RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30022375
Length (bp)2496
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30022375) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30022375) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30022375) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30022375) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022375

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30022375SMESG000071670.1 SmedASXL_015084SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30022375SMESG000071670.1 dd_Smed_v4_3282_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022375SMESG000071670.1 dd_Smed_v4_3282_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30022375SMESG000071670.1 dd_Smed_v4_3282_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30022375SMESG000071670.1 dd_Smed_v4_3282_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022375SMESG000071670.1 Contig54135uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022375SMESG000071670.1 Contig54135newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: EIF4B (eukaryotic translation initiation factor 4B [Source:HGNC Symbol;Acc:HGNC:3285])

HSP 1 Score: 51.9878 bits (123), Expect = 4.961e-6
Identity = 43/137 (31.39%), Postives = 70/137 (51.09%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPD---APTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    ST   W   + D   AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E +I+ FF+  ++  V         E+ +G G  EF+D +SL  AL L E+   +R IR+ +
Sbjct:   40 WADETDDLEGDVST--TWHSNDDDVYRAPPID----RSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDV 170          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: EIF4B (eukaryotic translation initiation factor 4B [Source:HGNC Symbol;Acc:HGNC:3285])

HSP 1 Score: 51.6026 bits (122), Expect = 5.199e-6
Identity = 43/137 (31.39%), Postives = 70/137 (51.09%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPD---APTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    ST   W   + D   AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E +I+ FF+  ++  V         E+ +G G  EF+D +SL  AL L E+   +R IR+ +
Sbjct:   40 WADETDDLEGDVST--TWHSNDDDVYRAPPID----RSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDV 170          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: eIF4B (gene:FBgn0020660 transcript:FBtr0113681)

HSP 1 Score: 68.5514 bits (166), Expect = 7.278e-12
Identity = 78/298 (26.17%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  176 LPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKN--ERSNWREKPMIRNEDKPVTPSENTGNWRRAPAANVKSGNFTRQSQPIMHESAKPPTVI---------------ERP----EPR------------ENDNVKEMK--------KVSIFGDAKPVDTQAKFMEVEQKIEQSKKQ 928
            LPT   A R I D  +IP   PF+   +N+PFDA+E+ +  FF+  +++++       ++ + RG G +E ++R  L   L L +     R IR+ +  + D    Q         +       +  + DS NWR       SQ    NF   +  ERS  RE+  + + D   TP    G+WR +        + TR+    + E  +   V                ERP    +PR            E  +V E           +++FG AKPVDT A+ +E+EQ++  ++KQ
Sbjct:   59 LPTAPRANR-IFDDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQ------KSNRRFDGFGNNGDNRDSGNWRRD-----SQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTP----GSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKIADRYSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAARELEIEQRLALARKQ 340          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: eIF4B (gene:FBgn0020660 transcript:FBtr0113679)

HSP 1 Score: 68.5514 bits (166), Expect = 7.703e-12
Identity = 78/298 (26.17%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  176 LPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKN--ERSNWREKPMIRNEDKPVTPSENTGNWRRAPAANVKSGNFTRQSQPIMHESAKPPTVI---------------ERP----EPR------------ENDNVKEMK--------KVSIFGDAKPVDTQAKFMEVEQKIEQSKKQ 928
            LPT   A R I D  +IP   PF+   +N+PFDA+E+ +  FF+  +++++       ++ + RG G +E ++R  L   L L +     R IR+ +  + D    Q         +       +  + DS NWR       SQ    NF   +  ERS  RE+  + + D   TP    G+WR +        + TR+    + E  +   V                ERP    +PR            E  +V E           +++FG AKPVDT A+ +E+EQ++  ++KQ
Sbjct:   59 LPTAPRANR-IFDDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQ------KSNRRFDGFGNNGDNRDSGNWRRD-----SQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTP----GSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKIADRYSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAARELEIEQRLALARKQ 340          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: eIF4B (gene:FBgn0020660 transcript:FBtr0334940)

HSP 1 Score: 68.5514 bits (166), Expect = 8.558e-12
Identity = 78/298 (26.17%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  176 LPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKN--ERSNWREKPMIRNEDKPVTPSENTGNWRRAPAANVKSGNFTRQSQPIMHESAKPPTVI---------------ERP----EPR------------ENDNVKEMK--------KVSIFGDAKPVDTQAKFMEVEQKIEQSKKQ 928
            LPT   A R I D  +IP   PF+   +N+PFDA+E+ +  FF+  +++++       ++ + RG G +E ++R  L   L L +     R IR+ +  + D    Q         +       +  + DS NWR       SQ    NF   +  ERS  RE+  + + D   TP    G+WR +        + TR+    + E  +   V                ERP    +PR            E  +V E           +++FG AKPVDT A+ +E+EQ++  ++KQ
Sbjct:   59 LPTAPRANR-IFDDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQ------KSNRRFDGFGNNGDNRDSGNWRRD-----SQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTP----GSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKIADRYSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAARELEIEQRLALARKQ 340          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: eIF4B (gene:FBgn0020660 transcript:FBtr0113680)

HSP 1 Score: 68.5514 bits (166), Expect = 9.954e-12
Identity = 78/298 (26.17%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  176 LPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVV------KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKN--ERSNWREKPMIRNEDKPVTPSENTGNWRRAPAANVKSGNFTRQSQPIMHESAKPPTVI---------------ERP----EPR------------ENDNVKEMK--------KVSIFGDAKPVDTQAKFMEVEQKIEQSKKQ 928
            LPT   A R I D  +IP   PF+   +N+PFDA+E+ +  FF+  +++++       ++ + RG G +E ++R  L   L L +     R IR+ +  + D    Q         +       +  + DS NWR       SQ    NF   +  ERS  RE+  + + D   TP    G+WR +        + TR+    + E  +   V                ERP    +PR            E  +V E           +++FG AKPVDT A+ +E+EQ++  ++KQ
Sbjct:   59 LPTAPRANR-IFDDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQ------KSNRRFDGFGNNGDNRDSGNWRRD-----SQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTP----GSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKIADRYSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAARELEIEQRLALARKQ 340          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: eif4bb (eukaryotic translation initiation factor 4Bb [Source:ZFIN;Acc:ZDB-GENE-030131-8563])

HSP 1 Score: 65.855 bits (159), Expect = 1.259e-10
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVV------KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGV 487
            W + T++L    ST  +  ++   AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E +IR FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I  + +     SG+
Sbjct:   41 WADETDDLEGDVSTSWHTVEDTYRAPPID----RSILPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVSEESIRDFFRGLAISAVRLPREPNNPERLKGFGYAEFDDIESLLRALSLNEENLGNRRIRVDIADQSNDKERDSGM 183          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: eif4bb (eukaryotic translation initiation factor 4Bb [Source:ZFIN;Acc:ZDB-GENE-030131-8563])

HSP 1 Score: 65.855 bits (159), Expect = 1.357e-10
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVV------KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGV 487
            W + T++L    ST  +  ++   AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E +IR FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I  + +     SG+
Sbjct:   41 WADETDDLEGDVSTSWHTVEDTYRAPPID----RSILPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVSEESIRDFFRGLAISAVRLPREPNNPERLKGFGYAEFDDIESLLRALSLNEENLGNRRIRVDIADQSNDKERDSGM 183          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: eif4bb (eukaryotic translation initiation factor 4Bb [Source:ZFIN;Acc:ZDB-GENE-030131-8563])

HSP 1 Score: 65.855 bits (159), Expect = 1.372e-10
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVV------KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGV 487
            W + T++L    ST  +  ++   AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E +IR FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I  + +     SG+
Sbjct:   43 WADETDDLEGDVSTSWHTVEDTYRAPPID----RSILPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVSEESIRDFFRGLAISAVRLPREPNNPERLKGFGYAEFDDIESLLRALSLNEENLGNRRIRVDIADQSNDKERDSGM 185          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: eif4bb (eukaryotic translation initiation factor 4Bb [Source:ZFIN;Acc:ZDB-GENE-030131-8563])

HSP 1 Score: 65.855 bits (159), Expect = 1.463e-10
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVV------KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGV 487
            W + T++L    ST  +  ++   AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E +IR FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I  + +     SG+
Sbjct:   43 WADETDDLEGDVSTSWHTVEDTYRAPPID----RSILPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVSEESIRDFFRGLAISAVRLPREPNNPERLKGFGYAEFDDIESLLRALSLNEENLGNRRIRVDIADQSNDKERDSGM 185          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: eif4ba (eukaryotic translation initiation factor 4Ba [Source:ZFIN;Acc:ZDB-GENE-060629-1])

HSP 1 Score: 65.0846 bits (157), Expect = 2.372e-10
Identity = 42/134 (31.34%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    +T  +   E   AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E++I++FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I
Sbjct:   41 WADETDDLEGDVTTSWHTEDEVYRAPPID----RSILPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVTEDSIKNFFRGLSISAVRLPREPSNPERLKGFGYAEFDDVESLLQALSLNEENLGNRRIRVDI 170          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: eif4b (eukaryotic translation initiation factor 4B [Source:NCBI gene;Acc:448618])

HSP 1 Score: 65.4698 bits (158), Expect = 2.723e-10
Identity = 45/137 (32.85%), Postives = 69/137 (50.36%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDA---PTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    ST   W   + DA   P +D    RS+LPT   A R+ + D   +P++ PF     N+P+D  E +I+ FF+  ++  V         E+ +G G  EF D +SL  AL L E+   +R IR+ I
Sbjct:   56 WADETDDLEGDVST--TWHSNDDDAYRAPPID----RSILPTAPRAAREPNVDRSRLPKSPPFTAFLGNLPYDVTEESIQKFFRGLNISAVRLPREPSNPERLKGFGYAEFDDLDSLLRALSLNEESLGNRRIRVDI 186          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: eif4b (eukaryotic translation initiation factor 4B [Source:NCBI gene;Acc:448618])

HSP 1 Score: 65.4698 bits (158), Expect = 2.764e-10
Identity = 45/137 (32.85%), Postives = 69/137 (50.36%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDA---PTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    ST   W   + DA   P +D    RS+LPT   A R+ + D   +P++ PF     N+P+D  E +I+ FF+  ++  V         E+ +G G  EF D +SL  AL L E+   +R IR+ I
Sbjct:   54 WADETDDLEGDVST--TWHSNDDDAYRAPPID----RSILPTAPRAAREPNVDRSRLPKSPPFTAFLGNLPYDVTEESIQKFFRGLNISAVRLPREPSNPERLKGFGYAEFDDLDSLLRALSLNEESLGNRRIRVDI 184          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: eif4b (eukaryotic translation initiation factor 4B [Source:NCBI gene;Acc:448618])

HSP 1 Score: 65.4698 bits (158), Expect = 2.840e-10
Identity = 45/137 (32.85%), Postives = 69/137 (50.36%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDA---PTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    ST   W   + DA   P +D    RS+LPT   A R+ + D   +P++ PF     N+P+D  E +I+ FF+  ++  V         E+ +G G  EF D +SL  AL L E+   +R IR+ I
Sbjct:   49 WADETDDLEGDVST--TWHSNDDDAYRAPPID----RSILPTAPRAAREPNVDRSRLPKSPPFTAFLGNLPYDVTEESIQKFFRGLNISAVRLPREPSNPERLKGFGYAEFDDLDSLLRALSLNEESLGNRRIRVDI 179          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: eif4b (eukaryotic translation initiation factor 4B [Source:NCBI gene;Acc:448618])

HSP 1 Score: 64.6994 bits (156), Expect = 4.139e-10
Identity = 45/137 (32.85%), Postives = 69/137 (50.36%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDA---PTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    ST   W   + DA   P +D    RS+LPT   A R+ + D   +P++ PF     N+P+D  E +I+ FF+  ++  V         E+ +G G  EF D +SL  AL L E+   +R IR+ I
Sbjct:   57 WADETDDLEGDVST--TWHSNDDDAYRAPPID----RSILPTAPRAAREPNVDRSRLPKSPPFTAFLGNLPYDVTEESIQKFFRGLNISAVRLPREPSNPERLKGFGYAEFDDLDSLLRALSLNEESLGNRRIRVDI 187          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: eif4b (eukaryotic translation initiation factor 4B [Source:NCBI gene;Acc:448618])

HSP 1 Score: 64.6994 bits (156), Expect = 4.164e-10
Identity = 45/137 (32.85%), Postives = 69/137 (50.36%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPDA---PTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    ST   W   + DA   P +D    RS+LPT   A R+ + D   +P++ PF     N+P+D  E +I+ FF+  ++  V         E+ +G G  EF D +SL  AL L E+   +R IR+ I
Sbjct:   57 WADETDDLEGDVST--TWHSNDDDAYRAPPID----RSILPTAPRAAREPNVDRSRLPKSPPFTAFLGNLPYDVTEESIQKFFRGLNISAVRLPREPSNPERLKGFGYAEFDDLDSLLRALSLNEESLGNRRIRVDI 187          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Eif4b (eukaryotic translation initiation factor 4B [Source:MGI Symbol;Acc:MGI:95304])

HSP 1 Score: 51.2174 bits (121), Expect = 5.846e-6
Identity = 42/137 (30.66%), Postives = 71/137 (51.82%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPD---APTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    ST   W   + D   AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E++I+ FF+  ++  V         ++ +G G  EF+D +SL  AL L E+   +R IR+ +
Sbjct:   40 WADETDDLEGDVST--TWHSNDDDVYRAPPID----RSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEDSIKDFFRGLNISAVRLPREPSNPDRLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDV 170          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|O14369|SCE3_SCHPO (Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sce3 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.664e-7
Identity = 29/88 (32.95%), Postives = 49/88 (55.68%), Query Frame = 2
Query:  224 IPQNGPFLLNFSNIPFDADENAIRHFF-QAFDVVNVV---KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGY-KEDFAR 472
            IP   PF  +  N+ FD  EN +  FF +    + +V    +E+ RG G +EF+  ++L+ AL L+ +  + RP+R+T+   +  FAR
Sbjct:   88 IPSEPPFTAHVGNLSFDLTENDLGDFFGEGVTSIRLVIDPLTERSRGFGYVEFETADTLSAALALSGEDLMGRPVRITVAEPRRSFAR 175          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A4V6K4 (Probable RNA-binding protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 3.048e-57
Identity = 128/212 (60.38%), Postives = 156/212 (73.58%), Query Frame = 2
Query:  332 KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSNWRE-KP-MIRNEDKPVTPSENTGNWRRAPAAN-VKSGNFTRQSQPIMHE-SAKPPTVIERPEPRENDNVKEMKKVSIFGDAKPVDTQAKFMEVEQKIEQSKKQTTDEPHKTE 955
            KSE KRGTGIIEFKD  +L+GAL +AEK FISRPIRL+IG KED  RI+SG  QR R+ NQQRNP  T+SEDSDNWRTKKPQPVSQ   DN+ P+N+R NWR+ KP  IR +D     SEN+ NWR+  + +  KSGNF R+++ +    S KP +  ER EP+  D +KE KKVSIFGDAKPVDTQ+K +E+E+KI Q KKQ  DE  KT+
Sbjct:    8 KSEIKRGTGIIEFKDLINLSGALSMAEKIFISRPIRLSIGLKEDLFRIKSGGQQRTRFGNQQRNPQPTISEDSDNWRTKKPQPVSQPSPDNYPPRNDRPNWRDNKPSTIRTDDNNKALSENSENWRKGTSRDTTKSGNFNRRNETMQDSGSTKPMSYAERSEPK--DLIKETKKVSIFGDAKPVDTQSKDLEIEEKIAQQKKQ-VDETSKTD 216          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: D6X4V5 (RRM domain-containing protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC011031 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.475e-15
Identity = 89/307 (28.99%), Postives = 139/307 (45.28%), Query Frame = 2
Query:  116 NWSQEEPDAPTMDVSEIRS-----VLPTKTSATRQISDL-ENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDV--VNVVKSEQ------KRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSN----WRE--------------KPMIRNE-DKPVTPSENTGNWRRAPAANV--KSGNFTRQSQPIMHESA------KPPTVIE-RPEPRENDNVKEMKKVSIFGDAKPVDTQAKFMEVEQKI 910
            NW+ E  D    DV + RS     VLPT   A+R   D+ + +PQ  PF+   +N+P+D DE+ I  FF+   +  + + K E+       +G G +EF+DR SL  AL + +    +R IR+ +    D  + + G     R +  +    S +S   D WR+   Q  S      F    ER +    WRE                  R E D+  + S +   + R    +   ++G FTR   P   E A      +P  V+  R +P EN+  K +   SIFG+AKPVDT A+  ++E+++
Sbjct:   39 NWADEVED--NHDVYDPRSAKASVVLPTAPKASRDFDDIIDKVPQEPPFIAYLTNLPYDVDESEIAAFFKNMKISHMRIPKDERPGEAPRLKGFGYVEFEDRESLLNALVIPDTTIKNRRIRIDVATDYDNDKRRGGRMDMNRDRGGR----SDMSSFGD-WRSGPRQENSDMERRGFSRDRERDDSSGAWREGRSNREPPERSFNRSDRFREERDQDFSRSRDDKTFMRRDYGDRGGRNGGFTRGPPPSREEEAPSEPRQRPKLVLTPRTKPVENEPEKAVSHASIFGNAKPVDTSARERQIEERL 338          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A170WL91 (Eukaryotic translation initiation factor 4b-like protein isoform x5 (Fragment) OS=Triatoma infestans OX=30076 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.803e-12
Identity = 48/121 (39.67%), Postives = 63/121 (52.07%), Query Frame = 2
Query:  113 SNWSQE--EPDAPTMDVSEIRSVLPTKTSATRQISDLEN-IPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
             NW+ E  E DA + ++   R VLPT   A+R  +  EN IP   PF    SNIP+D  EN + +FFQ   V NV          + +G G IEF+DR SL  AL L +     RPIR+ +
Sbjct:   17 GNWADEVDEEDANSYELKTERVVLPTAPRASRGTTIDENKIPSTAPFQAYLSNIPYDLTENELINFFQNLKVKNVRIPRDEKGGNRAKGFGYIEFEDRASLVAALNLGDNTLKGRPIRIEL 137          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A1W5B578 (eukaryotic translation initiation factor 4B OS=Ciona intestinalis OX=7719 GN=LOC100183462 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.990e-11
Identity = 79/274 (28.83%), Postives = 123/274 (44.89%), Query Frame = 2
Query:  176 LPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQK---RGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSD----NWRTKKPQPVSQAPADNFQPKNERSNWREKPMIRNEDKPVTPSENTGNWRRAPAANVKSGNFTR--QSQPIMHESAKPPTVIERP----EPRE---NDNVKEMKKVSIFGDAKPVDTQAKFMEVEQK-IEQSKKQTTDEP 943
            LPT   ++R +  D   IP +GP+     N+P+DADE  ++ FF+   + NV   E+    RG G ++F D+ SL  AL + ++    R IR+ I   ++      G                +LS D D    NWR      ++  P  N   + E S W  +   +N+       +  G  R     +    +F+R  +S+  M +  +PP   ERP    +PRE   N      +  SIFG AKPVDT A+   VE+K ++Q +    D+P
Sbjct:   73 LPTAPRSSRSVEIDTSRIPDSGPYTAYVGNLPYDADEFVLQEFFKDIPMTNVRLQEENGRFRGYGYVQFPDKQSLIQALQMNDETLQKRVIRVDIADNQNKEGKGRGDR------------YGSLSGDPDRLEGNWRRTSNDHLNGGPGSN---RGEDSRWGGRGYEQNDRGSRFGRDRYGGGRDGRYES----SFSRGGESEQWM-QRREPPK--ERPRLNLKPREKPLNPEAATTRSSSIFGSAKPVDTAARERMVEEKLLKQEQSLAADKP 324          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: H2Y944 (RRM domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.290e-11
Identity = 86/281 (30.60%), Postives = 123/281 (43.77%), Query Frame = 2
Query:  176 LPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQK---RGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSED--SDNWRTKKPQPVSQAPADNFQPKNERSNWREKPMIRNEDKPVTPSENTGN-WRRAPAANVKSGNFTRQS--------------QPIMHESAKP--PTVIERP----EPRE---NDNVKEMKKVSIFGDAKPVDTQAKFMEVEQKIEQSKKQ 928
            LPT   ++R I  D + IP+ GPF     N+P+D D+  ++ FF+   ++NV   E+    +G G ++F DR SL  AL + E+ F  R IR+ I    D    + G   R           ST  ED    NWR          P++N  P N     R     RN+D         GN W R+   N +  N  R                +P  +ES++   PT  ERP    +PRE   +      +  SIFG AKPVDT A+   VE+K+   +K+
Sbjct:   69 LPTAPRSSRSIDIDTDRIPETGPFTAFVGNLPYDVDQFVLQQFFKDIPILNVRLPEENGRFKGFGYVQFNDRQSLIQALQMNEETFQKRIIRVDIA---DNNNREGGRSDRY---------GSTGGEDRTQGNWRK---------PSNNPPPSNTGQYSRSGGSYRNDD--------GGNKWGRSYDQNSRGYNDQRSGFSSSRENRYESSYDRPRQYESSRSNEPTR-ERPKLNLKPREKPLDTAAATTRSSSIFGAAKPVDTAARERMVEEKLLSHEKE 319          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: eif4bb (eukaryotic translation initiation factor 4Bb [Source:ZFIN;Acc:ZDB-GENE-030131-8563])

HSP 1 Score: 63.5438 bits (153), Expect = 5.734e-10
Identity = 46/149 (30.87%), Postives = 73/149 (48.99%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPD--APTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVV------KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGV 487
            W + T++   + ST  +W  EE    AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E +I+ FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I  + +     SG+
Sbjct:   69 WADETDDFEGEVST--SWHTEEDSYRAPPID----RSLLPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVSEESIKDFFRGLAISAVRLPREPNNPERLKGFGYAEFDDVESLLQALTLNEENLGNRRIRVDIADQSNDKERDSGM 211          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: eif4ba (eukaryotic translation initiation factor 4B [Source:NCBI gene;Acc:103022088])

HSP 1 Score: 63.5438 bits (153), Expect = 6.525e-10
Identity = 43/136 (31.62%), Postives = 69/136 (50.74%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEP--DAPTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            W + T++L    +T  +W  E+    AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E++I+ FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I
Sbjct:   41 WADETDDLEGDVTT--SWHTEDDVYRAPPID----RSILPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVTEDSIKDFFRGLSISAVRLPREPSNPERLKGFGYAEFDDVESLLRALSLNEENLGNRRIRVDI 170          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: eif4bb (eukaryotic translation initiation factor 4Bb [Source:ZFIN;Acc:ZDB-GENE-030131-8563])

HSP 1 Score: 63.1586 bits (152), Expect = 8.546e-10
Identity = 46/149 (30.87%), Postives = 73/149 (48.99%), Query Frame = 2
Query:   68 WKNVTENLTLQFSTKSNWSQEEPD--APTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVV------KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGV 487
            W + T++   + ST  +W  EE    AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E +I+ FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I  + +     SG+
Sbjct:   69 WADETDDFEGEVST--SWHTEEDSYRAPPID----RSLLPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVSEESIKDFFRGLAISAVRLPREPNNPERLKGFGYAEFDDVESLLQALTLNEENLGNRRIRVDIADQSNDKERDSGM 211          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: eif4ba (eukaryotic translation initiation factor 4B [Source:NCBI gene;Acc:103022088])

HSP 1 Score: 60.077 bits (144), Expect = 7.000e-9
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 2
Query:  140 APTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            AP +D    RS+LPT   A R+ + D   +P++ P+     N+P+D  E++I+ FF+   +  V         E+ +G G  EF D  SL  AL L E+   +R IR+ I
Sbjct:   26 APPID----RSILPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVTEDSIKDFFRGLSISAVRLPREPSNPERLKGFGYAEFDDVESLLRALSLNEENLGNRRIRVDI 131          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006591.1 (pep scaffold:Pmarinus_7.0:GL478411:5246:36068:1 gene:ENSPMAG00000005947.1 transcript:ENSPMAT00000006591.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 6.086e-8
Identity = 31/101 (30.69%), Postives = 49/101 (48.51%), Query Frame = 2
Query:  167 RSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV------VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            RS LPT   A R    D   +P   P+     N+P+D  E +I  FF+   + +V      +  ++ +G G  EF D +SL   L L E+  ++R IR+ +
Sbjct:   59 RSQLPTAPRAARGAGIDTSRLPSKPPYTAFLGNLPYDVTEESIFDFFKGLKISSVRLPRDALNPDRLKGFGYAEFDDIDSLLSGLALNEESLLNRKIRVDL 159          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO49481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG78])

HSP 1 Score: 55.0694 bits (131), Expect = 1.075e-7
Identity = 32/100 (32.00%), Postives = 48/100 (48.00%), Query Frame = 2
Query:  167 RSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNV-----VKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTI 448
            R+ LPT   ++R    DL  IP N PF     N+P+D +   I  FF +  +  V     +   + +G G  EF+D+ SL  AL L  +    R +R+ I
Sbjct:   77 RAALPTAPRSSRPTEVDLSKIPDNPPFTAFLGNLPYDVEREDILEFFSSVKITAVRLPQDMGGGRAKGFGYAEFEDKASLIQALDLNNESLRGRKVRVDI 176          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: eif4bb (eukaryotic translation initiation factor 4B [Source:NCBI gene;Acc:101166297])

HSP 1 Score: 52.7582 bits (125), Expect = 1.475e-6
Identity = 34/115 (29.57%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  140 APTMDVSEIRSVLPTKTSATRQIS-DLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVV------KSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKED 463
            AP +D    RS+LPT   + R+ + +   +P++ P+     N+P++  E +I+ FF+   +  V         ++ +G G  EF D +SL  AL L E+   +R IR+ I  + D
Sbjct:   73 APPID----RSILPTAPRSAREPNINRAKLPRSPPYTAFLGNLPYEVTEESIKDFFRGLAISAVRLPREPNNPQKLKGFGYAEFDDVDSLLRALSLDEENLGNRRIRVDIADQSD 183          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000071670.1 (SMESG000071670.1)

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 565/578 (97.75%), Postives = 567/578 (98.10%), Query Frame = 2
Query:   53 MNKKQWKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSNWREKPMIRNEDKPVTPSENTGNWRRAPAANVKSGNFTRQSQPIMHESAKPPTVIERPEPRENDNVKEMKKVSIFGDAKPVDTQAKFMEVEQKIEQSKKQTTDEPHKTEQPMXXXXXXXNPWTNKKQANPPITSVAASVPEKPSDNLNWRSAKKVPIGSKSLDGINQRESIAKSDAIPAPVEAXXXXXXXXXXXXXXNVWEERRKMKSTQNVDLNNSAASKVVTVATNATIAHQSPPTATESPNQIVKPPTVXXXXXXXXXTSPGNSAPSQPPTTNESKVIIQKHPVVISANGPFLDPKSRTPHHSMSDSSSNKAPTAVPINKSPIEIECSRSAASLLSKPPCPMGSSDQQKQPAATVAAVNTCGKQSSWSKGPPKGLIEKTEINQ 1786
            MNKKQWKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRS LPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQKRGTGIIEFKDRNSLTGALGLAEKQF+SRPIRLTIGYKEDFARIQSGVGQRGRYQNQQRNPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSNWREKPMIRNEDKPVTPSENTGNWRRAPAANVKSGNFTRQSQ IMHESAKPPTVIERPEPRENDNVKEMKKVSIFGDAKPVDTQAKFMEVEQKIEQSKKQTTDEPHK EQPMSSSSSSSNPWTNKKQAN PITSVAASVPEKPSDNLNWRSAKKVPIGSKSLDGINQRESIAKSDAIPAPVEAPKPVVDIRPPPPTVNVWEERRKMKSTQNVDLNNSAASKVVTVATNATIAHQSPPTATESPNQIV PPTV AAAAAAAATSPGNSAPSQP TTNESKVIIQKHPVVISANGPFLDPKSRTPHHSMSDSSSNKAPTAVPINKSPIEIECSRSA SLLSKPPCP   +DQQKQPAATVAAVNTCGKQSSWSKGPPKGLIEKTEINQ
Sbjct:    1 MNKKQWKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSFLPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQKRGTGIIEFKDRNSLTGALGLAEKQFLSRPIRLTIGYKEDFARIQSGVGQRGRYQNQQRNPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSNWREKPMIRNEDKPVTPSENTGNWRRAPAANVKSGNFTRQSQSIMHESAKPPTVIERPEPRENDNVKEMKKVSIFGDAKPVDTQAKFMEVEQKIEQSKKQTTDEPHKNEQPMSSSSSSSNPWTNKKQANAPITSVAASVPEKPSDNLNWRSAKKVPIGSKSLDGINQRESIAKSDAIPAPVEAPKPVVDIRPPPPTVNVWEERRKMKSTQNVDLNNSAASKVVTVATNATIAHQSPPTATESPNQIVNPPTV-AAAAAAAATSPGNSAPSQPLTTNESKVIIQKHPVVISANGPFLDPKSRTPHHSMSDSSSNKAPTAVPINKSPIEIECSRSAVSLLSKPPCP---TDQQKQPAATVAAVNTCGKQSSWSKGPPKGLIEKTEINQ 574          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000068377.1 (SMESG000068377.1)

HSP 1 Score: 108.997 bits (271), Expect = 5.659e-26
Identity = 68/217 (31.34%), Postives = 114/217 (52.53%), Query Frame = 2
Query:   53 MNKKQWKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSNWREKPMIRNEDKPVTPSENTGNWR 703
            M KK WK V  + +++ +     + E P+  T++ +E+R +LPT T A RQ+ ++  +  +GPF L FSN+ FDADE  ++  F+  D+V++  + +KRGTG IEF    +L  AL    K  + R I LTI    D  R       +    ++    ++++  +S+NWR+KK   + +  A      ++  NWR K   +N +   T + +  NWR
Sbjct:    1 MVKKVWKTVAVDFSIKPNNNIIVNSEIPENNTINTAELRKILPTTTHANRQLEEVNKLAIDGPFYLAFSNLNFDADEECLKKLFKDLDLVDIYFNPRKRGTGNIEFSSLENLKSALEFNGKVLVGRAINLTIITDLDKERKFYTFRDKNSCFHKDDKKSTSI--ESENWRSKKVVEIKETKA------SDSDNWRVK---KNVEMRETKASDCDNWR 206          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000003058.1 (SMESG000003058.1)

HSP 1 Score: 108.997 bits (271), Expect = 1.149e-25
Identity = 72/230 (31.30%), Postives = 121/230 (52.61%), Query Frame = 2
Query:   53 MNKKQWKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPA---DNFQPK----------NERSNWREKPMIRNEDKPVTPSENTGNWR 703
            M KK WK V+ + +++ +     + E P+  T++ +E+R +LPT T A RQ+ ++  +P +GPF L FSN+ FDADE  ++  F+  D+V++  + +KRGTG IEF    ++  AL    K  + R I LT+    D  +       R +     ++   + S +S+NWR KK   + +  A   DN++ K          ++ +NWR K   +N +   T +  TGNW+
Sbjct:    1 MVKKVWKTVSVDFSIKPNNNIIVNSEVPENNTINTAELRKILPTTTHANRQLEEVNKLPIDGPFYLAFSNLNFDADEECLKRLFKDLDLVDIYFNPRKRGTGNIEFSSLENVKSALEFNGKVLVGRAINLTLI--TDLDKESKFYTFRDKNSCFHKDDKKSTSIESENWRIKKVVEIKETKASDSDNWRVKKNVEMRETKASDCNNWRVK---KNVEIRETKATYTGNWK 225          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000068379.1 (SMESG000068379.1)

HSP 1 Score: 108.997 bits (271), Expect = 1.781e-25
Identity = 72/221 (32.58%), Postives = 114/221 (51.58%), Query Frame = 2
Query:   53 MNKKQWKNVTENLTLQFSTKSN----WSQEEPDAPTMDVSEIRSVLPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSNWREKPMIRNEDKPVTPSENTGNWR 703
            M KK WK V     + FS K N     + E P+  T++ +E+R +LPT T A RQ+ ++  +  +GPF L FSN+ FDADE  ++  F+  D+V++  + +KRGTG IEF    +L  AL    K  + R I LTI    D  R       +    ++    ++++  +S+NWR+KK   + +  A      ++  NWR K   +N +   T + +  NWR
Sbjct:    1 MVKKVWKTVA----VDFSIKPNNNIIVNSEIPENNTINTAELRKILPTTTHANRQLEEVNKLAIDGPFYLAFSNLNFDADEECLKKLFKDLDLVDIYFNRRKRGTGNIEFSSLENLKSALEFNGKVLVGRAINLTIITDLDKERKFYTFRDKNSCFHKDDKKSTSI--ESENWRSKKVVEIKETKA------SDSDNWRVK---KNVEMRETKASDCDNWR 206          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000068378.1 (SMESG000068378.1)

HSP 1 Score: 108.612 bits (270), Expect = 2.087e-25
Identity = 68/217 (31.34%), Postives = 114/217 (52.53%), Query Frame = 2
Query:   53 MNKKQWKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATRQISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQKRGTGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVXXXXXXXXXXXXPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSNWREKPMIRNEDKPVTPSENTGNWR 703
            M KK WK V  + +++ +     + E P+  T++ +E+R +LPT T A RQ+ ++  +  +GPF L FSN+ FDADE  ++  F+  D+V++  + +KRGTG IEF    +L  AL    K  + R I LTI    D  R       +    ++    ++++  +S+NWR+KK   + +  A      ++  NWR K   +N +   T + +  NWR
Sbjct:    1 MVKKVWKTVAVDFSIKPNNNIIVNSEIPENNTINTAELRKILPTTTHANRQLEEVNKLAIDGPFYLAFSNLNFDADEECLKKLFKDLDLVDIYFNPRKRGTGNIEFSSLENLKSALEFNGKVLVGRAINLTIITDLDKERKFYTFRDKNSCFHKDDKKSTSI--ESENWRSKKVVEIKETKA------SDSDNWRVK---KNVEMRETKASDCDNWR 206          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EIF4B4.961e-631.39eukaryotic translation initiation factor 4B [Sourc... [more]
EIF4B5.199e-631.39eukaryotic translation initiation factor 4B [Sourc... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eIF4B7.278e-1226.17gene:FBgn0020660 transcript:FBtr0113681[more]
eIF4B7.703e-1226.17gene:FBgn0020660 transcript:FBtr0113679[more]
eIF4B8.558e-1226.17gene:FBgn0020660 transcript:FBtr0334940[more]
eIF4B9.954e-1226.17gene:FBgn0020660 transcript:FBtr0113680[more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4bb1.259e-1030.61eukaryotic translation initiation factor 4Bb [Sour... [more]
eif4bb1.357e-1030.61eukaryotic translation initiation factor 4Bb [Sour... [more]
eif4bb1.372e-1030.61eukaryotic translation initiation factor 4Bb [Sour... [more]
eif4bb1.463e-1030.61eukaryotic translation initiation factor 4Bb [Sour... [more]
eif4ba2.372e-1031.34eukaryotic translation initiation factor 4Ba [Sour... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4b2.723e-1032.85eukaryotic translation initiation factor 4B [Sourc... [more]
eif4b2.764e-1032.85eukaryotic translation initiation factor 4B [Sourc... [more]
eif4b2.840e-1032.85eukaryotic translation initiation factor 4B [Sourc... [more]
eif4b4.139e-1032.85eukaryotic translation initiation factor 4B [Sourc... [more]
eif4b4.164e-1032.85eukaryotic translation initiation factor 4B [Sourc... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Eif4b5.846e-630.66eukaryotic translation initiation factor 4B [Sourc... [more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O14369|SCE3_SCHPO4.664e-732.95Probable RNA-binding protein sce3 OS=Schizosacchar... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6K43.048e-5760.38Probable RNA-binding protein (Fragment) OS=Dugesia... [more]
D6X4V59.475e-1528.99RRM domain-containing protein OS=Tribolium castane... [more]
A0A170WL912.803e-1239.67Eukaryotic translation initiation factor 4b-like p... [more]
A0A1W5B5781.990e-1128.83eukaryotic translation initiation factor 4B OS=Cio... [more]
H2Y9442.290e-1130.60RRM domain-containing protein OS=Ciona savignyi OX... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eif4bb5.734e-1030.87eukaryotic translation initiation factor 4Bb [Sour... [more]
eif4ba6.525e-1031.62eukaryotic translation initiation factor 4B [Sourc... [more]
eif4bb8.546e-1030.87eukaryotic translation initiation factor 4Bb [Sour... [more]
eif4ba7.000e-933.64eukaryotic translation initiation factor 4B [Sourc... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006591.16.086e-830.69pep scaffold:Pmarinus_7.0:GL478411:5246:36068:1 ge... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO494811.075e-732.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif4bb1.475e-629.57eukaryotic translation initiation factor 4B [Sourc... [more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071670.10.000e+097.75SMESG000071670.1[more]
SMESG000068377.15.659e-2631.34SMESG000068377.1[more]
SMESG000003058.11.149e-2531.30SMESG000003058.1[more]
SMESG000068379.11.781e-2532.58SMESG000068379.1[more]
SMESG000068378.12.087e-2531.34SMESG000068378.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022375 ID=SMED30022375|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2496bp
ATTTTGTTTTACTTGATATTATTTTTAAAATTTAGTTTTACTTTACAAAA
AAATGAATAAAAAACAGTGGAAAAATGTTACTGAAAATTTAACACTCCAA
TTTTCAACTAAAAGCAATTGGTCACAAGAAGAACCAGATGCTCCAACTAT
GGACGTTAGTGAAATTCGATCGGTTTTGCCTACCAAAACTAGCGCAACAC
GTCAAATTTCAGATCTGGAGAACATTCCACAAAATGGTCCGTTTTTATTA
AATTTCTCCAATATTCCATTTGATGCCGATGAAAATGCAATTAGACATTT
CTTTCAAGCCTTTGATGTAGTAAACGTGGTTAAAAGCGAACAAAAACGTG
GAACTGGAATAATTGAATTTAAAGATCGTAATAGCTTAACTGGTGCATTA
GGGTTGGCAGAAAAACAATTTATAAGTAGGCCGATTCGTTTAACTATTGG
ATATAAAGAGGATTTTGCTCGTATACAAAGCGGAGTCGGTCAACGTGGGC
GATATCAAAATCAACAACGGAATCCAACATCCACATTGAGTGAAGATAGT
GATAATTGGAGAACGAAAAAACCCCAGCCAGTGTCACAAGCGCCAGCTGA
TAATTTCCAGCCTAAAAACGAAAGATCGAACTGGCGAGAAAAGCCAATGA
TTCGAAATGAAGATAAACCTGTAACTCCATCAGAAAACACCGGTAATTGG
CGAAGAGCTCCCGCCGCAAATGTAAAAAGCGGAAATTTCACTAGACAAAG
TCAGCCTATTATGCACGAAAGTGCTAAACCGCCCACCGTTATTGAACGAC
CAGAACCACGGGAAAATGATAATGTTAAGGAAATGAAAAAAGTATCGATT
TTCGGTGATGCCAAACCAGTCGATACACAAGCTAAATTTATGGAAGTTGA
ACAAAAAATTGAGCAATCCAAAAAACAAACTACCGATGAGCCACATAAAA
CCGAGCAGCCAATGAGCAGCAGCAGCAGCAGCTCAAACCCTTGGACCAAT
AAAAAGCAAGCAAATCCTCCAATCACCTCAGTTGCTGCATCAGTTCCTGA
AAAGCCATCCGATAACCTTAATTGGAGAAGTGCTAAAAAAGTTCCAATCG
GATCGAAATCTTTGGATGGTATAAATCAACGAGAATCTATCGCAAAATCT
GATGCAATTCCTGCTCCAGTTGAAGCTCCAAAACCCGTCGTGGACATTCG
GCCCCCTCCGCCAACAGTCAACGTATGGGAGGAACGGAGGAAAATGAAAT
CCACACAAAATGTCGACCTTAACAACAGTGCTGCTTCAAAGGTCGTTACC
GTTGCTACTAATGCAACAATTGCGCATCAAAGCCCACCGACAGCGACTGA
GAGTCCGAATCAGATTGTCAAGCCTCCCACTGTTGCTGCCGCCGCCGCCG
CTGCTGCTGCCACATCACCTGGCAACAGCGCTCCTTCACAGCCACCGACA
ACAAACGAATCAAAAGTAATCATCCAGAAGCACCCGGTTGTGATCTCTGC
AAATGGCCCATTCCTAGATCCGAAATCCCGCACGCCCCACCACAGCATGT
CTGACAGCTCATCGAATAAAGCTCCGACAGCCGTGCCGATCAATAAATCG
CCAATCGAAATCGAATGTTCCCGTTCCGCCGCATCACTGCTATCGAAACC
GCCTTGTCCAATGGGATCATCGGACCAACAGAAACAACCTGCTGCAACTG
TTGCTGCGGTAAATACCTGCGGAAAGCAAAGTTCATGGTCAAAAGGTCCC
CCGAAAGGCTTAATCGAAAAAACTGAAATCAATCAATAATTCTTGATTCT
TCTTCCGGTCGCGTGTTGTTGCCATTATCATTATTGATCTTATCGCGGCA
GTGTCAACGTGTTTTACCACCGTTTGGATATTTACCAATCTCGTTGGATT
TGTCATTAATATATATTGATAATTATAATAAATAGTTGAATTACCGTAAT
TTGATTGGCTGGTTTATTATATATAATTATATTTATCGATTCATTGATTC
TTATTTTTCAAAATACAATCATTATTATTGATATTATATTTGGGATAAAA
ATCGAATATTTAGTGAGCACACATTTATGTGTGTGCCAGTATGACAACGG
GCAAATTAGCCAATCAGTGATGATTGTGGTGTTTTTGGTTTTGGCTCAGT
ATTTTATGAAGATTATTTCATGATTTTTGGTTTTTCGGATTTGTAAAGTG
TTTATTTATACATATAATAATATTTCGGGTTTCTTTCTGTCTCTGCCTCT
CTGTGTGTGTGTCTGTGTTCTCGCGCGCGCGTGTGTGTGTGATATTTCTG
AATTATTTATTTCAAAACGAATCCCTGTTATAAACAAAGTTAATATTTTT
TTATTGTTATTAAATTAGTTGCCATTCAAATGTGTTTTAAAAGCGTGTTT
AATTTTGCAAGTATTTAATTCGTTAATGAGTTTGTTTCAAATGATTTTTA
GGGAATAAATAAATCGGACATATTTTTTGTTAAAAAAAAAGATCGG
back to top

protein sequence of SMED30022375-orf-1

>SMED30022375-orf-1 ID=SMED30022375-orf-1|Name=SMED30022375-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MNKKQWKNVTENLTLQFSTKSNWSQEEPDAPTMDVSEIRSVLPTKTSATR
QISDLENIPQNGPFLLNFSNIPFDADENAIRHFFQAFDVVNVVKSEQKRG
TGIIEFKDRNSLTGALGLAEKQFISRPIRLTIGYKEDFARIQSGVGQRGR
YQNQQRNPTSTLSEDSDNWRTKKPQPVSQAPADNFQPKNERSNWREKPMI
RNEDKPVTPSENTGNWRRAPAANVKSGNFTRQSQPIMHESAKPPTVIERP
EPRENDNVKEMKKVSIFGDAKPVDTQAKFMEVEQKIEQSKKQTTDEPHKT
EQPMSSSSSSSNPWTNKKQANPPITSVAASVPEKPSDNLNWRSAKKVPIG
SKSLDGINQRESIAKSDAIPAPVEAPKPVVDIRPPPPTVNVWEERRKMKS
TQNVDLNNSAASKVVTVATNATIAHQSPPTATESPNQIVKPPTVAAAAAA
AAATSPGNSAPSQPPTTNESKVIIQKHPVVISANGPFLDPKSRTPHHSMS
DSSSNKAPTAVPINKSPIEIECSRSAASLLSKPPCPMGSSDQQKQPAATV
AAVNTCGKQSSWSKGPPKGLIEKTEINQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0033592RNA strand annealing activity
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0003743translation initiation factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR033107EIF-4B
IPR035979RBD_domain_sf
IPR012677Nucleotide-bd_a/b_plait_sf
IPR000504RRM_dom
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
GO:0097010eukaryotic translation initiation factor 4F complex assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 69..129
e-value: 2.7E-5
score: 23.9
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 64..135
score: 9.524
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 45..143
e-value: 1.9E-8
score: 35.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 492..516
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 276..298
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..257
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 496..510
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 146..165
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 454..472
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 443..472
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 189..204
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 299..337
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 172..188
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 532..574
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 272..370
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..240
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 532..558
NoneNo IPR availablePANTHERPTHR23236EUKARYOTIC TRANSLATION INITIATION FACTOR 4B/4Hcoord: 39..131
IPR033107Eukaryotic translation initiation factor 4BPANTHERPTHR23236:SF42coord: 39..131
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 57..137