRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKC----PSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVK----------------MFLP-------------NLHRHL-QQCPESVINCKKCFVKILLKTQFDHENVNCINRSV-TCAMC-QKVMPA--FQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYH-----------------NKEENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNT----DSVELLNIEKTNLKQLISKVSCYKH---------VGST--------------FVWKIEHFTDTVKKSKSGQNL--SLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQK 1193
             RF C  C  L+   VQ +CG RFC  C           C     +S+       Q  PD A+ +EM  + + C+++ C+ +                + +P              LHRH+ Q+C    + C  C  ++L   Q     ++C +R    C +C QK +P   +Q+      ++N  + C      C Y+   E  HN  ++ +E H                    +N     S  ++    +     + +E+    + R+      S    NI++    +L +K++  +H         +G T              F+WKI+H  + ++++ +G      + S  F+T   GY++ L++   G+      H+S Y  +G G YD+ L WP+  K
Sbjct:    1 ARFACGSCQGLLRDAVQTHCGHRFCKPCIARLITSVHRSCNDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRCVSEGCEWRGRLLEYDVAHVERCDWVLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAAC-AQLLPYRQLQKHQLHCRSRRTRECKLCGQKSIPEDKWQHHEERRCMKN-RDTCPYSPLGCLYRGHGESLHNHDKNSVEVHLAIVYDAFKKTFEQLIKGHADNIKHPPSARLVAAEAQLATMDRRVEEVAKRVERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE------HVSAYAMLGPGPYDATLAWPYQLK 398          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 67.0106 bits (162), Expect = 3.987e-12
Identity = 51/208 (24.52%), Postives = 93/208 (44.71%), Query Frame = 3
Query:  861 ELNRNTDSVELLNIEKTNL-KQLISKV--SCYKHVGSTFVWKIEHFTDTVKKSKSGQNLS----------LLSQPFYTKEIGYKMFLKIYSFGDG-------------IGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQ--NGNKDITECFKPTSESLSYQRPDGEINL-ATGNPRFVDLKTLYQNDDFTKDDILFIKLVVL 1397
            EL+  TD+ + L  E T L + L ++V  S  +     F W++E F+  +    +    S          + S  FYT   GY++ L++                    G+  HL++++ + +G YD  L WPF  + +IS+++Q    +  +TE      +  ++QRP    N    G   F+D+ TL+    + +DD L ++  V+
Sbjct:  357 ELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHR-SYLRDDCLVVRCEVV 563          

HSP 2 Score: 65.855 bits (159), Expect = 9.925e-12
Identity = 39/132 (29.55%), Postives = 63/132 (47.73%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRST--KCPSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMC 611
            L++++ C +C   +  PVQ  CG RFC  C  +  +LR    KCP  D   +   Q  PD   ++E+  +++ C N  C  +  L  L  H  +C  + + C +C + +  +    HE   C+ R VTC  C
Sbjct:   59 LESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPV-DNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHC 189          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 135.576 bits (340), Expect = 9.811e-35
Identity = 66/181 (36.46%), Postives = 112/181 (61.88%), Query Frame = 3
Query:  861 ELNRNTDSVEL-LNIEKTNLKQLISKVSCYKHVG--STFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +LNR    +E  + I KT L Q   ++   + +    TF+WKI+ FT+   ++KSG   S+ S PFYT   GYK+  +++  GDG  +  +LSI++A+ +G+YDS+L WPF +   I++++Q+   +I+E F P   S+S+QRP   IN+A+G PRF   +T+ +   +  ++ +F+K+VV
Sbjct:  344 KLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNISETFDPDPCSISFQRPTRNINVASGCPRFCS-QTVLRTRGYMNENCVFVKVVV 523          

HSP 2 Score: 55.4546 bits (132), Expect = 3.189e-8
Identity = 53/189 (28.04%), Postives = 77/189 (40.74%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIN--DNCQVKMFLPNLHRHLQQCP---ESVINCKKCFVKILLKTQF-DHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKE 770
            L+ R+ C  C   +N P+Q  CG RFC  C D         CP  D + I+      DR    EM  +   C    D CQ    +  +  H + C     S I+      +I+L+ Q   H    C  R +TC  CQ  +P          IE+ L+ C  F   CP +C  ++   I+R  +  H +E
Sbjct:    6 LEDRYICNACRMPLNHPMQAQCGHRFCKHCIDVILISPFPACP-RDGQTIQALSVFHDRCALVEMQALPCYCHGRCDGCQWTGPVAMITVHEEVCAFIKVSCIHASDGCGEIMLRFQLAKHVEKECPFRLITCVYCQNDVPERTL------IEH-LKKCPAFPIECPNECGVKR---IERKKLSAHTRE 183          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 135.576 bits (340), Expect = 1.026e-34
Identity = 64/178 (35.96%), Postives = 107/178 (60.11%), Query Frame = 3
Query:  867 NRNTDSVELLNIE--KTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +RN   + L +I+  + +LK  + + + Y     T++WKI+ +T   ++  SG+  S+ S PFY    GYK   ++Y  GDG+GKG+HLS++  + +G++D+LL WPF QK    +L+Q+   DI + F+P   S S++RP   +N+A+G P F+    L Q   + +DD +FIK+ V
Sbjct:  348 DRNEHQLALHDIQLAEHDLKLQMLEATSYD---GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNL-QTRAYVRDDTMFIKIAV 521          

HSP 2 Score: 48.521 bits (114), Expect = 5.033e-6
Identity = 40/159 (25.16%), Postives = 64/159 (40.25%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSD--------CRDIEIKQKI-------PDRAIEKEMSK--------------ISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMC 611
            L  ++ C +C + +  PVQ  CG RFC+ C +   +  S KCP            +D+  +++I       P+R +  E  K                + C N  CQ K+   +L  HL++C     +C+ C  +I   +  DH    C    V C  C
Sbjct:   15 LDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPS-KCPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQT-CEKHPVVCPHC 171          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 134.035 bits (336), Expect = 1.630e-34
Identity = 113/437 (25.86%), Postives = 198/437 (45.31%), Query Frame = 3
Query:  183 RRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQM-NCGCRFCDKCCDNYFQLRSTKCP--SSDCRDIEIKQKIPD--RAIEKEMSKISISCIND--NCQVKMFLPNLHRHLQQCPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEE----------------NSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVG-STFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFK--------PTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            R L+K+Y +     + +  C +C  +   PVQ+  CG R C  C    ++    KCP  S D  D     KIPD  +A E +M+++   CIN    C+V++    +  H  +C  S I C   C  K   + +  H + +C  + ++C  C          ++  N +  LE C      CP KC  +K   I R  ++ H ++E                +      +    K +              +  +  +  +     +T +KQ+ S+V   + +  S  +W+IE +T  +K++K+G   +L S  F T + GY++   +   GDG GKGTH+S+++++ KG +D+LL WPF  +    +LNQ+ N +  +  K        P +E     RP  E N + G  +F+  + + ++ +F KDD +F+K+ V
Sbjct:   36 RPLTKNYFKKPPFEERKHLCPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKCSGDLDD-----KIPDVDQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCDD-------RHLRENKKEHLEDCLLIPLPCPNKC--DKTLTIPRGQLDEHIEKECPRAKLMCEFESLGCQHRCSREKMAKHMKSEIIGHVKMIFGVVLEQKEKLDNHAQKFEEHETIMKQVDSRVGDLEKIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPF-LGRPRLEKNASFGGAKFIKHEEI-ESGNFIKDDTVFLKVSV 456          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 132.109 bits (331), Expect = 3.794e-34
Identity = 109/404 (26.98%), Postives = 185/404 (45.79%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMN-CGCRFCDKCCDNYFQLRSTK--CPSSDCRDIEIKQKIPDRAIEKEMSKISISCIN--DNCQVKMFLPNLHRHLQQCPESVINC--KKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKS-KSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLS-----YQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            L   + C +C      P+Q+  CG RFC  C     +L+ +   CP  D R I   +   D+A  + +  + + C N    C+    L N+  H + C    ++C   +C   +  ++   H    C  R V+C  C ++   + Y++   ++++    C+     C  KC  +   +I R  + +H  E        L +   + +         +  +E +        LNI    +++  S+  C       F+WKI ++     ++  S + L++ S PFYT + GYK+ LK Y  G   GKGTHLS+Y+ I KG YD+LL WPF QK    +++Q+  ++        + SL      + RP  + NL  GNP FV  + L ++ ++ KDD++FIK VV
Sbjct:   20 LPEEYECPICQLAFRDPIQIEECGHRFCQSCLQELRRLQGSPVLCPM-DRRPISSTKVFVDKAARRAILGLGVKCWNWKRKCEWTGELSNIEEHAKNCAHEDVHCTNPECNEVMPRRSLQYHLVSKCKWRIVSCHFCTEM---YTYKDGKTHMKS----CKRLPIECVNKCGAK---DIPREEMPFHMSE------CPLAVHPCMYRDIGCPFKGRRDALEEHCKNAVHTHLNIACQKIRENESRSLC---TNGIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVPNEVL-ESGEYVKDDVMFIKAVV 402          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 126.331 bits (316), Expect = 5.690e-32
Identity = 104/417 (24.94%), Postives = 187/417 (44.84%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMN-CGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIN--DNCQVKMFLPNLHRHLQQ-CPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENSL----------------KNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVG-STFVWKIEHFTDTVKKSKSGQ-NLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGN----KDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            L   F C +C   +  PVQ+  CG R C  C     + R  +CP  D   + + +  PD A  +++  + I C +  D C+ +  + +L +HL++ C  S + C K     + + + +     C  R V C  C K +  F   N+HL      + C +F  SCP  C  +   ++ +  +  H  +E  L                K   +    +           +  C +  + +   E L ++K +++  I  V C        F+WKI+ F+  +  +K+G+ +  ++S+ FYT   GYKM   ++  G G G+G ++S+ + +  G++DS+L WP   ++  ++L+Q+ +    +D+   F+P S S    RP  +  L  G  RFV L+       + KD+ +FIK  V
Sbjct:   12 LDKSFECPVCLMALRDPVQVTPCGHRVCQTCIKPIIRNRRPRCPL-DNLTLNVGKIFPDNACHRQILSMDILCPHHGDGCEWQGTISDLEKHLERGCNLSEVRCPKDCGASVERGKLEGHYPECSRRLVNCTHCNKEV-VFADMNVHL------QSCASFPISCPLTCGAK---DLTKEALAVHLNQECPLLVIPCRFAEAGCTFKAKRQKMAAHVQESLTSHVAMLCDLVCEQKLQISAQKERLLLQKEHIQLQI--VECRSRCANGEFIWKIQCFSRKLMDAKTGRASEPMISEAFYTSPHGYKMCAGVWLNGIGTGRGRYISVGLQVQSGEFDSILKWPLYPRYTFTLLDQSEDTKTKRDVVATFEPQSIS----RPSADRQLGKGARRFV-LQDEVCGTTYCKDNTIFIKFSV 410          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 177.178 bits (448), Expect = 6.157e-50
Identity = 119/416 (28.61%), Postives = 205/416 (49.28%), Query Frame = 3
Query:  225 KTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIE--IKQKI-PDRAIEKEMSKISISCIND--NCQVKMFLPNLHRHLQQCPESVINCK--KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNK----------------EENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTD--SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            + ++ C+ C  ++  P Q  CG RFC  C ++     +  CP+    D+E   K KI  D    +E+  + + C ++   CQ +M L  +  H+  CP   + C   KC  +++ K   +H    C  R  TC  C+  MP  + +     +      C  F  SCP  C+       ++ +  +  K                E  SL+ +   +  ++    +  +   ++  +LNR+ D  SV  + +   +L+  + + + Y     T +WKI  +    + + +G+ LSL SQPFYT   GYKM  ++Y  GDG+GKGTHLS++  + +G+YD+LL WPF QK  + +++Q    K + + FKP   S S++RP  E+N+A+G P FV  +++ ++  + KDD +FIK+ V
Sbjct:   43 EAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPA----DMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQKHKETV------CPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGGRASLET--QLNRHDDMLSVHEIRLADMDLRFQVLETASY---NGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVS-QSVLESGTYIKDDTIFIKVTV 442          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 142.51 bits (358), Expect = 9.809e-37
Identity = 65/171 (38.01%), Postives = 107/171 (62.57%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            S+ + +++ +  +Q++ ++  Y      FVWKI  F+   +++ SG+  ++ S  FY+ + GYKM L++Y  GDG G+GTHLS++  + + KYD+LL WPFSQK  + +L+QN  + I + F+P   S S+QRP  E+N+A+G P F  L  L     + +DD +FIK +V
Sbjct:  342 SLTVKDLQLSEAEQMVRELQ-YCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 511          

HSP 2 Score: 62.003 bits (149), Expect = 5.998e-10
Identity = 55/215 (25.58%), Postives = 89/215 (41.40%), Query Frame = 3
Query:  186 RLSKDYLQS---------TYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKC-PSSDCRDIEI----------KQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLH-RHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNK 767
            R+S D L S         +  ++ ++ C+ C  ++  PVQ  CG RFC  C   + QL S+   P   CR  EI           +  PD A  +E++ +   C+N  C     +     +H  +C    I C+ C   +L K +  H +  C  R++ C  C+     F +++I  +     E+C+ F    P +C D     I R     H K
Sbjct:    3 RISWDSLSSLPGIPLSVLSVPMEDKYKCQQCLQVLRKPVQAQCGHRFCVHC---FRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVT---FNFKDIKAHD----EICQKF----PLQCKDCGKKKIPREKFNDHAK 203          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 142.124 bits (357), Expect = 1.379e-36
Identity = 65/171 (38.01%), Postives = 107/171 (62.57%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            S+ + +++ +  +Q++ ++  Y      FVWKI  F+   +++ SG+  ++ S  FY+ + GYKM L++Y  GDG G+GTHLS++  + + KYD+LL WPFSQK  + +L+QN  + I + F+P   S S+QRP  E+N+A+G P F  L  L     + +DD +FIK +V
Sbjct:  349 SLTVKDLQLSEAEQMVRELQ-YCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 518          

HSP 2 Score: 62.003 bits (149), Expect = 5.854e-10
Identity = 55/215 (25.58%), Postives = 89/215 (41.40%), Query Frame = 3
Query:  186 RLSKDYLQS---------TYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKC-PSSDCRDIEI----------KQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLH-RHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNK 767
            R+S D L S         +  ++ ++ C+ C  ++  PVQ  CG RFC  C   + QL S+   P   CR  EI           +  PD A  +E++ +   C+N  C     +     +H  +C    I C+ C   +L K +  H +  C  R++ C  C+     F +++I  +     E+C+ F    P +C D     I R     H K
Sbjct:   10 RISWDSLSSLPGIPLSVLSVPMEDKYKCQQCLQVLRKPVQAQCGHRFCVHC---FRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVT---FNFKDIKAHD----EICQKF----PLQCKDCGKKKIPREKFNDHAK 210          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 137.887 bits (346), Expect = 6.824e-35
Identity = 63/171 (36.84%), Postives = 104/171 (60.82%), Query Frame = 3
Query:  882 SVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +V L ++    ++  +  +S   + G  F+WKI  FT   + + +G+  ++ S  FYT + GYKM L+IY  GDG G+GTHLS++  + +G  D+LL WPF+QK  + +L+QN  + I + F+P   S S+QRP  ++N+A+G P F  L  L   + + +D+ +FIK +V
Sbjct:  395 TVSLRDLSIVEMEGKMKDMSAATYDG-IFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIV 564          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 133.265 bits (334), Expect = 9.662e-34
Identity = 119/468 (25.43%), Postives = 199/468 (42.52%), Query Frame = 3
Query:  219 KLKTRFFCKLCNSLMNVPVQMN-CGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCIN-----------------------------DNCQVKMFLPNLHRHLQQ---------------------------CPESVINCK-KCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENS-------LKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNG-----NKDITECFKPTSESLSYQRPDG------EINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            K K RF C LC+  M  PVQ++ CG RFCD C   +      KCP  D   ++  +  PD  +E+++  + I CI+                             + C VK+   +L  HLQ                            CP+  + C+ KC  +++ +    H    C  R+  C  C K       E +   I+N    C  F   CP +C      NI R  +  H K+           K++  +         + +++  KS + +  N  S +   I    L++ + ++S   H G   +WK+  ++  ++++K   N    S PFYT   GYK+ +  +  G+G G+G+HLS+Y+ +  G+YD+LL WPFS K   SIL+Q+       + ITE F P     ++Q+P        E  L  G P+F+  + + +  ++ +D+ +FIK  +
Sbjct:   11 KPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE-DQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGK-------EFVFDTIQNHQFHCPRFPVQCPNQCGTP---NIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNLVSRQRQEI--LELRREMEELS-VSHDG-VLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEI-KKRNYIRDNCIFIKASI 462          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000047778.1 (SMESG000047778.1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 447/450 (99.33%), Postives = 447/450 (99.33%), Query Frame = 3
Query:   51 MECEISNFSQNIFPKTLICKKITNIPENYKFYSKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVVLG 1400
            MECEISNFSQNIFPKTLICKKITNIPENYKFYSKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHE VNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENSLKNSSLEIIEKIDKYYKKIK IEKSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKL VLG
Sbjct:    1 MECEISNFSQNIFPKTLICKKITNIPENYKFYSKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHETVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENSLKNSSLEIIEKIDKYYKKIKKIEKSCVELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLEVLG 450          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 205.682 bits (522), Expect = 1.086e-60
Identity = 138/449 (30.73%), Postives = 221/449 (49.22%), Query Frame = 3
Query:  147 SKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRD--IEIKQKI-PDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHL-------------IEYHNKE------ENSLKNSSLXXXXXXXXXX---------XXXXXXXXSCVELN-RNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQ-NGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +K  + V+L  N  L    L S+ K      C +C+SL+    Q  CGC+ C+ C + Y       CP+ +C +  + I + I  D A  KE+  + I+C    C     +  + +H++ C    + C  C  +IL K +  H +  C  R   C  C K M       +HLN     ELC  +   CP  C + K  N+K HL               YH +E       N LK  +L      D            +++     +  E N + T  +  L  E++N  ++I+K + +++   +F+WKI+     ++ ++  + LS+ S PFYT E GYK+ L++Y  GDG+GKGTHLS++ A+ KG+YD LL WPF QK  +S+L+Q N  K  ++ FKP  +S  +QRP  + N+A+G+P+F  +  L  N  + K+D ++IK+ V
Sbjct:    2 NKINSAVELLTNYSLDIPNLSSSLK------CIICSSLLKNAKQTKCGCKVCENCINEYLSKGPKDCPNKECLNELLSIDKDIYNDNATNKEILNLKIACPFKGCAQLETVFKISQHVKSCEYRDVTCDPCQKRILAKEKQKHIDGECEMRITKCEFCHKTMTIKYLNEMHLNTTKN-ELCSEYVGHCPNNCGETKELNLKLHLETCLNRKSDDQNDTNYHIQEFSNTQLSNLLKQIALLNQTSKDLLTKLENQDVIIREMSTKYIALTEDNIKLTKKINALEAERSNPVKIIAKTNDFRN--GSFIWKIKDLKSQIQNAERSERLSITSDPFYTSEFGYKLCLRVYPSGDGLGKGTHLSVFFALMKGEYDDLLPWPFRQKLTLSLLDQENFTKHYSDTFKPDPKSPCFQRPILDSNIASGSPKFYSISHLSFNSIYYKNDTIYIKITV 441          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 204.142 bits (518), Expect = 5.406e-60
Identity = 135/441 (30.61%), Postives = 227/441 (51.47%), Query Frame = 3
Query:  222 LKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSS--DCRDI--EIKQKI-PDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKC---------------SDEK----YHNI--------KRHLIEYHNKE---------------ENSLKNSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNIEK--TNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            L  R  C LC  ++    Q +CGC+ C+ C  +Y       CPS   DC ++   + + I  D A  KE++ + + C    C  +M L N+  H+  C    I+C KC  K+  K +  H+   C  R + C  C + M     ++IHLN +   + C  +T  CP  C               S +K    +H++        K +L+++ N+E               EN++KN + E+  +     + +   +KS + + +  +++E L  +   T ++ + +K   +++  +TF+WK   F      ++SG+ +S+ S PFYT E GYKM L+IY  GDG+GKGTHLS++ AI KG++D LL+WPF QK  +SI++Q  G K  ++ FKP + S  YQ+P  E N+A+G+P+F+ L  +  N  + K+D +++K+ V
Sbjct:   22 LSDRLKCVLCQRILKNAKQTSCGCKACENCIKSYLANGPKPCPSKQIDCENVMLHMDEDINADNATNKEIASLKVKCPFKLCSSEMPLRNMVEHINSCEFREISCNKCQSKLQAKDKESHDKNKCEMRKLKCEYCLEEMSFRDLKSIHLNSDRE-DFCVKYTAICPNNCDVHTKVCLKEHLKLCSKKKLECPFHSLNCNVDKMTKENLMKHLNEEYVSHTSNLISKIKDMENTIKNLTDELENQKVLTKELLDMNKKSSLSVLKTQETIEKLKTKSFPTPIQAVENKSVIFRN--ATFIWKFTDFESKRIDAESGRKVSVTSDPFYTSEFGYKMCLRIYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSIMDQEAGTKHHSDTFKPDARSACYQKPVDECNIASGSPKFILLSLIMNNSLYCKNDTIYLKIAV 459          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 179.874 bits (455), Expect = 3.921e-51
Identity = 131/449 (29.18%), Postives = 211/449 (46.99%), Query Frame = 3
Query:  147 SKFENLVDLADNRRLSKDYLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRD--IEIKQKI-PDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPYKCSDEKYHNIKRHL-------------IEYHNKE------ENSLKNSSLXXXXXXXXXX---------XXXXXXXXSCVELN-RNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQ-NGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVV 1394
            +K  + V+L  N  L    L S+ K      C +C+SL+    Q  CGC+ C+ C + Y       CP+ +C +  + I + I  D A  KE+  + I+C    C     +  + +H++ C    + C  C  +IL K +  H +  C  R   C  C K M       +HLN     ELC  +   CP  C + K  N+K HL               YH +E       N LK  +L      D            +++     +  E N + T  +  L  E++N  ++I+K + +++   +F+WKI+     ++ ++  + LS+ S PFYT               DG+GKGTHLS++ A+ KG+YD LL WPF QK  +S+L+Q N  K  ++ FKP  +S  +QRP  + N+A+G+P+F  +  L  N  + K+D ++IK+ V
Sbjct:    2 NKINSAVELLTNYSLDIPNLSSSLK------CIICSSLLKNAKQTKCGCKVCENCINEYLSKGPKDCPNKECLNELLSIDKDIYNDNATNKEILNLKIACPFKGCAQLETVFKISQHVKSCEYRDVTCDPCQKRILAKEKQKHIDGECEMRITKCEFCHKTMTIKYLNEMHLNTTKN-ELCSEYVGHCPNNCGETKELNLKLHLETCLNRKSDDQNDTNYHIQEFSNTQLSNLLKQIALLNQTSKDLLTKLENQDVIIREMSTKYIALTEDNIKLTKKINALEAERSNPVKIIAKTNDFRN--GSFIWKIKDLKSQIQNAERSERLSITSDPFYT--------------SDGLGKGTHLSVFFALMKGEYDDLLPWPFRQKLTLSLLDQENFTKHYSDTFKPDPKSPCFQRPILDSNIASGSPKFYSISHLSFNSIYYKNDTIYIKITV 427          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000018404.1 (SMESG000018404.1)

HSP 1 Score: 159.844 bits (403), Expect = 1.284e-43
Identity = 131/430 (30.47%), Postives = 190/430 (44.19%), Query Frame = 3
Query:  255 SLMNV---PVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYE----NIHLNIEN-----------------------PLELCENFTRSCPYK---CSDEKYHN-IKRHL--------------IEYHNKEENSLK------NSSLXXXXXXXXXXXXXXXXXXSCVELNRNTDSVELLNI--EKTNLKQLISKVSCYKH-----VGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISIL-NQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDF 1358
            +L NV   P+Q  CGCRFC  C +NY    ++ CP+ D  +I   + I D+A+EKE+    I C N+ C     L  L  H + C   +  C  C      K +  H N  C  R VTC  CQ+ M +  +E    NI + I+N                        L+ C N   +CP+    C+     N I +HL              I     E N+LK      N SL    ++ K   K        ++     +   +LNI  E    KQLI+  S         V    VW IE+    +  +KSG  + ++S+PFY+   GY+M LKIY  GDG GK  +LS+Y  I +G+YD  + WPF QK  +SIL +++  ++IT   KP +    Y +P    N+  G P F+ L  L  + D+
Sbjct:    3 TLQNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDL-EINRNKFIRDKAVEKEIFNHQIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDECQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQVNCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHYAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGTGKDKYLSVYFMIVQGEYDDEIAWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDY 431          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF31.598e-4628.80TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.191e-3639.53TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.191e-3639.53TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.392e-3639.53TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.392e-3639.53TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.745e-2926.27TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-29.308e-1429.75TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf46.317e-3027.22gene:FBgn0026319 transcript:FBtr0334401[more]
Traf49.338e-3027.22gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like6.707e-828.42gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like6.707e-828.42gene:FBgn0030748 transcript:FBtr0074274[more]
Traf-like6.707e-828.42gene:FBgn0030748 transcript:FBtr0334036[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf39.853e-3839.23TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf4a1.008e-3625.54tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a1.008e-3625.54tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf2b1.050e-3642.07Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.050e-3642.07Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF21.928e-3926.58TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh29.402e-3738.46slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh21.223e-3638.46slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF24.123e-3626.75TNF receptor associated factor 2 [Source:NCBI gene... [more]
sytl24.873e-3624.15synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf51.369e-3842.01TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf51.369e-3842.01TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf51.655e-3742.01TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf51.655e-3742.01TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf39.185e-3739.53TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70191|TRAF5_MOUSE1.941e-3642.01TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN6.687e-3639.53TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE6.817e-3639.53TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|P39429|TRAF2_MOUSE1.785e-3536.26TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|O00463|TRAF5_HUMAN1.802e-3541.18TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG603.026e-5830.22TNF receptor-associated factor-2-like protein B OS... [more]
T1DBK66.845e-5529.55TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A493U4B71.649e-4930.04TNF receptor-associated factor OS=Anas platyrhynch... [more]
A0A192YFZ62.093e-4930.04TNF receptor-associated factor OS=Anas platyrhynch... [more]
A0A3Q2UB309.305e-4929.82TNF receptor-associated factor OS=Gallus gallus OX... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035169.16.140e-3843.84pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2b1.987e-3642.07TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf4a3.330e-3624.89TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2a1.503e-3537.43TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf13.174e-3540.12TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002130.18.793e-3841.67pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.11.948e-3641.67pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000008091.12.253e-1621.43pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
traf63.987e-1224.52TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352379.811e-3536.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494641.026e-3435.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328491.630e-3425.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495453.794e-3426.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459155.690e-3224.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf36.157e-5028.61TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf2b9.809e-3738.01TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.379e-3638.01TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.26.824e-3536.84TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf4a9.662e-3425.43TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047778.10.000e+099.33SMESG000047778.1[more]
SMESG000027123.11.086e-6030.73SMESG000027123.1[more]
SMESG000027153.15.406e-6030.61SMESG000027153.1[more]
SMESG000027123.13.921e-5129.18SMESG000027123.1[more]
SMESG000018404.11.284e-4330.47SMESG000018404.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022383 ID=SMED30022383|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1433bp
ATTTAAATTTAGTTTTTATTTCGTCTTAAAATTATTTTCTTCTGAGCATT
ATGGAGTGCGAAATATCAAATTTTAGTCAAAATATATTTCCGAAAACATT
AATTTGTAAAAAGATTACAAATATCCCTGAAAACTACAAATTTTACAGTA
AATTTGAAAATCTTGTAGATTTAGCAGACAACAGACGGCTATCCAAAGAC
TATTTGCAATCAACTTATAAATTGAAGACCAGATTTTTTTGTAAACTATG
TAACAGTCTCATGAATGTACCGGTTCAAATGAATTGTGGCTGCCGATTCT
GTGATAAATGCTGTGATAATTATTTCCAACTGAGATCAACGAAATGCCCA
TCAAGTGATTGTAGGGACATTGAGATAAAACAAAAAATCCCAGATCGTGC
AATTGAAAAAGAAATGTCGAAAATTTCAATTTCCTGTATCAACGATAATT
GTCAGGTGAAAATGTTCCTGCCGAATTTGCATCGCCACCTTCAGCAATGT
CCCGAATCTGTGATCAACTGTAAAAAATGTTTTGTCAAAATTTTGTTGAA
AACTCAATTCGACCATGAAAACGTCAATTGCATCAATAGAAGCGTTACTT
GTGCAATGTGTCAGAAGGTTATGCCGGCTTTTCAATATGAAAACATTCAT
TTGAATATAGAAAATCCATTAGAACTTTGTGAAAACTTTACCAGAAGCTG
TCCATATAAATGTTCTGATGAGAAATATCACAACATCAAACGGCATCTGA
TTGAATATCACAACAAAGAGGAAAATTCTCTAAAAAATTCATCCTTAGAA
ATCATTGAAAAAATTGATAAATATTATAAAAAAATTAAAAACATTGAAAA
GTCATGCGTTGAGCTGAATAGGAATACTGATTCTGTAGAATTGTTAAACA
TAGAAAAAACAAATTTAAAACAACTCATATCAAAAGTTTCTTGTTATAAA
CACGTTGGCTCGACTTTCGTTTGGAAAATTGAACATTTTACCGATACAGT
AAAAAAATCAAAATCCGGACAAAATCTTTCACTTTTAAGCCAGCCATTTT
ATACAAAAGAAATTGGCTATAAAATGTTTTTAAAAATCTATTCATTCGGT
GACGGAATCGGCAAAGGGACTCATTTGTCAATTTATATGGCCATTGGAAA
GGGAAAATATGATTCACTTTTAACCTGGCCATTTTCACAGAAATTTAAAA
TCTCCATTCTAAATCAAAATGGCAACAAAGATATAACAGAATGCTTCAAA
CCGACTTCCGAATCCCTAAGTTATCAAAGACCAGATGGTGAAATCAACCT
TGCTACGGGTAATCCTCGCTTCGTGGACTTAAAAACTCTATATCAAAACG
ATGACTTTACAAAAGATGATATTTTGTTTATAAAATTGGTGGTATTGGGA
TAAATATAAACTCCTATTAAACTCATTAAAACA
back to top

protein sequence of SMED30022383-orf-1

>SMED30022383-orf-1 ID=SMED30022383-orf-1|Name=SMED30022383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=451bp
MECEISNFSQNIFPKTLICKKITNIPENYKFYSKFENLVDLADNRRLSKD
YLQSTYKLKTRFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCP
SSDCRDIEIKQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQC
PESVINCKKCFVKILLKTQFDHENVNCINRSVTCAMCQKVMPAFQYENIH
LNIENPLELCENFTRSCPYKCSDEKYHNIKRHLIEYHNKEENSLKNSSLE
IIEKIDKYYKKIKNIEKSCVELNRNTDSVELLNIEKTNLKQLISKVSCYK
HVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFG
DGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFK
PTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLVVLG
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0001878response to yeast
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012227TNF_rcpt-assoc_TRAF_met
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR001293Znf_TRAF
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 255..275
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 57..448
NoneNo IPR availableCDDcd16449RING-HCcoord: 64..100
e-value: 2.01479E-4
score: 36.6765
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 53..118
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 308..430
e-value: 7.1E-5
score: 32.2
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 303..448
score: 20.084
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 245..449
e-value: 3.4E-49
score: 169.1
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 125..256
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 303..448
IPR012227TNF receptor-associated factor TRAF, metazoaPIRSFPIRSF015614TRAFcoord: 224..449
e-value: 7.7E-55
score: 184.1
coord: 40..246
e-value: 3.8E-21
score: 73.0
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 42..162
e-value: 3.8E-13
score: 51.5
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 57..448
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 64..100
score: 8.727
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 146..187
score: 9.529