cytoplasmic dynein 2 light intermediate chain 1

Overview
Namecytoplasmic dynein 2 light intermediate chain 1
Smed IDSMED30022372
Length (bp)1096
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cytoplasmic dynein 2 light intermediate chain 1 (SMED30022372) t-SNE clustered cells

Violin plots show distribution of expression levels for cytoplasmic dynein 2 light intermediate chain 1 (SMED30022372) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cytoplasmic dynein 2 light intermediate chain 1 (SMED30022372) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cytoplasmic dynein 2 light intermediate chain 1 (SMED30022372) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022372

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022372h1SMcG0016073 dd_Smed_v4_4291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022372h1SMcG0016073 dd_Smed_v4_4291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022372h1SMcG0016073 dd_Smed_v4_4291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022372h1SMcG0016073 dd_Smed_v6_4291_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022372h1SMcG0016073 dd_Smed_v4_4291_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Human
Match: DYNC2LI1 (dynein cytoplasmic 2 light intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:24595])

HSP 1 Score: 265.003 bits (676), Expect = 9.810e-86
Identity = 139/347 (40.06%), Postives = 221/347 (63.69%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFSLSE----SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLY-LEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQT--EIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++W+I    +  +  N S  +    ++  +FF G K+ GK+TII + L+++E  KPT+AL+Y YGR+ KGHN PK +AH WELGGGT L  LI + IT D LRT ++++V+DLS+P  ++ T+E LL   K+ +  ++ KL   +   +  + +K+   + K  P+ +LI+ FPVPLVIIG KYD FQ+ + ++R VICK+LRF+ H+YG SLMF + S+ LL+ ++R ++   AFG   +K++      P+ I AG DSF  IG+P      + +L + + ++ WK+ Y   +PPK SI T  +I DP ++ Q+AE  VDE ++QKD +LE+Y++ S +  + +
Sbjct:    3 SETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMKLGKTNAKAVSEMRQKIWNNMPKDHPDHELIDPFPVPLVIIGSKYDVFQDFESEKRKVICKTLRFVAHYYGASLMFTSKSEALLL-KIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSFGQIGSPPVPENDIGKLHAHSPMELWKKVYEKLFPPK-SINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQI 347          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Human
Match: DYNC2LI1 (dynein cytoplasmic 2 light intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:24595])

HSP 1 Score: 262.692 bits (670), Expect = 7.171e-85
Identity = 139/350 (39.71%), Postives = 219/350 (62.57%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFSLSE----SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKSP-----EKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQT--EIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++W+I    +  +  N S  +    ++  +FF G K+ GK+TII + L+++E  KPT+AL+Y YGR+ KGHN PK +AH WELGGGT L  LI + IT D LRT ++++V+DLS+P  ++ T+E LL   K+ +  ++ KL  G      + E  +++    P     + +LI+ FPVPLVIIG KYD FQ+ + ++R VICK+LRF+ H+YG SLMF + S+ LL+ ++R ++   AFG   +K++      P+ I AG DSF  IG+P      + +L + + ++ WK+ Y   +PPK SI T  +I DP ++ Q+AE  VDE ++QKD +LE+Y++ S +  + +
Sbjct:    3 SETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMKL--GKTNAKAVSEMRQKIWNNMPKDHPQDHELIDPFPVPLVIIGSKYDVFQDFESEKRKVICKTLRFVAHYYGASLMFTSKSEALLL-KIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSFGQIGSPPVPENDIGKLHAHSPMELWKKVYEKLFPPK-SINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQI 348          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Human
Match: DYNC2LI1 (dynein cytoplasmic 2 light intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:24595])

HSP 1 Score: 253.832 bits (647), Expect = 7.711e-82
Identity = 130/299 (43.48%), Postives = 197/299 (65.89%), Query Frame = 2
Query:  107 LFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLY-LEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQT--EIADPGKNLQFAEPLVDEAKLQKD 991
            +FF G K+ GK+TII + L+++E  KPT+AL+Y YGR+ KGHN PK +AH WELGGGT L  LI + IT D LRT ++++V+DLS+P  ++ T+E LL   K+ +  ++ KL   +   +  + +K+   + K  P+ +LI+ FPVPLVIIG KYD FQ+ + ++R VICK+LRF+ H+YG SLMF + S+ LL+ ++R ++   AFG   +K++      P+ I AG DSF  IG+P      + +L + + ++ WK+ Y   +PPK SI T  +I DP ++ Q+AE  VDE ++QKD
Sbjct:   18 VFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMKLGKTNAKAVSEMRQKIWNNMPKDHPDHELIDPFPVPLVIIGSKYDVFQDFESEKRKVICKTLRFVAHYYGASLMFTSKSEALLL-KIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSFGQIGSPPVPENDIGKLHAHSPMELWKKVYEKLFPPK-SINTLKDIKDPARDPQYAENEVDEMRIQKD 314          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Human
Match: DYNC2LI1 (dynein cytoplasmic 2 light intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:24595])

HSP 1 Score: 124.02 bits (310), Expect = 3.664e-33
Identity = 61/143 (42.66%), Postives = 94/143 (65.73%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFSLSE----SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKL 442
            S ++W+I    +  +  N S  +    ++  +FF G K+ GK+TII + L+++E  KPT+AL+Y YGR+ KGHN PK +AH WELGGGT L  LI + IT D LRT ++++V+DLS+P  ++ T+E LL   K+ +  ++ KL
Sbjct:    3 SETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMKL 145          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Human
Match: DYNC2LI1 (dynein cytoplasmic 2 light intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:24595])

HSP 1 Score: 96.6709 bits (239), Expect = 1.129e-23
Identity = 48/106 (45.28%), Postives = 69/106 (65.09%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFSLSE----SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRT 331
            S ++W+I    +  +  N S  +    ++  +FF G K+ GK+TII + L+++E  KPT+AL+Y YGR+ KGHN PK +AH WELGGGT L  LI + IT D LR+
Sbjct:    3 SETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRS 108          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Celegans
Match: xbx-1 (X-BoX promoter element regulated [Source:UniProtKB/TrEMBL;Acc:Q19119])

HSP 1 Score: 158.688 bits (400), Expect = 5.975e-45
Identity = 105/341 (30.79%), Postives = 179/341 (52.49%), Query Frame = 2
Query:   29 MSVWDIGIQSL-NNKEKNFSL---------SESDTTL-----------FFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKSPEKDL--INVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPK----DSIQTEIADPGKNLQFAEPLVD 970
            M++WD+  Q L  NK++   L         ++SD  L            F G + SGKS+ +  FLE+ E +K +V L+Y Y R+T+G+   K +A++WELGGG  + +L+ V IT  N+   ++I+++D++    ++ TIE  ++  + R+   L++ +   +TRL   EKM+  + K  +  L   N  P+P+ I+  KYD+FQ  + ++R  +C+ LRFL + YG +LM F+S  E     ++ +  H+AFG+   +   T    P+ +  G DS   IG P     S N + + +    W+ ++ S +P K    D   T+  DP  +  F EP +D
Sbjct:    1 MNIWDLAKQKLVENKQRAAELKQKLDDENGTQSDNYLSEVRRRHESHIIFAGNRKSGKSSFMLNFLERKEDLKDSVGLEYTYARRTRGN--VKDIANLWELGGGATVTELLSVPITMKNVEICSLILLLDMTNLDEMWITIEKTVDSVR-RLVENLERQDINLQTRL--AEKMRLRLEKYDDGSLKMCNPCPIPVTIVASKYDEFQNFESEKRRHLCQFLRFLAYSYGANLMMFSSRMEQFPKLVKNMTSHFAFGTVCPQGYMTDHNKPMFVKCGFDSLESIGIPP---ASDNFMGASSPFNLWRESFISLWPQKTGTIDIEDTKKQDPMIDPVFKEPNID 333          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Fly
Match: CG3769 (gene:FBgn0032119 transcript:FBtr0079810)

HSP 1 Score: 140.584 bits (353), Expect = 5.079e-38
Identity = 96/341 (28.15%), Postives = 173/341 (50.73%), Query Frame = 2
Query:   20 SNSMSVWDIGIQSLNNKEKNFSLSESDT----TLFFFGEKSSGKSTIISKFLEKNE-SIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGK-SPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSAN--KTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ------TEIADPGKNLQFAEPLVDEAKLQKDEDL 1000
            S + S+ DI  +    +++   L  + T    T+   G K  GK+T I+KF ++ E + +PT+AL+Y +GR+      P+ V ++WELG     ++L++V +    L+ + +I+++DLS+P   ++ +E      +   + +++K+    E R  LE++  E VG+ + + + ++  P P++I+GGKYD F   D   R   C+ LR + H  GG+L+F++     L   LR  + H  FGS A+  ++       P+ I  G+DS+  IG              +   Q  +R  ++F      +Q       E  DP K+  F E ++DE + QK+E+L
Sbjct:   27 SATPSIQDIAGRLAEEQQRLRQLEATTTPKERTILVLGSKCVGKTTAINKFFDREEHATRPTLALEYSFGRRIGSGKSPQ-VMNVWELGSLDNAEQLLEVPMRTHGLQQLAVILMLDLSQPQRFWTDLECAYKGLRDTAQQMMEKVTP--ELREILEQRTVERVGQQNKDSEKLDPLPFPVIIVGGKYDVFSGFDPIIRKHTCRCLRSMAHLIGGALLFYSQKMPKLAKVLRDTICHLGFGSPAHPFRSHVVDFNEPLCIWFGTDSWSKIG--------------DTGAQSVERIGATFGMEVPQLQLEKQKLKETTDPAKDPGFKELVIDEIRSQKNEEL 350          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Zebrafish
Match: dync2li1 (dynein, cytoplasmic 2, light intermediate chain 1 [Source:NCBI gene;Acc:393452])

HSP 1 Score: 273.478 bits (698), Expect = 3.259e-89
Identity = 130/342 (38.01%), Postives = 221/342 (64.62%), Query Frame = 2
Query:   23 NSMSVWDIGIQSLNNKEKNFSLSE---------SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ-TEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRK 1015
            +S ++WDI    + ++E      E         S  T+FF G K+ GK+TI+ +FL+++E+ KPT+AL+Y +GR+ +GHN PK +AH+WELGGG  L  L+ + IT DN+  +++++V+DLS+P +++ T+E+LL  A+ +++ +   L    E+R   ++++  V+ K  P+++LI+ FPVPL+I+G K+D FQ+ D ++R VIC++LRFL HFYG SL+F +S  E  +++ R  +   AFG+   K++ T    P++IPAGSDS   IG P      +  L ++N    WK+ +   +P + + +  E+ DP K+ QF+EPL+D  + QKD++L++Y++
Sbjct:    5 SSDTLWDIAAAEVRSRESRTDEEEAEEEDAHFPSQRTVFFMGSKAGGKTTILLRFLDRDETAKPTLALEYTFGRRARGHNTPKDIAHLWELGGGISLSDLVQIPITADNVSFLSVVLVLDLSKPNALWETMESLLGSARNQVEKVCAALQKTGESR-SGKQRVPRVLHKDYPDRELISPFPVPLLIVGSKFDIFQDFDSEKRKVICRTLRFLAHFYGASLIFTSSKSETTMSKSRSFINQLAFGTERPKSISTDPSKPLAIPAGSDSLSQIGPPVATEVDIGTLHAKNPFDLWKKVFEKVFPHESTRERKELKDPVKDPQFSEPLIDSIRAQKDQELDQYKR 345          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Zebrafish
Match: dync2li1 (dynein, cytoplasmic 2, light intermediate chain 1 [Source:NCBI gene;Acc:393452])

HSP 1 Score: 273.478 bits (698), Expect = 3.259e-89
Identity = 130/342 (38.01%), Postives = 221/342 (64.62%), Query Frame = 2
Query:   23 NSMSVWDIGIQSLNNKEKNFSLSE---------SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ-TEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRK 1015
            +S ++WDI    + ++E      E         S  T+FF G K+ GK+TI+ +FL+++E+ KPT+AL+Y +GR+ +GHN PK +AH+WELGGG  L  L+ + IT DN+  +++++V+DLS+P +++ T+E+LL  A+ +++ +   L    E+R   ++++  V+ K  P+++LI+ FPVPL+I+G K+D FQ+ D ++R VIC++LRFL HFYG SL+F +S  E  +++ R  +   AFG+   K++ T    P++IPAGSDS   IG P      +  L ++N    WK+ +   +P + + +  E+ DP K+ QF+EPL+D  + QKD++L++Y++
Sbjct:    5 SSDTLWDIAAAEVRSRESRTDEEEAEEEDAHFPSQRTVFFMGSKAGGKTTILLRFLDRDETAKPTLALEYTFGRRARGHNTPKDIAHLWELGGGISLSDLVQIPITADNVSFLSVVLVLDLSKPNALWETMESLLGSARNQVEKVCAALQKTGESR-SGKQRVPRVLHKDYPDRELISPFPVPLLIVGSKFDIFQDFDSEKRKVICRTLRFLAHFYGASLIFTSSKSETTMSKSRSFINQLAFGTERPKSISTDPSKPLAIPAGSDSLSQIGPPVATEVDIGTLHAKNPFDLWKKVFEKVFPHESTRERKELKDPVKDPQFSEPLIDSIRAQKDQELDQYKR 345          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Zebrafish
Match: dync1li2 (dynein, cytoplasmic 1, light intermediate chain 2 [Source:ZFIN;Acc:ZDB-GENE-050417-156])

HSP 1 Score: 54.299 bits (129), Expect = 1.245e-7
Identity = 61/269 (22.68%), Postives = 112/269 (41.64%), Query Frame = 2
Query:   95 SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFV-AHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKM----------KEVVGKSPEKD-------------------LINVFPVPLVIIGGKYDKF----QEIDLKRR--TVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDS 793
            S   +  FGE  SGK+T++SK L+  E  K    L+Y Y    +  +I       +W L G  + + L+  A+T ++L+    + VVD+S P +I  +++   +V +  +    DKL    E    +E++M          +E    SP++                    L +   +P++I+  K D      +E D K      I   +R     YG  L++ +  +E  ++ L   + H  +    +       K+ + IP+G D+
Sbjct:   49 SGKNVLLFGEDGSGKTTLMSK-LQGAEHNKKGRGLEYLY-LNVQDEDIDDLTRCSVWILDGDLYHKGLLKFAVTAESLKDSLAVFVVDMSRPWTIMESLQKWTSVLREHV----DKLRIPPEEMREMEQRMVKAFQEYVEPEEATPGSPQRRAPAAAGEDESVLLPLADNVLTHNLGIPMLIVCTKCDAVNVLEKEHDYKEEHFDFIQSHIRRFCLQYGAGLIYTSVKEEKNLDLLYKYMVHKIYDFQFSSPALVVEKDAVFIPSGWDN 311          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Zebrafish
Match: dync1li2 (dynein, cytoplasmic 1, light intermediate chain 2 [Source:ZFIN;Acc:ZDB-GENE-050417-156])

HSP 1 Score: 53.9138 bits (128), Expect = 1.825e-7
Identity = 61/269 (22.68%), Postives = 112/269 (41.64%), Query Frame = 2
Query:   95 SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFV-AHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKM----------KEVVGKSPEKD-------------------LINVFPVPLVIIGGKYDKF----QEIDLKRR--TVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDS 793
            S   +  FGE  SGK+T++SK L+  E  K    L+Y Y    +  +I       +W L G  + + L+  A+T ++L+    + VVD+S P +I  +++   +V +  +    DKL    E    +E++M          +E    SP++                    L +   +P++I+  K D      +E D K      I   +R     YG  L++ +  +E  ++ L   + H  +    +       K+ + IP+G D+
Sbjct:   49 SGKNVLLFGEDGSGKTTLMSK-LQGAEHNKKGRGLEYLY-LNVQDEDIDDLTRCSVWILDGDLYHKGLLKFAVTAESLKDSLAVFVVDMSRPWTIMESLQKWTSVLREHV----DKLRIPPEEMREMEQRMVKAFQEYVEPEEATPGSPQRRAPAAAGEDESVLLPLADNVLTHNLGIPMLIVCTKCDAVNVLEKEHDYKEEHFDFIQSHIRRFCLQYGAGLIYTSVKEEKNLDLLYKYMVHKIYDFQFSSPALVVEKDAVFIPSGWDN 311          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Zebrafish
Match: dync1li1 (dynein, cytoplasmic 1, light intermediate chain 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4108])

HSP 1 Score: 51.9878 bits (123), Expect = 7.444e-7
Identity = 64/266 (24.06%), Postives = 111/266 (41.73%), Query Frame = 2
Query:   95 SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKM----KEVV-----------GKSPEKD------------LINVFPVPLVIIGGKYDKF----QEIDLKRRTV--ICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDS 793
            S   +   GE  SGK+T+++K     E +K    L+Y Y          +   + W L G  + + L   AI+ +NL    I+ VVDLS P     +++   +V    ++  +DKL    ET   LE ++    +E V            ++PE D            L +   +P+V++  K D      +E D K   +  I   +R     YG +L++ +  +   ++ L   L H  +G   N   +   K+ + IP+G D+
Sbjct:   52 SGKNVVVMGEVGSGKTTLVAKLQGVEEYMKGR-GLEYLYFNVHDDDIDDQSRCNAWVLDGDLYHKGLQKFAISLENLEDSLILFVVDLSRPWLALDSLQKWGSV----VRDFVDKLRVPPETMRELEHRLTKQFQEYVEPGSDLDAVPQRRNPESDEESVLLPLGENTLTHNLGLPIVVVCTKCDAISTLEKEHDYKDEHLDFIQSHIRRFCLQYGAALLYTSMKENKNLDLLYKYLVHRLYGFPFNSPAQVVEKDSVFIPSGWDN 312          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Xenopus
Match: ENSXETT00000007798.1 (dynein, cytoplasmic 2, light intermediate chain 1 [Source:NCBI gene;Acc:101734949])

HSP 1 Score: 234.572 bits (597), Expect = 3.489e-74
Identity = 113/295 (38.31%), Postives = 189/295 (64.07%), Query Frame = 2
Query:  170 NESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKL-NDGDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRL-RILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ-TEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            +E+ KPT+AL+Y +GR+ KGHN PK +AH WELGGGT L  LI + IT DNL + ++++V+DLS+P  ++ T+E+LL   +  +  I+  +  +  +    +++K+ + + K  P+++LI+ FP+PL+I G KYD FQ+ D + R +ICK+LRF+ H+YG SL+F + S  L++  + R  + H AFG   +K++      P+ IPAGSDSF  IG+P   +  ++Q      ++ WK+ +   +PPK++    E  DP K+ Q++E  VD  +  KD++LE+Y++ +DR  + +
Sbjct:   40 DEAPKPTLALEYTFGRRAKGHNTPKDIAHFWELGGGTSLLDLIQIPITSDNLMSFSVVLVLDLSKPNELWPTMESLLETTRKHVDKIITGIAKNSSKIANQIKQKLWQTIPKDHPDRELIDPFPLPLLIAGSKYDIFQDFDSEIRKIICKTLRFVAHYYGASLLFTSKSDALMLKGVTRSFINHLAFGLDKSKSLSIDHNKPLIIPAGSDSFSQIGSPPASDTDISQFRVRTPMELWKKVFEKNFPPKNTNDFKETRDPAKDPQYSEAEVDAMRALKDQELEQYKRNADRTWKAM 334          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Xenopus
Match: ENSXETT00000009585.1 (cytoplasmic dynein 2 light intermediate chain 1-like [Source:NCBI gene;Acc:100498570])

HSP 1 Score: 204.912 bits (520), Expect = 4.900e-63
Identity = 105/276 (38.04%), Postives = 169/276 (61.23%), Query Frame = 2
Query:  176 SIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKL-NDGDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ-TEIADPGKNLQFAEPLVDEAKLQKDE 994
            S KPT+AL+Y +GR+ KGHN    +AH WELGGGT L  LI + IT DNL + ++++V+DLS+P  ++ T+E+LL   +  +  I+  +  +  +    +++K+ + + K  P+++LI+ FP+PL+I G KYD FQ+ D + R +ICK+LRF+ H+YG SL+   S   +L    R  + H AFG   +K++      P+ IPAGSDSF  IG+P   +  ++Q      ++ WK+ +   +PPK++    E  DP K+ Q++E  VD  +  KD+
Sbjct:   26 SPKPTLALEYTFGRRAKGHNTVN-IAHFWELGGGTSLLDLIQIPITSDNLMSFSVVLVLDLSKPNELWPTMESLLETTRKHVDKIITGIAKNSSKIANQIKQKLWQTIPKDHPDRELIDPFPLPLLIAGSKYDIFQDFDSEIRKIICKTLRFVAHYYGASLL---SDALMLKGVTRSFINHLAFGLDKSKSLSIDHNKPLIIPAGSDSFSQIGSPPASDTDISQFRVRTPMELWKKVFEKNFPPKNTNDFKETRDPAKDPQYSEAEVDAMRALKDQ 297          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Xenopus
Match: ENSXETT00000009678.1 (cytoplasmic dynein 2 light intermediate chain 1-like [Source:NCBI gene;Acc:100498570])

HSP 1 Score: 194.512 bits (493), Expect = 3.003e-59
Identity = 102/278 (36.69%), Postives = 169/278 (60.79%), Query Frame = 2
Query:  170 NESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKL-NDGDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ-TEIADPGKNLQFAEPLVDEAKLQKDE 994
            +E+ KPT+AL+Y +GR+ KGHN    +AH WELGGGT L  LI + IT DNL + ++++V+DLS+P  ++ T+E+LL   +  +  I+  +  +  +    +++K+ + + K  P+++LI+ FP+PL+I G KYD FQ+ D + R +ICK+LRF+ H+YG SL+       L+++ + +     A  S+ NK        P+ IPAGSDSF  IG+P   +  ++Q      ++ WK+ +   +PPK++    E  DP K+ Q++E  VD  +  KD+
Sbjct:    6 DEAPKPTLALEYTFGRRAKGHNTVN-IAHFWELGGGTSLLDLIQIPITSDNLMSFSVVLVLDLSKPNELWPTMESLLETTRKHVDKIITGIAKNSSKIANQIKQKLWQTIPKDHPDRELIDPFPLPLLIAGSKYDIFQDFDSEIRKIICKTLRFVAHYYGASLLVCTIHVSLIMHSISL-----AINSNHNK--------PLIIPAGSDSFSQIGSPPASDTDISQFRVRTPMELWKKVFEKNFPPKNTNDFKETRDPAKDPQYSEAEVDAMRALKDQ 269          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Mouse
Match: Dync2li1 (dynein cytoplasmic 2 light intermediate chain 1 [Source:MGI Symbol;Acc:MGI:1913996])

HSP 1 Score: 278.87 bits (712), Expect = 1.896e-91
Identity = 139/346 (40.17%), Postives = 222/346 (64.16%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFSLSES----DTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLND-GDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDS-IQTEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++W+I    +  +  + S  +     + ++FF G K+ GK+TII + L+++ES KPT+AL+Y YGR+TKGHN PK +AH WELGGGT L  LI + IT D LRT +I++V+DLS+P  ++ST+E LL   K+ +  ++ KL     +    + ++M  VV K  P+++LI+ FP+PLVIIG KYD FQ+ D ++R VICK+LRF+ H+YG SLMF + S+ LL+ ++R ++   AFG   +K++      P+ I AG DS   IG+P   +  + +L + + ++ WK+ Y   +PPK +     + DP ++ Q+AE  VDE ++QKD++LE Y++ S +  + +
Sbjct:    3 SETLWEIAKAEVEKRRSHGSEGDGAEIGEKSVFFIGSKNGGKTTIILRCLDRDESAKPTLALEYTYGRKTKGHNTPKDIAHFWELGGGTSLLDLISIPITVDTLRTFSIVLVLDLSKPNDLWSTMENLLQATKSHVDKVIMKLGKTSSKASAEMRQRMWSVVQKDHPDRELIDPFPIPLVIIGSKYDIFQDFDPEKRKVICKTLRFVAHYYGASLMFTSKSEALLL-KIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSLCQIGSPPVPDSDIGKLQAHSPMELWKKVYDKLFPPKSTGTLKAVQDPARDPQYAESEVDEMRVQKDQELEHYKRSSSKTWKQI 347          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Mouse
Match: Dync1li2 (dynein, cytoplasmic 1 light intermediate chain 2 [Source:MGI Symbol;Acc:MGI:107738])

HSP 1 Score: 54.299 bits (129), Expect = 1.465e-7
Identity = 63/269 (23.42%), Postives = 111/269 (41.26%), Query Frame = 2
Query:   95 SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEK-MKEV---------VGKSPEKD--------------------LINVFPVPLVIIGGKYDKF----QEIDLKRRTV--ICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDS 793
            S   +  FGE  SGK+T+++K L+  E  K    L+Y Y              ++W L G  + + L+  A++ ++LR   +I V D+S P +I  +++   +V +  I    DK+    E    LE K MKE             SP++                     L +   +P++++  K D      +E D +   +  I   LR     YG +L++ +  +E  ++ L   + H  +G           K+ + IPAG D+
Sbjct:   53 SGKNILVFGEDGSGKTTLMTK-LQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLRETLVIFVADMSRPWTIMESLQKWASVLREHI----DKMKIPPEEMRDLERKFMKEFQDYIEPEEGCQGSPQRRGPLTSGSDEDSVALPLGDNVLTHNLGIPVLVVCTKCDAMSVLEKEHDYRDEHLDFIQAHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTIPALVVEKDAVFIPAGWDN 316          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Mouse
Match: Dync1li2 (dynein, cytoplasmic 1 light intermediate chain 2 [Source:MGI Symbol;Acc:MGI:107738])

HSP 1 Score: 54.299 bits (129), Expect = 1.495e-7
Identity = 63/269 (23.42%), Postives = 111/269 (41.26%), Query Frame = 2
Query:   95 SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEK-MKEV---------VGKSPEKD--------------------LINVFPVPLVIIGGKYDKF----QEIDLKRRTV--ICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDS 793
            S   +  FGE  SGK+T+++K L+  E  K    L+Y Y              ++W L G  + + L+  A++ ++LR   +I V D+S P +I  +++   +V +  I    DK+    E    LE K MKE             SP++                     L +   +P++++  K D      +E D +   +  I   LR     YG +L++ +  +E  ++ L   + H  +G           K+ + IPAG D+
Sbjct:   53 SGKNILVFGEDGSGKTTLMTK-LQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLRETLVIFVADMSRPWTIMESLQKWASVLREHI----DKMKIPPEEMRDLERKFMKEFQDYIEPEEGCQGSPQRRGPLTSGSDEDSVALPLGDNVLTHNLGIPVLVVCTKCDAMSVLEKEHDYRDEHLDFIQAHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTIPALVVEKDAVFIPAGWDN 316          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. UniProt/SwissProt
Match: sp|Q8K0T2|DC2L1_MOUSE (Cytoplasmic dynein 2 light intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync2li1 PE=1 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.326e-90
Identity = 139/346 (40.17%), Postives = 222/346 (64.16%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFSLSES----DTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLND-GDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDS-IQTEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++W+I    +  +  + S  +     + ++FF G K+ GK+TII + L+++ES KPT+AL+Y YGR+TKGHN PK +AH WELGGGT L  LI + IT D LRT +I++V+DLS+P  ++ST+E LL   K+ +  ++ KL     +    + ++M  VV K  P+++LI+ FP+PLVIIG KYD FQ+ D ++R VICK+LRF+ H+YG SLMF + S+ LL+ ++R ++   AFG   +K++      P+ I AG DS   IG+P   +  + +L + + ++ WK+ Y   +PPK +     + DP ++ Q+AE  VDE ++QKD++LE Y++ S +  + +
Sbjct:    3 SETLWEIAKAEVEKRRSHGSEGDGAEIGEKSVFFIGSKNGGKTTIILRCLDRDESAKPTLALEYTYGRKTKGHNTPKDIAHFWELGGGTSLLDLISIPITVDTLRTFSIVLVLDLSKPNDLWSTMENLLQATKSHVDKVIMKLGKTSSKASAEMRQRMWSVVQKDHPDRELIDPFPIPLVIIGSKYDIFQDFDPEKRKVICKTLRFVAHYYGASLMFTSKSEALLL-KIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSLCQIGSPPVPDSDIGKLQAHSPMELWKKVYDKLFPPKSTGTLKAVQDPARDPQYAESEVDEMRVQKDQELEHYKRSSSKTWKQI 347          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. UniProt/SwissProt
Match: sp|Q6AY43|DC2L1_RAT (Cytoplasmic dynein 2 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2li1 PE=1 SV=2)

HSP 1 Score: 276.944 bits (707), Expect = 8.102e-90
Identity = 139/346 (40.17%), Postives = 221/346 (63.87%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFS----LSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGD-ETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKD-SIQTEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++W+I    +  +  + S    +   + ++FF G K+ GK+TII + L+++E  KPT+AL+Y YGR+TKGHN PK +AH WELGGGT L  LI + IT D LRT +I++V+DLS+P  ++ T+E LL   K+ +  +  KL   + +    + ++M  V+ K  P+++LI+ FP+PLVIIG KYD FQ+ D ++R VICK+LRF+ H+YG SLMF + S+ LL+ ++R ++   AFG   +K+M      P+ I AG DS   IG+P   +  + +L + + ++ WK+ Y   +PPK  S    I DP ++ Q+AE  VDE ++QKD++LE+Y++ S +  + +
Sbjct:    3 SETLWEIAKAEVEKRRCHGSDGDGMEIGEKSVFFIGSKNGGKTTIILRCLDRDEPAKPTLALEYTYGRKTKGHNTPKDIAHFWELGGGTSLLDLISIPITVDTLRTFSIVLVLDLSKPNDLWPTMENLLQATKSHVDKVTMKLGKANSKASSEMRQRMWSVMQKDHPDRELIDPFPIPLVIIGSKYDIFQDFDPEKRKVICKTLRFVAHYYGASLMFTSKSEALLL-KMRGVINQLAFGIDKSKSMCVDQNKPLFITAGLDSLCQIGSPPVPDSDIGKLQAHSPMELWKKVYEKLFPPKSTSTLKAIQDPARDPQYAESEVDEMRVQKDQELEQYKRSSSKTWKQI 347          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. UniProt/SwissProt
Match: sp|Q7SXY4|DC2L1_DANRE (Cytoplasmic dynein 2 light intermediate chain 1 OS=Danio rerio OX=7955 GN=dync2li1 PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 3.818e-89
Identity = 132/342 (38.60%), Postives = 221/342 (64.62%), Query Frame = 2
Query:   23 NSMSVWDIGIQSLNNKEKNFSLSE---------SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ-TEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRK 1015
            +S ++WDI    + ++E      E         S  T+FF G K+ GK+TI+ +FLE++E+ KPT+AL+Y +GR+ +GHN PK +AH+WELGGG  L  L+ + IT DN+  +++++V+DLS+P +++ T+E+LL  A+ +++ +   L    E+R   ++++  V+ K  P+++LI+ FPVPL+I+G K+D FQ+ D ++R VICK+LRFL HFYG SL+F +S  E  +++ R  +   AFG+   K++ T    P++IPAGSDS   IG P      +  L ++N    WK+ +   +P + + +  E+ DP K+ QF+EPL+D  + QKD++L++Y++
Sbjct:    5 SSDTLWDIAAAEVRSRESRTDEEEAEEEDAHFPSQRTVFFMGSKAGGKTTILLRFLERDETAKPTLALEYTFGRRARGHNTPKDIAHLWELGGGISLSDLVQIPITADNVSFLSVVLVLDLSKPNALWETMESLLGSARNQVEKVCAALQKTGESR-SGKQRVPRVLHKDYPDRELISPFPVPLLIVGSKFDIFQDFDSEKRKVICKTLRFLAHFYGASLIFTSSKSETTMSKSRSFINQLAFGTERPKSISTDPSKPLAIPAGSDSLSQIGPPVATEVDIGTLHAKNPFDLWKKVFEKVFPHESTRERKELKDPVKDPQFSEPLIDSIRAQKDQELDQYKR 345          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. UniProt/SwissProt
Match: sp|Q32KV4|DC2L1_BOVIN (Cytoplasmic dynein 2 light intermediate chain 1 OS=Bos taurus OX=9913 GN=DYNC2LI1 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.249e-87
Identity = 142/347 (40.92%), Postives = 224/347 (64.55%), Query Frame = 2
Query:   26 SMSVWDIG---IQSLNNKEKNFSLSE-SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGD-ETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQT--EIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++W+I    ++   + E     +E  + ++FF G K+ GK+TII + L+++E  KPT+AL+Y YGR+TKGHNIPK +AH WELGGGT L  LI + IT D LRT +I++V+DLS+P  ++ T+E LL   K  I  ++ KL   + +    + +KM   + K  P+++L++ FP+PLVIIG KYD FQ+ D ++R VICK+LRF+ H+YG SLMF + S+ LL+ ++R ++   AFG + +K++      P+ I AG DS   IG P   +  + +L + + +  WK+ Y   +PPK SI T  ++ DP K+ Q+AE  VDE ++QKD++LE+Y++ S +  + +
Sbjct:    3 SETLWEIAKAEVEKRGSSENEGDGAEIGEKSVFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGRRTKGHNIPKDIAHFWELGGGTSLLDLISIPITSDTLRTFSIVLVLDLSKPNDLWPTMENLLQATKLNIDKVIMKLGKKNSKAASEMRQKMWSNMQKDHPDRELLDPFPIPLVIIGSKYDIFQDFDSEKRKVICKTLRFVAHYYGASLMFTSKSEALLL-KIRGVINQLAFGINKSKSICVDQNKPLFITAGLDSLSQIGPPPLPDNDIGKLHARSPMDLWKKVYEKLFPPK-SINTLKDVKDPAKDPQYAESEVDEMRIQKDQELEQYKRSSSKSWKQI 347          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. UniProt/SwissProt
Match: sp|Q8TCX1|DC2L1_HUMAN (Cytoplasmic dynein 2 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC2LI1 PE=1 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 4.711e-85
Identity = 139/347 (40.06%), Postives = 221/347 (63.69%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFSLSE----SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLY-LEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQT--EIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++W+I    +  +  N S  +    ++  +FF G K+ GK+TII + L+++E  KPT+AL+Y YGR+ KGHN PK +AH WELGGGT L  LI + IT D LRT ++++V+DLS+P  ++ T+E LL   K+ +  ++ KL   +   +  + +K+   + K  P+ +LI+ FPVPLVIIG KYD FQ+ + ++R VICK+LRF+ H+YG SLMF + S+ LL+ ++R ++   AFG   +K++      P+ I AG DSF  IG+P      + +L + + ++ WK+ Y   +PPK SI T  +I DP ++ Q+AE  VDE ++QKD +LE+Y++ S +  + +
Sbjct:    3 SETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKPNDLWPTMENLLQATKSHVDKVIMKLGKTNAKAVSEMRQKIWNNMPKDHPDHELIDPFPVPLVIIGSKYDVFQDFESEKRKVICKTLRFVAHYYGASLMFTSKSEALLL-KIRGVINQLAFGIDKSKSICVDQNKPLFITAGLDSFGQIGSPPVPENDIGKLHAHSPMELWKKVYEKLFPPK-SINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQI 347          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. TrEMBL
Match: A0A1S3IDT3 (cytoplasmic dynein 2 light intermediate chain 1 OS=Lingula unguis OX=7574 GN=LOC106163308 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 8.108e-104
Identity = 149/351 (42.45%), Postives = 237/351 (67.52%), Query Frame = 2
Query:   32 SVWDIGIQSLNNKEKNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKL-NDGDETRLYLEEKMKEVVGKS-PEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKD-SIQTEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDLRQQA-INDGIV 1072
            S+WD+ +   N  EK+    + +  +F  G K+SGK++II +FL+++E+ KPT AL+Y YGR+ +  N+ K VAHI+ELGGGTWL KL+ + ++ D L+   +++V+DLS+P  +++T+E LLN A++++K  +++L N   E    +E+   E VG+  P+K+L++ FP+PL IIG KYD FQE + ++R  ICK+LRF+ H YG +L+FF+S QE L+ R R L+ HY FG++ +KT++     P+ IPAG D+   IG+P   +  L    ++  L  WKRAY S +P ++ +  T + DP K++Q+AEP +D  + QKDE+LE+YR+L +RR ++  QQA +N+GI 
Sbjct:    7 SIWDLVVDQANGIEKDERQPKDEAAVFVIGSKNSGKTSIILRFLDRDETPKPTTALEYTYGRRARASNLAKDVAHIYELGGGTWLSKLMAIPLSADTLKNTALVMVLDLSQPNELWATLECLLNEAQSKVKVAMNELKNKNPELAQKMEQAAWERVGEDHPDKELLDPFPIPLAIIGSKYDLFQEFEPEKRKTICKTLRFVAHSYGATLIFFSSKQETLIQRTRALISHYVFGTNMSKTVQVDQNKPLLIPAGLDAASQIGSPPLSDDELGVGSAKTPLDLWKRAYCSMFPQENLNTPTSVEDPAKDIQYAEPAIDSMRKQKDEELERYRRLCERRAKEAEQQAMLNEGIA 357          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. TrEMBL
Match: A0A4S2LW40 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005903 PE=4 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.296e-95
Identity = 157/365 (43.01%), Postives = 230/365 (63.01%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKEKNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEV-----VGKSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQTEIA-----------DPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDLRQQAINDGIV 1072
            + SVWDI IQ  N K K F  ++ + TL F G KS+GKSTII  FL++ +  KPT+ALDY +GR++ G    K   H+WELG G  L  LID  ITPD++    +I+V+DLS+P  ++ T+ETLL     R   +L ++N  D     L+ K +E+         P+KDL+N FP+PLVIIG KYD F    L+++ +ICK+LRFLNHFYGGSL F +  ++LL+ R++ +L H AFG+   + ++T    P+SIP G+D F +IGAP      +++L ++  L+ WK  + + +P     Q+E+A           DP K+ Q+AEPLVD A+  KD++LE+ ++ ++RRMRDL QQAI DG++
Sbjct:    2 TQSVWDIAIQQHNLKNKKFP-NDHEPTLIFVGNKSAGKSTIIHYFLDREDKPKPTLALDYTFGRKSSGAFSTKSTVHVWELGRGIRLADLIDATITPDSVWRFHLILVLDLSKPREMWQTMETLLGTLMRRYDQLLTRINKRDLPE-SLKSKYRELREARKTSSHPDKDLLNPFPLPLVIIGSKYDLFTTQQLEQQKMICKTLRFLNHFYGGSLYFVSEKEDLLMKRIKAVLNHIAFGTPEQRVIQTELGKPLSIPEGADCFSNIGAPPNYELEVSRLTAKTPLEMWKAVFCARFP--QMTQSELAGLNSIVLDMATDPAKDPQYAEPLVDRARAGKDKELERIQQQNERRMRDLLQQAILDGVL 362          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. TrEMBL
Match: A0A0B6ZXV4 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF83487 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 1.481e-92
Identity = 141/339 (41.59%), Postives = 224/339 (66.08%), Query Frame = 2
Query:   32 SVWDIGIQSLNNKEKNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDET-RLYLEEKMKEVVG-KSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQTEIA-DPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRD 1039
            S+WDI I+    ++ + + S  ++T+F FG K+SGK++II +FL+++E  KPTVAL+Y +GR+ KG+NI K V HIWELGGGTWL KL+++ ITP +L   T+++V+DLS P  ++ST+ETLL+ AK R++  + +    D + +  L++K  E VG   P+K +I+ F +PLVI+G K+D FQ+ D ++R VICK+LRF+ H +G SL FF++ QE LV+R+R    H  F ++ +K ++     PI +  G D+   IG+P      + ++ ++  +  WK A++   P  ++    +  DP K+ QFAEP +D  + QKDE+LE YRKL++RR ++
Sbjct:   21 SLWDIAIEQSKIRKNDENSSNEESTMFLFGSKNSGKTSIILRFLDRDEPPKPTVALEYTFGRRAKGNNIAKDVGHIWELGGGTWLSKLMEIPITPKSLMHTTLLLVLDLSVPSELWSTMETLLHAAKTRLEEAIKEAKLTDPSIKDKLQKKAWERVGVDHPDKSMIDPFLIPLVIVGSKHDLFQDFDSEQRKVICKTLRFIAHVHGASLQFFSTKQEQLVSRMRNTFNHCLFDAATSKAIQVDHSKPIFVSPGHDTLQQIGSPPLSEKEIGRVQAKTPMALWKVAFTGILPQTNTNDPALVDDPAKDPQFAEPSIDNLRSQKDEELEHYRKLAERRSKE 359          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. TrEMBL
Match: V9KV96 (Cytoplasmic dynein 2 light intermediate chain 1-like protein OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 4.229e-92
Identity = 140/346 (40.46%), Postives = 225/346 (65.03%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKE----KNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLN--DGDETRLYLEEKMKEVVGKSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQT-EIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++WDI +  +  KE    K   L   + ++FF G KS GK+TII +FL+++E  KPT+AL+Y +GR+ KGHN PK +AH WELGGGT L  LI++ I  D++R +++++V+DLS+P  +++++E LL  A+  I  +L++L   D      + +   K +    P+ +L++ FPVPLVIIG KYD FQ+ D ++R VICK+LRF+ H+YG SL+FF+S  ELL++++R +L   AFG+  +KT+      P+ +PAG DS   IG+P      L ++ + N ++ WK+ Y   +PP+++ +  +I D  K+  +AEP VD  + QKD++LE+Y+K + R  ++L
Sbjct:    5 SNTLWDIAVAQVLKKENEDGKEDDLKTKERSVFFLGNKSGGKTTIILRFLDRDEVPKPTLALEYTFGRRAKGHNTPKDIAHFWELGGGTSLVDLIEIPINMDSIRDLSVVLVLDLSKPNDLWTSMEKLLTAARRHIDNVLNELGKKDSKTANQWKQRAWKNLQKDHPDWELVDPFPVPLVIIGNKYDIFQDFDSEQRKVICKTLRFVAHYYGASLLFFSSKSELLMSKMRNILNQLAFGTDRSKTISVEHNRPLFVPAGLDSLSQIGSPPATEIDLGKINARNPMELWKKVYERLFPPENTSEVKDIKDLVKDSHYAEPEVDAMRAQKDQELEQYKKNAARSWKEL 350          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. TrEMBL
Match: A0A4W3GVJ0 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=dync2li1 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 5.925e-92
Identity = 140/346 (40.46%), Postives = 225/346 (65.03%), Query Frame = 2
Query:   26 SMSVWDIGIQSLNNKE----KNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLN--DGDETRLYLEEKMKEVVGKSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQT-EIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            S ++WDI +  +  KE    K   L   + ++FF G KS GK+TII +FL+++E  KPT+AL+Y +GR+ KGHN PK +AH WELGGGT L  LI++ I  D++R +++++V+DLS+P  +++++E LL  A+  I  +L++L   D      + +   K +    P+ +L++ FPVPLVIIG KYD FQ+ D ++R VICK+LRF+ H+YG SL+FF+S  ELL++++R +L   AFG+  +KT+      P+ +PAG DS   IG+P      L ++ + N ++ WK+ Y   +PP+++ +  +I D  K+  +AEP VD  + QKD++LE+Y+K + R  ++L
Sbjct:    4 SNTLWDIAVAQVLKKENEDGKEDDLKTKERSVFFLGNKSGGKTTIILRFLDRDEVPKPTLALEYTFGRRAKGHNTPKDIAHFWELGGGTSLVDLIEIPINMDSIRDLSVVLVLDLSKPNDLWTSMEKLLTAARRHIDNVLNELGKKDSKTANQWKQRAWKTLQKDHPDWELVDPFPVPLVIIGNKYDIFQDFDSEQRKVICKTLRFVAHYYGASLLFFSSKSELLMSKMRNILNQLAFGTDRSKTISVEHNRPLFVPAGLDSLSQIGSPPATEIDLGKINARNPMELWKKVYERLFPPENTSEVKDIKDLVKDSHYAEPEVDAMRAQKDQELEQYKKNAARSWKEL 349          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Cavefish
Match: dync2li1 (dynein, cytoplasmic 2, light intermediate chain 1 [Source:NCBI gene;Acc:393452])

HSP 1 Score: 221.09 bits (562), Expect = 3.418e-69
Identity = 105/286 (36.71%), Postives = 173/286 (60.49%), Query Frame = 2
Query:  191 VALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ--TEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            +AL+Y +GR+ +GHN PK +AH+WELGGG  L  L+ + IT  N+ T+++++V+DLS+P +++ T+E          K     L    ++     E   +   +  +++LI+ FPVPL++IG KYD FQ+ + ++R VICK+LRFL H+YG SL+F +S  E  +++ R  + H AFG+   K++      P+ IPAG DS   IG+P   +  +  L + N L  WK+ +   +PP+ S +   E+ DP K+ Q+ EPL+D  + QKD++LE+Y++   +  + L
Sbjct:   56 LALEYTFGRRARGHNTPKDIAHLWELGGGISLSDLVQIPITNQNISTVSVVLVLDLSKPSTLWGTLE----------KTPAGSLEPSGKSVCLTAEVGSQQTER--DRELISPFPVPLLLIGSKYDIFQDFESEKRKVICKTLRFLAHYYGASLIFTSSKSETTMSKARSFVSHLAFGTERGKSLSADPSKPLIIPAGMDSLSQIGSPPAIDVDIGTLHARNPLDLWKKVFERVFPPEGSTKENKEVKDPAKDPQYCEPLIDSMRAQKDQELEQYKREQTKSWKGL 329          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Cavefish
Match: dync1li2 (dynein cytoplasmic 1 light intermediate chain 2 [Source:NCBI gene;Acc:103045291])

HSP 1 Score: 48.1358 bits (113), Expect = 8.982e-6
Identity = 58/268 (21.64%), Postives = 107/268 (39.93%), Query Frame = 2
Query:   95 SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKM----------KEVVGKSPEKD-------------------LINVFPVPLVIIGGKYDKF----QEIDLKRR--TVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDS 793
            S   +  FGE  SGK+T+++K L+  E  K    L+Y Y              ++W L G  + + L+  A+T + L+    + VVD+S P  I  +++   +V +  +    DKL    E    +E+ M          ++    SP++                    L +   +P++I+  K D      ++ D K      I   +R     YG +L++ +  +E  ++ L   + H  +            K+ + IPAG D+
Sbjct:   47 SGKNILVFGEDGSGKTTLMAK-LQGAEHNKKGRGLEYLYLSVHDEDRDDLTRCNVWILDGDLYHKGLLKFAVTAETLKDSLAVFVVDMSRPWGIVESLQKWTSVLREHV----DKLRIPPEEMREMEQSMVKAFQEYAEPEDATPASPQRRVPPAGGEDEGVLLPLGENVLTHNLGIPVLIVCTKCDAVTVLEKDHDYKEEHFDFIQSHIRRFCLQYGAALIYTSVKEEKNLDLLYKYMVHKMYDFQFTTPALVVEKDAVFIPAGWDN 309          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009033.1 (pep scaffold:Pmarinus_7.0:GL477561:65577:67700:-1 gene:ENSPMAG00000008173.1 transcript:ENSPMAT00000009033.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.995e-13
Identity = 29/95 (30.53%), Postives = 59/95 (62.11%), Query Frame = 2
Query:  764 PISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKD-SIQTEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDLR 1045
            P+ I AGSDS  +IG P      + ++ + + ++ W+++Y + +P ++   + +  D  K+ Q+AE  VD  + QKD++LE+YR+ + ++ RD++
Sbjct:    5 PLMIQAGSDSLQNIGGPPVSQKEMGRIHARSPMELWEKSYKAIFPQEEVDGRDKDGDAAKDKQYAELAVDAMRAQKDQELEEYRRSAGQQWRDIK 99          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Sea Lamprey
Match: dync1li1 (dynein, cytoplasmic 1, light intermediate chain 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4108])

HSP 1 Score: 48.9062 bits (115), Expect = 9.922e-7
Identity = 63/270 (23.33%), Postives = 110/270 (40.74%), Query Frame = 2
Query:  107 LFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARI---KYILDKLNDGD-----ETRLYLEEKMKEVVGKSP---------EKDLINVFP-----------VPLVIIGGKYDKF----QEIDLKRRT---VICKSLRF-LNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIG 808
            +   GE  SGK+++++K L+  E  +    L+Y Y              ++W L G  +   L+  A+T ++ R    ++V DL+ P  I   +     V +  +   K  +D+  D D     E + Y+E + +E    SP         E D   V P           VP++++  K D      +E D +      +     RF L   YG +L++ +  ++  V+ L   L H  +GS          ++ + IPAG D+   IG
Sbjct:   19 VVVLGEDGSGKTSLVAK-LQGVEEARKGRGLEYLYLSVHDEDRDDHARCNVWVLDGDEYHSGLLRFAMTRESARDSLTLLVADLARPWLIVDALHKWSGVLRRHLDSLKIPVDERRDMDNKLVREFQSYVEPETEE---SSPLRKSGSGDEEADECVVLPLGENTFTHNLGVPVIVVCTKSDAVSTLEKEYDYREEHFDFIQSHVRRFCLRGQYGAALVYTSLKEDKNVDLLHKYLLHRLYGSPFCTPALVLERDAVFIPAGWDNDKKIG 284          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Nematostella
Match: EDO46938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNJ9])

HSP 1 Score: 276.559 bits (706), Expect = 7.810e-91
Identity = 140/348 (40.23%), Postives = 216/348 (62.07%), Query Frame = 2
Query:   32 SVWDIGIQS---LNNKEKNFSLSES-----DTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLY-LEEKMKEVVG-KSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQ-TEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDL 1042
            ++WD+ I+    L N+ K     ES     +  +F  G K++GK++++ +FL+++E  KPT ALDY +GR+ KGHNI K V HIWELGGGT+L KLID+ I  D++R ++II+ +DLS P  ++ T+ETLLN  K R+  ++D+L   + + +  L     E  G   P+K  +  FP+PL I+GGKYD +Q+ D ++R +I ++LRF+ H  G  L FF++  E LV R R ++ H  F +S  K +      PI + AG DS   IGAP   +  L +L S N    WK AY++F+PP+ S Q ++  DP K+ Q+ E  VD  + QKDE+L++YR+ ++R+ R++
Sbjct:    9 TIWDLAIEERDYLLNEAKKKGTQESSPHGEEAGIFLIGSKNAGKTSMVLRFLDRDEVPKPTTALDYTFGRKAKGHNIAKDVGHIWELGGGTFLSKLIDIPINVDSVRGLSIIIFLDLSLPNELWHTMETLLNQVKKRVHKVMDELAAKNPSAVQKLRNDAWEKFGTDHPDKSFVEPFPIPLAIVGGKYDIYQDFDPEKRKMISRALRFIAHCNGAHLQFFSTKTEGLVGRSRGMIGHLLFHTSLGKAIGVDHNKPIIVSAGQDSLAQIGAPPVASEDLGRLQSRNPYDLWKAAYATFFPPEKSKQHSDREDPSKDPQYFEAAVDAMRKQKDEELDRYRRQAERKAREM 356          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Nematostella
Match: EDO45956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH9])

HSP 1 Score: 59.3066 bits (142), Expect = 7.639e-10
Identity = 60/267 (22.47%), Postives = 110/267 (41.20%), Query Frame = 2
Query:   95 SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVA-HIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARI---KYILDKLNDGDETRLY-------LEEKMKEVVGKSPEKD------------LINVFPVPLVIIGGKYDKFQEIDLKRR------TVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIG 808
            S  ++   G   SGK+T+ISK   K + I     L+Y Y  +     I  +   ++W L G    + L+  A+TP + R + +++VVD S P +I  ++ +   + +  I   K    +LN+ +E  +         EE   E   +S  KD            L++   +P++++  K D    ++  R         I + +R     +G +L + +  +    N     + H  +G           K+ + IP+G DS   IG
Sbjct:   17 SHKSIILIGNDESGKTTLISKLRGKEDDISKGHGLEYTY-LEVHDEEIDDYTRLNVWILDGDPRNKSLLKYALTPKHARDVLVVMVVDCSRPWAIMESLHSWTEILREHIHSLKLSPKELNEMEEKIVQQFQDYTDTEEASDENRRRSGTKDEDKVVLPLEENVLVDNLGIPMIVLVTKTDCMLSLEKDRDFHDEHFDFIQQHIRRYCLKHGAALFYTSVKENKNCNLFLKYVLHKIYGLPFKSPALVVDKDSVFIPSGWDSMKKIG 282          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Medaka
Match: dync2li1 (dynein cytoplasmic 2 light intermediate chain 1 [Source:NCBI gene;Acc:101158968])

HSP 1 Score: 242.276 bits (617), Expect = 5.539e-77
Identity = 116/333 (34.83%), Postives = 204/333 (61.26%), Query Frame = 2
Query:   17 VSNSMSVWDIGIQSLNNKEKNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYIL------DKLNDGDETRLYLEEKMKEVVGKSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKD-SIQTEIADPGKNLQFAEPLVDEAKLQKDE 994
            + NS S+W++    + ++E     + S+ T+F  G K+ GK++I+ + LE++E+ KPT+AL+Y +GR+ +GHN PK +AH+WELGGGT L  L+ + IT  ++  +++I+V+DLS+P  ++ T+E LL   + ++  +        K   G + + ++    + +    P+++LI+ FPVPL+IIG KYD FQ+ D +++ V+ K+LRF+ H++  SL+F +   E L+++++    H AFG    KT+ +     + I AGSDSF  IG P   +  +  L ++N    W++ Y   +P ++ S Q E+ DP K+ Q++EP +D  + QKD+
Sbjct:    1 IRNSDSLWELAAAEVQHQESE-EETVSERTVFLMGSKAGGKTSILLRCLERDEAPKPTLALEYTFGRRARGHNTPKDIAHLWELGGGTSLSDLVQIPITSVSVSCLSVILVLDLSKPNDLWVTMEKLLQAVQTQVDKVFSQAAQAQKSKPGTKNQQFVHPAARVLPKDYPDRELISPFPVPLLIIGSKYDLFQDFDSEKKKVVSKTLRFIAHYHAASLIFTSIKSESLMSKIKSFFSHLAFGLDRGKTLSSDLNKALIISAGSDSFSQIGPPSVTDVDITSLHAKNPKDLWRKVYEHVFPHENASEQKELKDPSKDPQYSEPQIDAMRAQKDQ 332          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Medaka
Match: dync1li2 (dynein cytoplasmic 1 light intermediate chain 2 [Source:NCBI gene;Acc:101172643])

HSP 1 Score: 50.0618 bits (118), Expect = 2.418e-6
Identity = 61/271 (22.51%), Postives = 109/271 (40.22%), Query Frame = 2
Query:   95 SDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKM---------------------------KEVVGKSPEKDLINVFPVPLVIIGGKYDKF----QEIDLKRR--TVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIG 808
            S   +  FGE  SGK+T++SK L+  +  K    L+Y Y              ++W L G  + + L+  A+T  +L     + VVD+S P +I  +++   +V +  +    DKL    E    +E++M                           + VV    E  L + F +P++I+  K D      +E D +      I   +R  +  YG  L++ +  +E  ++ L   + H  +            K+ + IP+G D+   IG
Sbjct:   46 SGKNILVFGEDGSGKTTLMSK-LQGADHNKKGRGLEYLYLSVHDEDRDDLTRCNVWILDGDLYHKGLLKFAVTAQSLPDCLAVFVVDMSRPWTIMESLQKWASVLRDHV----DKLKIPPEDMREMEQRMVKAFQEYIEPEDGTPSSPRRATTSGEDEAVVLPLGENTLTHNFGIPVLIVCTKCDAVSVLEKEHDFRDEHFDFIQSHIRRFSLQYGAGLIYTSVKEEKNLDLLYKYILHKLYDFQFVTPALVVEKDAVFIPSGWDNEKKIG 311          
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Planmine SMEST
Match: SMESG000069411.1 (SMESG000069411.1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 347/350 (99.14%), Postives = 348/350 (99.43%), Query Frame = 2
Query:   29 MSVWDIGIQSLNNKEKNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQTEIADPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDLRQQAINDGIVAI 1078
            MSVW+IGIQSLNNKEKNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKSPEK LINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQTEIADPGKN QFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDLRQQAINDGIVAI
Sbjct:    1 MSVWEIGIQSLNNKEKNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNESIKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLRTITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEEKMKEVVGKSPEKYLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFLNHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIPAGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQTEIADPGKNPQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDLRQQAINDGIVAI 350          
The following BLAST results are available for this feature:
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNC2LI19.810e-8640.06dynein cytoplasmic 2 light intermediate chain 1 [S... [more]
DYNC2LI17.171e-8539.71dynein cytoplasmic 2 light intermediate chain 1 [S... [more]
DYNC2LI17.711e-8243.48dynein cytoplasmic 2 light intermediate chain 1 [S... [more]
DYNC2LI13.664e-3342.66dynein cytoplasmic 2 light intermediate chain 1 [S... [more]
DYNC2LI11.129e-2345.28dynein cytoplasmic 2 light intermediate chain 1 [S... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xbx-15.975e-4530.79X-BoX promoter element regulated [Source:UniProtK... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG37695.079e-3828.15gene:FBgn0032119 transcript:FBtr0079810[more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dync2li13.259e-8938.01dynein, cytoplasmic 2, light intermediate chain 1 ... [more]
dync2li13.259e-8938.01dynein, cytoplasmic 2, light intermediate chain 1 ... [more]
dync1li21.245e-722.68dynein, cytoplasmic 1, light intermediate chain 2 ... [more]
dync1li21.825e-722.68dynein, cytoplasmic 1, light intermediate chain 2 ... [more]
dync1li17.444e-724.06dynein, cytoplasmic 1, light intermediate chain 1 ... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000007798.13.489e-7438.31dynein, cytoplasmic 2, light intermediate chain 1 ... [more]
ENSXETT00000009585.14.900e-6338.04cytoplasmic dynein 2 light intermediate chain 1-li... [more]
ENSXETT00000009678.13.003e-5936.69cytoplasmic dynein 2 light intermediate chain 1-li... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dync2li11.896e-9140.17dynein cytoplasmic 2 light intermediate chain 1 [S... [more]
Dync1li21.465e-723.42dynein, cytoplasmic 1 light intermediate chain 2 [... [more]
Dync1li21.495e-723.42dynein, cytoplasmic 1 light intermediate chain 2 [... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K0T2|DC2L1_MOUSE1.326e-9040.17Cytoplasmic dynein 2 light intermediate chain 1 OS... [more]
sp|Q6AY43|DC2L1_RAT8.102e-9040.17Cytoplasmic dynein 2 light intermediate chain 1 OS... [more]
sp|Q7SXY4|DC2L1_DANRE3.818e-8938.60Cytoplasmic dynein 2 light intermediate chain 1 OS... [more]
sp|Q32KV4|DC2L1_BOVIN1.249e-8740.92Cytoplasmic dynein 2 light intermediate chain 1 OS... [more]
sp|Q8TCX1|DC2L1_HUMAN4.711e-8540.06Cytoplasmic dynein 2 light intermediate chain 1 OS... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IDT38.108e-10442.45cytoplasmic dynein 2 light intermediate chain 1 OS... [more]
A0A4S2LW401.296e-9543.01Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0B6ZXV41.481e-9241.59Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
V9KV964.229e-9240.46Cytoplasmic dynein 2 light intermediate chain 1-li... [more]
A0A4W3GVJ05.925e-9240.46Uncharacterized protein OS=Callorhinchus milii OX=... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dync2li13.418e-6936.71dynein, cytoplasmic 2, light intermediate chain 1 ... [more]
dync1li28.982e-621.64dynein cytoplasmic 1 light intermediate chain 2 [S... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009033.11.995e-1330.53pep scaffold:Pmarinus_7.0:GL477561:65577:67700:-1 ... [more]
dync1li19.922e-723.33dynein, cytoplasmic 1, light intermediate chain 1 ... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO469387.810e-9140.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459567.639e-1022.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dync2li15.539e-7734.83dynein cytoplasmic 2 light intermediate chain 1 [S... [more]
dync1li22.418e-622.51dynein cytoplasmic 1 light intermediate chain 2 [S... [more]
back to top
BLAST of cytoplasmic dynein 2 light intermediate chain 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000069411.10.000e+099.14SMESG000069411.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022372 ID=SMED30022372|Name=cytoplasmic dynein 2 light intermediate chain 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1096bp
ATTATCTTAGTTACAAGTTAGTAACAGTATGTCTGTGTGGGATATTGGTA
TTCAAAGTCTCAACAACAAAGAAAAAAATTTTTCTTTAAGTGAATCTGAT
ACGACATTGTTTTTTTTTGGTGAAAAGAGTTCAGGTAAATCTACCATTAT
ATCAAAATTTCTTGAAAAAAATGAGTCAATAAAACCAACAGTTGCATTGG
ATTATTGTTATGGACGTCAAACAAAAGGACATAATATTCCTAAATTTGTA
GCTCATATCTGGGAACTTGGAGGAGGAACTTGGCTACAGAAATTGATTGA
TGTTGCAATAACTCCAGATAATCTTAGAACTATTACCATAATTGTTGTGG
TTGATCTTTCTGAGCCTTGTTCAATATTTTCTACAATTGAAACTCTACTG
AACGTGGCAAAAGCCAGAATTAAATATATTCTCGATAAATTAAATGACGG
AGATGAAACAAGGTTATATCTTGAAGAGAAAATGAAAGAAGTAGTCGGAA
AGTCGCCTGAAAAAGATTTAATCAATGTTTTTCCGGTTCCATTAGTGATT
ATCGGTGGGAAATATGACAAATTTCAGGAAATAGATTTAAAGAGAAGAAC
TGTAATTTGCAAATCATTAAGATTCCTCAATCATTTCTATGGAGGATCTT
TGATGTTTTTCAATTCATCTCAAGAATTATTAGTGAATAGATTACGAATC
CTCTTGCGACATTATGCTTTTGGTTCATCAGCGAATAAAACAATGGAAAC
TTCATCTAAGAACCCAATTTCTATACCTGCGGGGTCAGATTCATTTGTAG
ACATTGGTGCTCCAGAATTCTGTAATGGCAGCCTTAATCAATTGCCGAGC
GAGAATCTGTTACAGTATTGGAAAAGAGCTTATTCTTCATTCTACCCGCC
CAAGGATTCTATACAAACTGAGATAGCTGATCCCGGCAAAAATCTCCAGT
TTGCTGAACCGTTGGTTGACGAAGCAAAGTTGCAGAAAGATGAAGATTTG
GAAAAATATAGGAAACTTAGTGATCGACGGATGAGGGATTTACGCCAACA
GGCAATCAACGATGGAATTGTTGCTATATAATTTAAAAGAGTTTTT
back to top

protein sequence of SMED30022372-orf-1

>SMED30022372-orf-1 ID=SMED30022372-orf-1|Name=SMED30022372-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=351bp
MSVWDIGIQSLNNKEKNFSLSESDTTLFFFGEKSSGKSTIISKFLEKNES
IKPTVALDYCYGRQTKGHNIPKFVAHIWELGGGTWLQKLIDVAITPDNLR
TITIIVVVDLSEPCSIFSTIETLLNVAKARIKYILDKLNDGDETRLYLEE
KMKEVVGKSPEKDLINVFPVPLVIIGGKYDKFQEIDLKRRTVICKSLRFL
NHFYGGSLMFFNSSQELLVNRLRILLRHYAFGSSANKTMETSSKNPISIP
AGSDSFVDIGAPEFCNGSLNQLPSENLLQYWKRAYSSFYPPKDSIQTEIA
DPGKNLQFAEPLVDEAKLQKDEDLEKYRKLSDRRMRDLRQQAINDGIVAI
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0035721intraciliary retrograde transport
GO:0007275multicellular organism development
GO:0007368determination of left/right symmetry
GO:0030030cell projection organization
GO:0035735intraciliary transport involved in cilium assembly
GO:0060271cilium morphogenesis
GO:1902017regulation of cilium assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040045DYNC2LI1
IPR022780Dynein_light_int_chain
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0008569ATP-dependent microtubule motor activity, minus-end-directed
GO:0045504dynein heavy chain binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005868cytoplasmic dynein complex
GO:0005874microtubule
GO:0005929cilium
GO:0005930axoneme
GO:0030286dynein complex
GO:0031514motile cilium
GO:0035869ciliary transition zone
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0045177apical part of cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 313..333
NoneNo IPR availableCDDcd00882Ras_like_GTPasecoord: 29..154
e-value: 4.86831E-4
score: 38.2064
IPR022780Dynein family light intermediate chainPFAMPF05783DLICcoord: 23..149
e-value: 4.6E-8
score: 32.3
IPR040045Cytoplasmic dynein 2 light intermediate chain 1PANTHERPTHR13236DYNEIN 2 LIGHT INTERMEDIATE CHAIN, ISOFORM 2coord: 2..339
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 26..213