leucine-rich repeat-containing protein 74B

Overview
Nameleucine-rich repeat-containing protein 74B
Smed IDSMED30022359
Uniprot Best hitLeucine-rich repeat-containing protein 74A OS=Homo sapiens OX=9606 GN=LRRC74A PE=2 SV=2 (E=1.32581e-36)
Length (bp)1603
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of leucine-rich repeat-containing protein 74B (SMED30022359) t-SNE clustered cells

Violin plots show distribution of expression levels for leucine-rich repeat-containing protein 74B (SMED30022359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of leucine-rich repeat-containing protein 74B (SMED30022359) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for leucine-rich repeat-containing protein 74B (SMED30022359) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022359

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30022359SMESG000008282.1 Contig46637newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022359SMESG000008282.1 Contig46637uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30022359SMESG000008282.1 dd_Smed_v4_10342_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30022359SMESG000008282.1 dd_Smed_v4_10342_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Human
Match: LRRC74A (leucine rich repeat containing 74A [Source:HGNC Symbol;Acc:HGNC:23346])

HSP 1 Score: 145.591 bits (366), Expect = 2.761e-37
Identity = 116/417 (27.82%), Postives = 208/417 (49.88%), Query Frame = 2
Query:  338 ELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFS--SLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWI-LSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDP------VDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAG-IPINDNQINQLIQYLDSDGDGEIDFSY 1555
            ELY   C+ +       FI+ ++        + + + H+GL  +G +AI  + ++  +   L L+DN I E  +  L+  L  N  + E+N+S+++L   G +I+S +   +S  I +L L  N+F ++   +L + +S N  ++ LDL+ N FS   G  L +M+  N  L  LDLSWN     GAV+L  GLR N  L +L L+ NGF +     L + L  N  L  L+I  N I + G + I K LE N +L++LK+  N I+   A   + + +      S +  LD  N++    F   ++ +  V P+    F        + +Q   P      +   ++ ++ Y + H I +V+ F+  +   +M ++ +EF++ + E   +P+N  Q+ ++I+ LD +  G ++FS+
Sbjct:   84 ELYLEACKLMGVVPVSYFIRNMEE-------SYVNLNHHGLGPRGTKAIAIALVSNMAVTKLELEDNCIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGARIISDFFERNSSSIWSLELSGNDFKEDSAALLCQALSTNYQIKKLDLSHNQFSDVGGEHLGQMLAINVGLTSLDLSWNNFHTRGAVALCNGLRGNVTLTKLDLSMNGFGNEVALALGEVLRLNRCLVYLDIGGNDIGNEGASKISKGLESNESLRVLKLFLNPINMDGAILLILAIKRNP--KSRMEELDISNVLVSEQFMKTLDGVYAVHPQLDVVF--------KAVQGLSPKKTIFLLTNPMKLIQSYADQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQVREVIKKLD-EKTGMVNFSF 482          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Human
Match: LRRC74B (leucine rich repeat containing 74B [Source:HGNC Symbol;Acc:HGNC:34301])

HSP 1 Score: 105.145 bits (261), Expect = 6.879e-24
Identity = 84/282 (29.79%), Postives = 145/282 (51.42%), Query Frame = 2
Query:  437 IEMAHYGLTDQGLRAIISSDITQ--FSSLNLKDN-IISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEF 1273
            + + H GL  QG RA+ SS  +      L+L+DN +    + A   +   ++ I +++LS++ L   G + L   +  ++ ++ + L  N  ++     L E +  +  L+ LDL+ N  +   G +L   + +N  L  L++SWN LR  GAV+ ++GL  N  LK L +++NGF D G   + ++L  N  LEEL ++ NRI+ +G  ++   L  N TL+IL +  N +        LKS +D    +S +  LDF +I     F  +  S++ +LPE 
Sbjct:   84 LNLRHRGLGPQGARALASSLSSNPYVKRLDLRDNGLCGAGAEALAGALSKSSSIHDVDLSENQLGVAGAQALCAALTVNQAMRKMQLSGNGLEEQAAQHLAELLLAHTDLKSLDLSYNQLNDQAGETLGPALAENTGLTELNVSWNHLRGPGAVAFARGLEANIFLKVLDISYNGFGDPGASAVGEALKANNVLEELNMSNNRISAMGALSLGLGLRVNQTLRILVVSRNPMRSEGCFGLLKSVQDN--PASALELLDFSDIQVNAEFDGLASSVRGILPEL 363          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 69.707 bits (169), Expect = 7.898e-12
Identity = 62/232 (26.72%), Postives = 112/232 (48.28%), Query Frame = 2
Query:  473 LRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRD 1165
            L +++S    +   ++L +N IS +    L  +L  N+ +T L+L  +++   G K L+  +  ++ + +L L+ N   D+    + E ++ NR+L +L L +N+        +   ++ N SL+ L  S N +   GA +L++ L+ N GL+ L L  N   D+G   L  +L  N+ L  L +  N I+  G   I  +L  N TLK L +  N +    A     + R+
Sbjct:  704 LGSVLSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRE 935          

HSP 2 Score: 67.0106 bits (162), Expect = 5.379e-11
Identity = 55/195 (28.21%), Postives = 98/195 (50.26%), Query Frame = 2
Query:  398 ILKRISAGSTITNIEMAHYGLTDQGLRAIISS--DITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTK 973
            I   + A ST+ N+++    L DQG RAI  +  +    +SL+L+ N I   +   L   L  N+ +T L+L ++ +   G   ++  +  +  +  LYL+  +   +   VL E ++ NR+L++LDL  N        +L   ++ N SL  L+L  N L ++GA+ ++  L  N+ L+ + L  N   DSG +
Sbjct:  901 IAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQHINLQGNHIGDSGAR 1095          

HSP 3 Score: 62.7734 bits (151), Expect = 1.275e-9
Identity = 66/243 (27.16%), Postives = 121/243 (49.79%), Query Frame = 2
Query:  425 TITNIEMAHYGLTDQGLRAI---ISSDITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAE 1141
            T+T++ +    + D G R++   ++S+ T  S L+L+ N I       +   L  N+ + EL  S +++   G K L+  +  ++ +++L L++N+  D     L   +  N++L  L L EN+ S     ++   +  N +L+ LDL+ N L  +GA +++  +R+N  L  L L WN  +    + L Q+L  N  L  L++  N I D G   + ++L+ N  L  L +   SI  S A+
Sbjct:  770 TLTSLSLQGNTVRDDGARSMAEALASNRT-LSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQ 1011          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Human
Match: NOD1 (nucleotide binding oligomerization domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16390])

HSP 1 Score: 69.3218 bits (168), Expect = 1.013e-11
Identity = 58/187 (31.02%), Postives = 95/187 (50.80%), Query Frame = 2
Query:  422 STITNIEMAHYGLTDQGLRAIISSDITQF---SSLNLKDNIISERSLAYLISTL-WTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGT 970
            S +T + ++   +TD G++ ++S ++T++   + L L +N I++    Y+   L     +T L L  + +T  G K L+  + +SK I  + +  N   D       E +  + SL  L LA N  ST  G SL + ++ N SLE+L L+ N+L  E A SL++ L+ N  LK L L  N     GT
Sbjct:  728 SRLTVLRLSVNQITDGGVK-VLSEELTKYKIVTYLGLYNNQITDVGARYVTKILDECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHPSLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKHLWLIQNQITAKGT 913          

HSP 2 Score: 51.6026 bits (122), Expect = 3.188e-6
Identity = 46/190 (24.21%), Postives = 89/190 (46.84%), Query Frame = 2
Query:  392 IKIL-KRISAGSTITNIEMAHYGLTDQGLRAI--ISSDITQFSSLNLKDNIISERSLAYL-ISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWN 949
            +K+L + ++    +T + + +  +TD G R +  I  +    + L L  N I+     YL ++   +  I+E+ +  + +   G K  +  + +   +  L L +N      G  L   +  N SL++L L +N  +     SL +M++ N +L+ L L  NQ+  +G   L+  L+ N G+  + LN N
Sbjct:  745 VKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKILDECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHPSLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKHLWLIQNQITAKGTAQLADALQSNTGITEICLNGN 934          

HSP 3 Score: 51.6026 bits (122), Expect = 3.952e-6
Identity = 56/195 (28.72%), Postives = 97/195 (49.74%), Query Frame = 2
Query:  581 NQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAA---EDALKS 1156
            +++T L LS + +T  G K+LS  +   K++  L L NN   D     + + +   + L  L L +N  ++  G  L   ++++ S+  + +  NQ+  EGA + ++ LR +  L  L L  NG    G K L+++L +N  LE L +  N + D    ++ + L+ N TLK L +  N I+        DAL+S
Sbjct:  728 SRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKILDECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHPSLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKHLWLIQNQITAKGTAQLADALQS 922          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 69.3218 bits (168), Expect = 1.139e-11
Identity = 62/232 (26.72%), Postives = 112/232 (48.28%), Query Frame = 2
Query:  473 LRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRD 1165
            L +++S    +   ++L +N IS +    L  +L  N+ +T L+L  +++   G K L+  +  ++ + +L L+ N   D+    + E ++ NR+L +L L +N+        +   ++ N SL+ L  S N +   GA +L++ L+ N GL+ L L  N   D+G   L  +L  N+ L  L +  N I+  G   I  +L  N TLK L +  N +    A     + R+
Sbjct:  657 LGSVLSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRE 888          

HSP 2 Score: 67.0106 bits (162), Expect = 5.887e-11
Identity = 55/195 (28.21%), Postives = 98/195 (50.26%), Query Frame = 2
Query:  398 ILKRISAGSTITNIEMAHYGLTDQGLRAIISS--DITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTK 973
            I   + A ST+ N+++    L DQG RAI  +  +    +SL+L+ N I   +   L   L  N+ +T L+L ++ +   G   ++  +  +  +  LYL+  +   +   VL E ++ NR+L++LDL  N        +L   ++ N SL  L+L  N L ++GA+ ++  L  N+ L+ + L  N   DSG +
Sbjct:  854 IAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQHINLQGNHIGDSGAR 1048          

HSP 3 Score: 62.3882 bits (150), Expect = 1.763e-9
Identity = 66/243 (27.16%), Postives = 121/243 (49.79%), Query Frame = 2
Query:  425 TITNIEMAHYGLTDQGLRAI---ISSDITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAE 1141
            T+T++ +    + D G R++   ++S+ T  S L+L+ N I       +   L  N+ + EL  S +++   G K L+  +  ++ +++L L++N+  D     L   +  N++L  L L EN+ S     ++   +  N +L+ LDL+ N L  +GA +++  +R+N  L  L L WN  +    + L Q+L  N  L  L++  N I D G   + ++L+ N  L  L +   SI  S A+
Sbjct:  723 TLTSLSLQGNTVRDDGARSMAEALASNRT-LSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQ 964          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 59.6918 bits (143), Expect = 4.495e-9
Identity = 80/311 (25.72%), Postives = 139/311 (44.69%), Query Frame = 2
Query:  287 TIDISKVFAKD----QLSNMCELYEGICERLECPSSKR-----FIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSS----LNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDN------DGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSF 1159
            TID    F  D     L  M E Y+  C RL    +K+     +  I + I    ++  + + +  L D+ + A+      Q S+    L+L++  +S ++L  LI  L  N  + EL L D+ L       +   I S+  ++ L LRNN+  D+      DG    E V  + SL  + L  NN +    +SL + + +N  +E L++  N L +EG   L   L  N+ L RL L   G    G   L++ + +N  L  ++I  N I   G   +  +++ N ++ +L I  + +  S+ +D  + +
Sbjct:  178 TIDFEYTFLDDDCAISLGEMIEFYDS-CVRLNLSFNKQIDMRGWTTIFRSIRHAVSLQMLNLRYTNLNDRSIPALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHREAVEKS-SLSAMVLWNNNVTGASMDSLAEALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGLQNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNIDASCVKLSSEKDEFERY 486          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 58.9214 bits (141), Expect = 7.881e-9
Identity = 80/311 (25.72%), Postives = 139/311 (44.69%), Query Frame = 2
Query:  287 TIDISKVFAKD----QLSNMCELYEGICERLECPSSKR-----FIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSS----LNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDN------DGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSF 1159
            TID    F  D     L  M E Y+  C RL    +K+     +  I + I    ++  + + +  L D+ + A+      Q S+    L+L++  +S ++L  LI  L  N  + EL L D+ L       +   I S+  ++ L LRNN+  D+      DG    E V  + SL  + L  NN +    +SL + + +N  +E L++  N L +EG   L   L  N+ L RL L   G    G   L++ + +N  L  ++I  N I   G   +  +++ N ++ +L I  + +  S+ +D  + +
Sbjct:  178 TIDFEYTFLDDDCAISLGEMIEFYDS-CVRLNLSFNKQIDMRGWTTIFRSIRHAVSLQMLNLRYTNLNDRSIPALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHREAVEKS-SLSAMVLWNNNVTGASMDSLAEALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGLQNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNIDASCVKLSSEKDEFERY 486          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 56.9954 bits (136), Expect = 3.210e-8
Identity = 80/313 (25.56%), Postives = 141/313 (45.05%), Query Frame = 2
Query:  287 TIDISKVFAKD----QLSNMCELYEGICERLECPSSKR-----FIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSS----LNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDN------DGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRD 1165
            TID    F  D     L  M E Y+  C RL    +K+     +  I + I    ++  + + +  L D+ + A+      Q S+    L+L++  +S ++L  LI  L  N  + EL L D+ L       +   I S+  ++ L LRNN+  D+      DG    E V  + SL  + L  NN +    +SL + + +N  +E L++  N L +EG   L   L  N+ L RL L   G    G   L++ + +N  L  ++I  N I   G   +  +++ N ++ +L I  + +  S+  + ++ ++D
Sbjct:  178 TIDFEYTFLDDDCAISLGEMIEFYDS-CVRLNLSFNKQIDMRGWTTIFRSIRHAVSLQMLNLRYTNLNDRSIPALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHREAVEKS-SLSAMVLWNNNVTGASMDSLAEALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGLQNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNIDASCVKLSS--EKVREYQD 486          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 56.6102 bits (135), Expect = 3.659e-8
Identity = 80/313 (25.56%), Postives = 141/313 (45.05%), Query Frame = 2
Query:  287 TIDISKVFAKD----QLSNMCELYEGICERLECPSSKR-----FIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSS----LNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDN------DGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRD 1165
            TID    F  D     L  M E Y+  C RL    +K+     +  I + I    ++  + + +  L D+ + A+      Q S+    L+L++  +S ++L  LI  L  N  + EL L D+ L       +   I S+  ++ L LRNN+  D+      DG    E V  + SL  + L  NN +    +SL + + +N  +E L++  N L +EG   L   L  N+ L RL L   G    G   L++ + +N  L  ++I  N I   G   +  +++ N ++ +L I  + +  S+  + ++ ++D
Sbjct:  178 TIDFEYTFLDDDCAISLGEMIEFYDS-CVRLNLSFNKQIDMRGWTTIFRSIRHAVSLQMLNLRYTNLNDRSIPALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHREAVEKS-SLSAMVLWNNNVTGASMDSLAEALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGLQNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNIDASCVKLSS--EKVREYQD 486          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Zebrafish
Match: lrrc74a (leucine rich repeat containing 74A [Source:ZFIN;Acc:ZDB-GENE-131127-263])

HSP 1 Score: 186.422 bits (472), Expect = 4.244e-53
Identity = 128/408 (31.37%), Postives = 215/408 (52.70%), Query Frame = 2
Query:  338 ELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQF--SSLNLKDNIISERSLAYLISTLWTN-QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSY-GKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDF 1549
            ELY   C+ +     + FI+ L           I + H+GL   G +A+  + +T    ++L L DN +      +L+  L  N  I  L+LSD+ L   G + ++  +L +  IK+L L  N F ++D     + +S N  ++ LDL+ N FS   G  L +MI +ND LEVLDLSWN LR++GAV+   GL+ N  LK L L+WNGF + G   L ++L  N  L+ L++  NRITD G   + K LE N TL++L++ +NS++   A   + + ++     S I  ++  N++   NF  +++   +  P  +  +G    +  K+  +  DP    ++ ++ Y++   + L + F   D D +M V   +FR+ ++++ IP+   QI +LIQ LD D  G +D+
Sbjct:    5 ELYLQACKLVGVIPVRYFIRNLG-------CATINLNHHGLGPLGGKALAIALVTDMHTTTLELADNCLRAEGATHLMEMLRANFTIHNLDLSDNQLQSAGAESVAKMLLENISIKSLKLSGNKFTEDDAKWFADALSSNYRVKELDLSHNEFSGRGGEHLGQMIANNDGLEVLDLSWNHLRMKGAVAFCAGLKVNTTLKHLDLSWNGFGNEGALALGEALKFNNTLQHLDLNNNRITDEGAGMLSKGLEANDTLRVLQLAYNSLTVEGALTLINTIKN--TPKSAIEDINICNVLVNENFVQLLDLTCQERPSLEVQYGGVGGFIAKKPRKRIDP----MKIIQDYLDQRKLRLWDFFRNIDKDGTMRVPVVDFRKAVQQSSIPLERFQIEELIQRLDRDRTGVVDY 399          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Zebrafish
Match: lrrc74b (leucine rich repeat containing 74B [Source:ZFIN;Acc:ZDB-GENE-141212-96])

HSP 1 Score: 117.857 bits (294), Expect = 3.362e-28
Identity = 91/276 (32.97%), Postives = 146/276 (52.90%), Query Frame = 2
Query:  431 TNIEMAHYGLTDQGLRAIISSDITQFS--SLNLKDNIISERSLAYLISTLWTN-QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVES 1249
            + + M H GL  QG +A+  S +T  S   LNL+DN +     A +   L  N  ITE++LSD+ + ++G + LS  +L +  + ++ L  N+ D+     L   +  N+ LQ LDL+ N  +   G  L   I +N  L+ L+L+WN +R +GA++ +KGL  N  L+ + L++NG    G   L ++L +N  LE+L I+ NRI   G  ++   L+ N TL+ILK+  N I  +     LKS +  S   S    LDF +I     F+++  S
Sbjct:  144 SEVNMMHCGLGAQGTKALAISLVTNTSILKLNLRDNWMEGAGAAAIADMLKENCYITEIDLSDNRMGEYGARALSSMLLENSTLFSVNLSGNHLDERAAKHLSPALISNQKLQHLDLSHNRLTDTAGEILGAAIAENTGLKALNLAWNCIRGKGAIAFAKGLEGNIFLRSVDLSYNGLGKDGALALEEALKQNNTLEDLNISNNRIPFEGAVHLALGLKVNTTLRILKMSRNPIQSAGCFAILKSVQ--SNPESAAEFLDFSDICVDQEFEDLFNS 417          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Zebrafish
Match: nlrc3 (NLR family, CARD domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-071119-1])

HSP 1 Score: 74.3294 bits (181), Expect = 1.794e-13
Identity = 67/253 (26.48%), Postives = 123/253 (48.62%), Query Frame = 2
Query:  464 DQGLRAIISSDITQ----FSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFK 1207
            D+G R++  S++ Q     ++LN++ N I    +  +   L  NQ + + N+S ++L   G   L+  ++ + V+  L L++N+  D     L   +  NR L  L+L EN+        + K ++ N  L  LDL+ N L  EG  ++++ +R N  +  L L WN  +    K L++SL  N  ++ L++  N + D G   +  +L  N +L +L +   S  +S A     +  D  + + T+ TLD +
Sbjct:  412 DEGARSL--SEVLQSNRKLTTLNVQKNGIGPEGMKKIAEGLIKNQTLQDFNVSSNHLGDLGTVALAQALMVNHVLHTLSLQSNSVSDRGIKALSHALQSNRGLCCLNLRENSIGVAGAKDIAKALKVNTCLRELDLTANLLHDEGVTAIAEAMRVNRSISSLHLQWNFMKAGAAKALAESLSSNTCIQLLDLQENALGDNGVIALAAALMSNSSLTVLYLQGVSAGKSGA----VALADAMVVNKTLHTLDLR 658          

HSP 2 Score: 60.077 bits (144), Expect = 4.308e-9
Identity = 50/195 (25.64%), Postives = 95/195 (48.72%), Query Frame = 2
Query:  398 ILKRISAGSTITNIEMAHYGLTDQGLRAIISSDIT--QFSSLNLKDNIISERSLAYLISTLWTNQITEL-NLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTK 973
            I K +   + +  +++    L D+G+ AI  +       SSL+L+ N +   +   L  +L +N   +L +L ++ L   G   L+  ++S+  +  LYL+  +   +    L + +  N++L  LDL  N+       +    +++N SL  L+L  N L ++GA+ ++  LR N+ L  + L  NG  +SG K
Sbjct:  530 IAKALKVNTCLRELDLTANLLHDEGVTAIAEAMRVNRSISSLHLQWNFMKAGAAKALAESLSSNTCIQLLDLQENALGDNGVIALAAALMSNSSLTVLYLQGVSAGKSGAVALADAMVVNKTLHTLDLRGNSIGMEGAKAFSSALKNNRSLRSLNLQENSLGMDGAIFIATALRGNHQLTYINLQGNGIGESGAK 724          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Zebrafish
Match: lrrc45 (leucine rich repeat containing 45 [Source:ZFIN;Acc:ZDB-GENE-121214-317])

HSP 1 Score: 58.151 bits (139), Expect = 1.829e-8
Identity = 46/153 (30.07%), Postives = 80/153 (52.29%), Query Frame = 2
Query:  500 TQFSSLNLKDNIISERSLAYLISTLWTNQITE-LNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDD-NDGCVLF-EGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWN 949
            T F+ + L D ++SE  +  L++ L +N   + L+L  +N+   G + L   ++ +KV++ L L  N      +G  +F EG++ + SL  LDL  N  +      L   ++ N +L+ LDL WN + L G  SL + +++N  L +L L  N
Sbjct:   62 TVFTEIILSDCMLSEEGVKMLLNGLCSNTTVKVLDLKGNNMRGTGAEALGQLLVRNKVLRRLVLEWNALGMWEEGFAVFCEGLASSTSLTQLDLRNNQINHQGAAELCVALKRNSNLQELDLRWNNMGLLGGRSLLEAMQQNRTLTKLELAGN 214          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Zebrafish
Match: lrrc45 (leucine rich repeat containing 45 [Source:ZFIN;Acc:ZDB-GENE-121214-317])

HSP 1 Score: 57.3806 bits (137), Expect = 2.811e-8
Identity = 46/153 (30.07%), Postives = 80/153 (52.29%), Query Frame = 2
Query:  500 TQFSSLNLKDNIISERSLAYLISTLWTNQITE-LNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDD-NDGCVLF-EGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWN 949
            T F+ + L D ++SE  +  L++ L +N   + L+L  +N+   G + L   ++ +KV++ L L  N      +G  +F EG++ + SL  LDL  N  +      L   ++ N +L+ LDL WN + L G  SL + +++N  L +L L  N
Sbjct:   57 TVFTEIILSDCMLSEEGVKMLLNGLCSNTTVKVLDLKGNNMRGTGAEALGQLLVRNKVLRRLVLEWNALGMWEEGFAVFCEGLASSTSLTQLDLRNNQINHQGAAELCVALKRNSNLQELDLRWNNMGLLGGRSLLEAMQQNRTLTKLELAGN 209          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Xenopus
Match: ENSXETT00000010017.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:141910231:141918723:1 gene:ENSXETG00000001685.1 transcript:ENSXETT00000010017.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 1.596e-24
Identity = 82/257 (31.91%), Postives = 132/257 (51.36%), Query Frame = 2
Query:  443 MAHYGLTDQGLRAIISSDIT--QFSSLNLKDNIISERSLAYLISTLWTN-QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDF 1204
            M H+GL  Q  +A+  + +T  +  +L+L DN +     A +   L  N  I+E++L+D+ L   G K LS  ++ +  ++ L L  N F D     + E    N+ ++  DL+ N F    G +L   I +N  +  L+LSWN  R +GA ++++GL  N  LK + L++NGF + G   L ++L  N  LE++ I+ NRI+  G       L+ N TL+ILKI  N +        LK+ +  S   S +  LDF
Sbjct:  109 MRHHGLGPQATKALAVTLVTNTRIVTLDLSDNWLGGEGAAAIAEMLKENCYISEIHLADNKLGVKGAKALSHMLVENTTLQKLNLSGNEFSDEAAQYISEAFMSNQKVECTDLSHNMFGEGSGETLGTAIAENTGMLELNLSWNNFRGKGAAAIARGLGANIFLKAIDLSYNGFGNDGAAALGEALKVNNVLEDINISNNRISVQGAVRFAMCLKANKTLRILKISRNPMQSEGCFAILKAIQANS--ESAMECLDF 363          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Xenopus
Match: tent2 (terminal nucleotidyltransferase 2 [Source:Xenbase;Acc:XB-GENE-1217408])

HSP 1 Score: 92.0485 bits (227), Expect = 5.311e-20
Identity = 65/181 (35.91%), Postives = 99/181 (54.70%), Query Frame = 2
Query:  590 TELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQ--------LLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKI 1108
            T + L    L   G + ++  +LS+K I +L L +N         L E +  N  +Q         LDL+ N F    G  L +++  N+ L+VL+LSWN + ++GA++LS GLR N  LK L L++NGF + G   L ++L  N  L +L+I CNRI + G   + K LE N TL++LK+
Sbjct:   60 TSMELKHHGLGPRGARAIAASLLSNKCITHLNLEDNWIQPEGASDLVEMLRKNYYIQDLANFRLTELDLSHNEFCEKGGEYLGQILASNEGLQVLNLSWNHICMKGAIALSAGLRANGMLKILNLSYNGFGNEGALALGEALRVNCSLIQLDITCNRINNEGVRLLCKGLEINETLRVLKV 240          

HSP 2 Score: 67.0106 bits (162), Expect = 1.538e-11
Identity = 59/210 (28.10%), Postives = 101/210 (48.10%), Query Frame = 2
Query:  338 ELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQ--FSSLNLKDNIISERSLAYLISTLWTN---------QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRL 934
            ELY   C+      +  F++ +         T++E+ H+GL  +G RAI +S ++    + LNL+DN I     + L+  L  N         ++TEL+LS +   + G + L   + S++ ++ L L  N+        L  G+  N  L++L+L+ N F      +L + +  N SL  LD++ N++  EG   L KGL  N  L+ L
Sbjct:   36 ELYVQACQEAGVVPASYFMRHMND-------TSMELKHHGLGPRGARAIAASLLSNKCITHLNLEDNWIQPEGASDLVEMLRKNYYIQDLANFRLTELDLSHNEFCEKGGEYLGQILASNEGLQVLNLSWNHICMKGAIALSAGLRANGMLKILNLSYNGFGNEGALALGEALRVNCSLIQLDITCNRINNEGVRLLCKGLEINETLRVL 238          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Xenopus
Match: NLRC3 (NLR family, CARD domain containing 3 [Source:NCBI gene;Acc:100158644])

HSP 1 Score: 62.3882 bits (150), Expect = 1.601e-9
Identity = 69/248 (27.82%), Postives = 117/248 (47.18%), Query Frame = 2
Query:  431 TNIEMAHYGLTD---QGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRL-------ILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAE 1141
            TN+ M + G  D   + L +I+ +       ++L +N +S R +  L   L  N+ +  L+L  +N+   G   L+  + S++V+ +L L+NN         L + +  NR L+ L+L EN+       +L + +  N +L  LDL+ N L  EG  +L++ LR+N  L+ L        L  N     G K L+ +L  N  L+ L +  N I   G   +  ++  N +L  L +  N I QS A+
Sbjct:  646 TNLRMENNGFQDVVMELLASILRAKDCAIQRISLAENRLSNRGVKALGRALMVNRTLAVLDLHSNNIGPSGAMALAEVLRSNQVLLSLNLQNNQIKSEGAQFLAQSLLANRKLRALNLRENSIGIEGAQALAESLRRNSTLLHLDLTANLLHDEGMEALARALRENQSLESLQRSMTIYSLRGNNIGLRGAKALAGALKINNTLQSLNLQENSIVLDGAICLANAVSGNSSLTSLSLQGNHIGQSGAK 893          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Xenopus
Match: pth2r (parathyroid hormone 2 receptor [Source:Xenbase;Acc:XB-GENE-1018413])

HSP 1 Score: 61.2326 bits (147), Expect = 2.694e-9
Identity = 54/209 (25.84%), Postives = 98/209 (46.89%), Query Frame = 2
Query:  341 LYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTD---QGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFD--DNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWN 949
            LY  +C+       +  +  +K I   +    ++++   ++    Q L  ++ +D+T F+ + L D +ISE  L   +  + +N  I  L+L  +NL   G + L  ++  +  + +L L  NN    +N      EG++ N+SLQ LDL  N  +      L   ++ N +L+ LDL WN + L G  ++      N  L +L L+ N
Sbjct:    7 LYVFMCQERGSEPQESVLSQMKEIRESTKRRQLDLSTQSISQESCQVLGILLQNDVT-FTQVLLSDCMISEDGLKAFLQGMQSNSVIKHLDLKGNNLQAKGGEALGKFLRHTASLTSLTLEWNNLGTWENGFSFFCEGLALNQSLQKLDLRNNQINHKGAEELAMALQRNSTLQELDLRWNNIGLLGGRAIQSCFESNKALVKLELSGN 214          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Xenopus
Match: pth2r (parathyroid hormone 2 receptor [Source:Xenbase;Acc:XB-GENE-1018413])

HSP 1 Score: 60.8474 bits (146), Expect = 3.542e-9
Identity = 54/209 (25.84%), Postives = 98/209 (46.89%), Query Frame = 2
Query:  341 LYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTD---QGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFD--DNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWN 949
            LY  +C+       +  +  +K I   +    ++++   ++    Q L  ++ +D+T F+ + L D +ISE  L   +  + +N  I  L+L  +NL   G + L  ++  +  + +L L  NN    +N      EG++ N+SLQ LDL  N  +      L   ++ N +L+ LDL WN + L G  ++      N  L +L L+ N
Sbjct:   41 LYVFMCQERGSEPQESVLSQMKEIRESTKRRQLDLSTQSISQESCQVLGILLQNDVT-FTQVLLSDCMISEDGLKAFLQGMQSNSVIKHLDLKGNNLQAKGGEALGKFLRHTASLTSLTLEWNNLGTWENGFSFFCEGLALNQSLQKLDLRNNQINHKGAEELAMALQRNSTLQELDLRWNNIGLLGGRAIQSCFESNKALVKLELSGN 248          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Mouse
Match: Lrrc74a (leucine rich repeat containing 74A [Source:MGI Symbol;Acc:MGI:3646959])

HSP 1 Score: 145.976 bits (367), Expect = 1.435e-37
Identity = 117/411 (28.47%), Postives = 207/411 (50.36%), Query Frame = 2
Query:  338 ELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWIL-SSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGL-KEAGIPINDNQINQLIQYLDSDGDGEIDFSY 1555
            ELY   C+ +    +  FI+ ++        + + + H+GL   G +AI  + +  T    L L DN I E  +  L+  L  N  + ELN+SD+NL   G +I+S ++  ++  +  L L  N+F +    +L + +S N  ++ L+L+ N FS   G  L +M+  N  L+ L+LSWN   + GAV+L  GLR N  LK+L ++ NGF + G   L  +L  N  L  ++++ N IT+ G + I K LE N  L++LK+  N +S   A   + + +      S +  +D  N++    F  V++ +  + P+      Y    G    +S       ++ ++ Y E   I++VE F   +    M++   +FR+ + +++ I IN  Q+ +LI+ LD +  G ++FS+
Sbjct:   69 ELYLEACKLVGVVPASYFIRNMEE-------SCVNLNHHGLGPMGTKAIAITLVSNTTVLKLELGDNCIQEEGIMSLMEMLHENYYLQELNVSDNNLGLEGARIISNFLQENNSSLWKLKLSGNSFKEECAALLCQALSSNYRIRSLNLSHNEFSDIGGEHLGQMLALNVGLQSLNLSWNHFNIRGAVALCNGLRSNVTLKKLDVSMNGFGNEGALALGDALRLNSCLVYVDVSRNGITNEGASKISKGLENNECLQVLKLFLNPLSLEGAYSLIMAIKRNP--KSRMEDIDISNVLVSEQFVKVLDGVCAIHPQLDVV--YKGLQGLSTKKSISLGTNPMRLIQSYTEQKKISVVEFFRSLNPTGLMTMPVGDFRKAMIQQSNILINRYQVRELIKKLD-EKKGMVNFSF 467          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Mouse
Match: Lrrc74a (leucine rich repeat containing 74A [Source:MGI Symbol;Acc:MGI:3646959])

HSP 1 Score: 145.206 bits (365), Expect = 2.252e-37
Identity = 118/419 (28.16%), Postives = 209/419 (49.88%), Query Frame = 2
Query:  338 ELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWIL-SSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGL-KEAGIPINDNQINQLIQYLDSDGDGEIDFSYWSGDSRTK 1579
            ELY   C+ +    +  FI+ ++        + + + H+GL   G +AI  + +  T    L L DN I E  +  L+  L  N  + ELN+SD+NL   G +I+S ++  ++  +  L L  N+F +    +L + +S N  ++ L+L+ N FS   G  L +M+  N  L+ L+LSWN   + GAV+L  GLR N  LK+L ++ NGF + G   L  +L  N  L  ++++ N IT+ G + I K LE N  L++LK+  N +S   A   + + +      S +  +D  N++    F  V++ +  + P+      Y    G    +S       ++ ++ Y E   I++VE F   +    M++   +FR+ + +++ I IN  Q+ +LI+ LD +  G ++FS    +  +K
Sbjct:   69 ELYLEACKLVGVVPASYFIRNMEE-------SCVNLNHHGLGPMGTKAIAITLVSNTTVLKLELGDNCIQEEGIMSLMEMLHENYYLQELNVSDNNLGLEGARIISNFLQENNSSLWKLKLSGNSFKEECAALLCQALSSNYRIRSLNLSHNEFSDIGGEHLGQMLALNVGLQSLNLSWNHFNIRGAVALCNGLRSNVTLKKLDVSMNGFGNEGALALGDALRLNSCLVYVDVSRNGITNEGASKISKGLENNECLQVLKLFLNPLSLEGAYSLIMAIKRNP--KSRMEDIDISNVLVSEQFVKVLDGVCAIHPQLDVV--YKGLQGLSTKKSISLGTNPMRLIQSYTEQKKISVVEFFRSLNPTGLMTMPVGDFRKAMIQQSNILINRYQVRELIKKLD-EKKGMVNFSSLEKEDLSK 475          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Mouse
Match: Lrrc74b (leucine rich repeat containing 74B [Source:MGI Symbol;Acc:MGI:1921935])

HSP 1 Score: 100.908 bits (250), Expect = 1.415e-22
Identity = 88/292 (30.14%), Postives = 143/292 (48.97%), Query Frame = 2
Query:  431 TNIEMAHYGLTDQGLRAIIS--SDITQFSSLNLKDNIISERSLAYLISTLWTNQI-TELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDS 1297
            + + + H GL  QG+RA+ S  +       L+L+DN +       L   L  N I ++++LS++ +   G + +   +  +  ++ + L+ N  ++     L   +  +R L+ LDL+ N  +   G  L   + +N  L  L+LSWN LR  GA + ++GL  N  LK L ++ NGF DSG   +  +L  N  LEEL +  NRI+  G   +   L+ N TL+IL I  N I        LKS R+   KSS +  LD  +I      +++  S+ ++LP   C   Y S
Sbjct:   80 SELNLRHRGLGPQGVRALASVLTSNPYIKRLDLRDNGLCGAGAEALADVLRKNSIISDVDLSENQIGAAGLQAICTALALNPTVEKMQLQGNRLEEQAAQHLAALLLHHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWNHLRGLGATAFARGLEANIFLKVLDISHNGFGDSGASAIGDALRVNNVLEELNMRNNRISVSGALKLGLGLQVNQTLRILIISKNPIRSDGCVGLLKSVRNN--KSSALELLDVSDIQVSRECEDLASSMSEILPGL-CIKRYTS 368          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Mouse
Match: Lrrc74b (leucine rich repeat containing 74B [Source:MGI Symbol;Acc:MGI:1921935])

HSP 1 Score: 83.1889 bits (204), Expect = 5.076e-17
Identity = 70/231 (30.30%), Postives = 117/231 (50.65%), Query Frame = 2
Query:  431 TNIEMAHYGLTDQGLRAIIS--SDITQFSSLNLKDNIISERSLAYLISTLWTNQI-TELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGW 1114
            + + + H GL  QG+RA+ S  +       L+L+DN +       L   L  N I ++++LS++ +   G + +   +  +  ++ + L+ N  ++     L   +  +R L+ LDL+ N  +   G  L   + +N  L  L+LSWN LR  GA + ++GL  N  LK L ++ NGF DSG   +  +L  N  LEEL +  NRI+  G   +   L+ N TL+IL + W
Sbjct:   80 SELNLRHRGLGPQGVRALASVLTSNPYIKRLDLRDNGLCGAGAEALADVLRKNSIISDVDLSENQIGAAGLQAICTALALNPTVEKMQLQGNRLEEQAAQHLAALLLHHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWNHLRGLGATAFARGLEANIFLKVLDISHNGFGDSGASAIGDALRVNNVLEELNMRNNRISVSGALKLGLGLQVNQTLRILIVCW 310          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Mouse
Match: Lrrc74b (leucine rich repeat containing 74B [Source:MGI Symbol;Acc:MGI:1921935])

HSP 1 Score: 80.8777 bits (198), Expect = 5.235e-16
Identity = 69/227 (30.40%), Postives = 115/227 (50.66%), Query Frame = 2
Query:  431 TNIEMAHYGLTDQGLRAIIS--SDITQFSSLNLKDNIISERSLAYLISTLWTNQI-TELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKIL 1102
            + + + H GL  QG+RA+ S  +       L+L+DN +       L   L  N I ++++LS++ +   G + +   +  +  ++ + L+ N  ++     L   +  +R L+ LDL+ N  +   G  L   + +N  L  L+LSWN LR  GA + ++GL  N  LK L ++ NGF DSG   +  +L  N  LEEL +  NRI+  G   +   L+ N TL+IL
Sbjct:   80 SELNLRHRGLGPQGVRALASVLTSNPYIKRLDLRDNGLCGAGAEALADVLRKNSIISDVDLSENQIGAAGLQAICTALALNPTVEKMQLQGNRLEEQAAQHLAALLLHHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWNHLRGLGATAFARGLEANIFLKVLDISHNGFGDSGASAIGDALRVNNVLEELNMRNNRISVSGALKLGLGLQVNQTLRIL 306          
BLAST of leucine-rich repeat-containing protein 74B vs. UniProt
Match: sp|Q0VAA2|LR74A_HUMAN (Leucine-rich repeat-containing protein 74A OS=Homo sapiens OX=9606 GN=LRRC74A PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 1.326e-36
Identity = 116/417 (27.82%), Postives = 208/417 (49.88%), Query Frame = 2
Query:  338 ELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFS--SLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWI-LSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDP------VDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAG-IPINDNQINQLIQYLDSDGDGEIDFSY 1555
            ELY   C+ +       FI+ ++        + + + H+GL  +G +AI  + ++  +   L L+DN I E  +  L+  L  N  + E+N+S+++L   G +I+S +   +S  I +L L  N+F ++   +L + +S N  ++ LDL+ N FS   G  L +M+  N  L  LDLSWN     GAV+L  GLR N  L +L L+ NGF +     L + L  N  L  L+I  N I + G + I K LE N +L++LK+  N I+   A   + + +      S +  LD  N++    F   ++ +  V P+    F        + +Q   P      +   ++ ++ Y + H I +V+ F+  +   +M ++ +EF++ + E   +P+N  Q+ ++I+ LD +  G ++FS+
Sbjct:   84 ELYLEACKLMGVVPVSYFIRNMEE-------SYVNLNHHGLGPRGTKAIAIALVSNMAVTKLELEDNCIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGARIISDFFERNSSSIWSLELSGNDFKEDSAALLCQALSTNYQIKKLDLSHNQFSDVGGEHLGQMLAINVGLTSLDLSWNNFHTRGAVALCNGLRGNVTLTKLDLSMNGFGNEVALALGEVLRLNRCLVYLDIGGNDIGNEGASKISKGLESNESLRVLKLFLNPINMDGAILLILAIKRNP--KSRMEELDISNVLVSEQFMKTLDGVYAVHPQLDVVF--------KAVQGLSPKKTIFLLTNPMKLIQSYADQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQVREVIKKLD-EKTGMVNFSF 482          
BLAST of leucine-rich repeat-containing protein 74B vs. UniProt
Match: sp|A0JPI9|LR74A_RAT (Leucine-rich repeat-containing protein 74A OS=Rattus norvegicus OX=10116 GN=Lrrc74a PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.348e-36
Identity = 118/422 (27.96%), Postives = 213/422 (50.47%), Query Frame = 2
Query:  338 ELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWIL-SSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREG-LKEAGIPINDNQINQLIQYLDSDGDGEIDFSYWSGDSRTKRGK 1588
            ELY   C+ +       FI+ ++        + + + H+GL   G++AI  + +  T    L L+DN I E  +  L+  L  N  + ELN+SD+NL   G +I+S ++  ++  +  L L  N F +    +L + +S N  ++ L+L+ N FS   G  L +M+  N  L+ L+LSWN   + GAV+L  GLR N  LK+L ++ NGF + G   L  +L  N  L  ++++ N IT+ G + I K LE N  L++LK+  N +S   A   + + +      S +  LD  N++    F  V++ +  + P+    +        +K  S +     ++ ++ Y + + I++VE F+  +    M++   +FR+  +++  IPIN  Q  +LI+ L+ + +G ++FS +     T  G+
Sbjct:   69 ELYLEACKLVGVVPVSYFIRNMEE-------SCMNLNHHGLGPMGIKAIAITLVSNTTVLKLELEDNSIQEEGILSLMEMLHENYYLQELNVSDNNLGLEGARIISDFLQENNSSLWKLKLSGNKFKEECALLLCQALSSNYRIRSLNLSHNEFSDTAGEYLGQMLALNVGLQSLNLSWNHFNVRGAVALCNGLRTNVTLKKLDVSMNGFGNDGALALGDTLKLNSCLVYVDVSRNGITNEGASRISKGLENNECLQVLKLFLNPVSLEGAYSLILAIKRNP--KSRMEDLDISNVLVSEQFVKVLDGVCAIHPQLDVVYKGLQGLSTKKTVSLET--NPIKLIQNYTDQNKISVVEFFKSLNPSGLMTMPVGDFRKAIIQQTNIPINRYQARELIKKLE-EKNGMVNFSGFKSLKVTAAGQ 478          
BLAST of leucine-rich repeat-containing protein 74B vs. UniProt
Match: sp|Q6ZQY2|LR74B_HUMAN (Leucine-rich repeat-containing protein 74B OS=Homo sapiens OX=9606 GN=LRRC74B PE=2 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 3.304e-23
Identity = 84/282 (29.79%), Postives = 145/282 (51.42%), Query Frame = 2
Query:  437 IEMAHYGLTDQGLRAIISSDITQ--FSSLNLKDN-IISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEF 1273
            + + H GL  QG RA+ SS  +      L+L+DN +    + A   +   ++ I +++LS++ L   G + L   +  ++ ++ + L  N  ++     L E +  +  L+ LDL+ N  +   G +L   + +N  L  L++SWN LR  GAV+ ++GL  N  LK L +++NGF D G   + ++L  N  LEEL ++ NRI+ +G  ++   L  N TL+IL +  N +        LKS +D    +S +  LDF +I     F  +  S++ +LPE 
Sbjct:   84 LNLRHRGLGPQGARALASSLSSNPYVKRLDLRDNGLCGAGAEALAGALSKSSSIHDVDLSENQLGVAGAQALCAALTVNQAMRKMQLSGNGLEEQAAQHLAELLLAHTDLKSLDLSYNQLNDQAGETLGPALAENTGLTELNVSWNHLRGPGAVAFARGLEANIFLKVLDISYNGFGDPGASAVGEALKANNVLEELNMSNNRISAMGALSLGLGLRVNQTLRILVVSRNPMRSEGCFGLLKSVQDN--PASALELLDFSDIQVNAEFDGLASSVRGILPEL 363          
BLAST of leucine-rich repeat-containing protein 74B vs. UniProt
Match: sp|Q14BP6|LR74B_MOUSE (Leucine-rich repeat-containing protein 74B OS=Mus musculus OX=10090 GN=Lrrc74b PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.901e-22
Identity = 88/292 (30.14%), Postives = 143/292 (48.97%), Query Frame = 2
Query:  431 TNIEMAHYGLTDQGLRAIIS--SDITQFSSLNLKDNIISERSLAYLISTLWTNQI-TELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDS 1297
            + + + H GL  QG+RA+ S  +       L+L+DN +       L   L  N I ++++LS++ +   G + +   +  +  ++ + L+ N  ++     L   +  +R L+ LDL+ N  +   G  L   + +N  L  L+LSWN LR  GA + ++GL  N  LK L ++ NGF DSG   +  +L  N  LEEL +  NRI+  G   +   L+ N TL+IL I  N I        LKS R+   KSS +  LD  +I      +++  S+ ++LP   C   Y S
Sbjct:   80 SELNLRHRGLGPQGVRALASVLTSNPYIKRLDLRDNGLCGAGAEALADVLRKNSIISDVDLSENQIGAAGLQAICTALALNPTVEKMQLQGNRLEEQAAQHLAALLLHHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWNHLRGLGATAFARGLEANIFLKVLDISHNGFGDSGASAIGDALRVNNVLEELNMRNNRISVSGALKLGLGLQVNQTLRILIISKNPIRSDGCVGLLKSVRNN--KSSALELLDVSDIQVSRECEDLASSMSEILPGL-CIKRYTS 368          
BLAST of leucine-rich repeat-containing protein 74B vs. UniProt
Match: sp|Q9Y239|NOD1_HUMAN (Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 4.863e-11
Identity = 58/187 (31.02%), Postives = 95/187 (50.80%), Query Frame = 2
Query:  422 STITNIEMAHYGLTDQGLRAIISSDITQF---SSLNLKDNIISERSLAYLISTL-WTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGT 970
            S +T + ++   +TD G++ ++S ++T++   + L L +N I++    Y+   L     +T L L  + +T  G K L+  + +SK I  + +  N   D       E +  + SL  L LA N  ST  G SL + ++ N SLE+L L+ N+L  E A SL++ L+ N  LK L L  N     GT
Sbjct:  728 SRLTVLRLSVNQITDGGVK-VLSEELTKYKIVTYLGLYNNQITDVGARYVTKILDECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHPSLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKHLWLIQNQITAKGT 913          
BLAST of leucine-rich repeat-containing protein 74B vs. TrEMBL
Match: gnl|BL_ORD_ID|20308501 (tr|A0A1S3K3B1|A0A1S3K3B1_LINUN leucine-rich repeat-containing protein 74B OS=Lingula unguis OX=7574 GN=LOC106178473 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 5.218e-76
Identity = 155/406 (38.18%), Postives = 239/406 (58.87%), Query Frame = 2
Query:  344 YEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTNQI-TELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            YE  C + + P +  F + L+          ++M +YG+  +G  A+    +  T+ + LNL+ N +    +  +   +  N I T+L+LS+++++    KI++  ++ ++ I+ L L  N   D D  VL   V  + SL  L+L+ NNF    G   +KMIE N  LE LDLSWNQ+R +GA+++ +G+++NN LK L ++WNG  + G   + Q+L  +  + EL+I+ NRI D GF  ++KSL  N TLK LK+G N I++ A    L+  ++  + S  +  L+    I+ +     +E + +    F C  GY  SYGKRKL+++D V+EA+ F+K YI  H++NLVELF  FD D SMSVTY+EF+EGLK A IP+   Q+  LIQ LD+DGDGEIDF 
Sbjct:   70 YENACIKFKIPQANTFHRKLEHAK------EVDMKYYGIGPKGALALAIPLVINTKVTKLNLRGNSLGVEGVDNICRMMEENSIITDLDLSENDVSGRATKIIAQMLVVNQTIQRLTLEENGLTDQDAKVLVGPVEDHSSLIYLNLSHNNFGIQSGILFQKMIE-NGMLEELDLSWNQIRGDGALAICRGVKENNSLKILNMSWNGLAEEGAISMGQALQASRTMTELDISSNRINDQGFLILIKSLRDNDTLKTLKVGQNPITEDAVLAGLEVLKE--IDSLKLEVLELIENIYTSRVDEKIEEVHEKHENFTCNHGYAHSYGKRKLKAFDVVEEAMTFLKNYIAEHNMNLVELFASFDQDGSMSVTYDEFKEGLKMARIPMTALQVEYLIQGLDADGDGEIDFG 466          
BLAST of leucine-rich repeat-containing protein 74B vs. TrEMBL
Match: gnl|BL_ORD_ID|22471536 (tr|X2ATT6|X2ATT6_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 1.050e-73
Identity = 152/406 (37.44%), Postives = 234/406 (57.64%), Query Frame = 2
Query:  344 YEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            YE  C + +   S RF + L   S+      +++ HY L  +G  A+    +  T+ SSLNLKDN ++E  + ++   +  N  +TELNLS +N+   G  +++  +  +  +K+L +  NNF D D  VL + +  + +L+ L+L  N F +  G   K +I +N +L+ LDL WNQ+R++GA  L++G+++N  LK L L WNGF D G K L+++L          I+ NRI   GF  ++K L +N  LK LKI  N + ++AA   +      ++    +  L+  +I F + F+  V SL +  PEF+C  GY  SYGK+  + +D V +ALQ M+ Y   H +N+VELF +FD D SMSVT++EF+ G+KEAGI + +  +  LI  LD DGDGEIDFS
Sbjct:  103 YEKACSKFKALLSSRFHRKLAEDSS------VDLKHYNLGSKGAMALSIPLVINTRISSLNLKDNNLNEEGVVWIGRMMAENTTVTELNLSHNNIGSHGALVMAEVLRQNIRLKSLDISGNNFTDGDAKVLTKPIEEHPNLRYLNLGSNCFGSEAGVLFKDLIAENATLQELDLRWNQIRMKGAQELARGMKENVSLKSLHLGWNGFSDDGAKALAEALKTCPLSYLD-ISANRIGSEGFLAMIKILGQNEDLKELKISGNPVGEAAALAGMDLLL--AMPELHLDELEMVDISFGSAFKRKVASLAEPHPEFKCLHGYLDSYGKKVRKKFDMVAQALQAMQEYCNKHSMNIVELFSRFDADGSMSVTHDEFKLGIKEAGINVTEEHVTCLINALDEDGDGEIDFS 499          
BLAST of leucine-rich repeat-containing protein 74B vs. TrEMBL
Match: gnl|BL_ORD_ID|23531715 (tr|A0A210Q7P6|A0A210Q7P6_MIZYE Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08008 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.622e-67
Identity = 150/408 (36.76%), Postives = 243/408 (59.56%), Query Frame = 2
Query:  344 YEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIED-NDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQ-SYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            YE  C++     S  F++ L          +I++ +YGL  +G+ A+  + +  +  +SL LK N I    + Y+   +  N  IT+L+LS+++L  +G K++   +  +KV++ L L  N F D D   L + +  + SL+ +DL+ N F    G   +KM+ D N +L  LDLSWNQ RL GA  L+ G+++N  LK L ++WNG +D G K+   ++  N  +E ++++C RI   GFA ILK L+ N TL+ L+IG N+I + AA  A++ F    ++S+ +  LD  ++I   +FQ+ V+ L++     +  FGY   YGKRK+  S D  ++AL  +K Y++ H++ + ELF +FD D S SV Y+EFREG+KEA I + D Q+++LI ++D DGDG++DFS
Sbjct:   79 YERACKKYGVTPSSLFLRNLAE-------KDIDLTNYGLGPKGVMAVSVALVVNSTVTSLVLKGNCIDNAGVLYIQQMMTENMSITDLDLSENSLGTYGAKVMGLMLRENKVVRYLNLSGNQFTDQDAIYLTKQIQDHSSLEHVDLSHNEFGDVSGPEFEKMMSDANRALLALDLSWNQFRLIGAKHLATGMKENAYLKYLNVSWNGLDDGGGKDFGDAIGNNNVIEVIDLSCCRIGPEGFAGILKGLKNNDTLQELRIGKNNIPEDAANAAVEMF--DQMESTALTMLDMTDVILGPHFQDRVDELKEKHEGLEIKFGYGDMYGKRKMAGSVDVGEDALLTIKEYMDRHNLTISELFARFDDDGSNSVDYDEFREGIKEAKIDLTDFQVDKLITFIDMDGDGDLDFS 477          
BLAST of leucine-rich repeat-containing protein 74B vs. TrEMBL
Match: gnl|BL_ORD_ID|21134408 (tr|A0A2T7NPI2|A0A2T7NPI2_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16346 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 5.756e-64
Identity = 143/437 (32.72%), Postives = 235/437 (53.78%), Query Frame = 2
Query:  263 ETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQF-----SSLNLKDNIISERSLAYLISTLWTNQ--ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            ET +DT  +I    V  K         YE  C ++    ++  ++ L +  A      +++ HYGL   G R++I   +        + +NL+ N +    +A + + +  N   I  +    +NL   G   ++  I ++K ++ L +  N F D D   L   V  +  L +L+L+ N F          MI +N  LE L+LSWN  R++GA  L  GL +N  LK   ++WNG ED GT+ +  +L +N  L+ +++  NRI+  GF  +LK+L  N  L+ +++G N+IS   A+ A+   +  ++++  +  LD  +II  ++ + ++E L+++ P+ Q  +GY  SYGK K++SYD V EAL  M+ + + + I LVE+F +FD D S S+T  EF EGLKEA IP+    +++LI+ LD DGD EIDFS
Sbjct:   72 ETLLDTSESIPPYDVTGKTT-------YERACVKVGVTPARCLLRKLDKGRA------LDLKHYGL---GPRSVIPVTMALMINRCITEINLRGNCLGASGMACIQTMMEDNNTIIHIVQPGANNLRSEGATHVARMIGTNKTLRVLDISENGFVDADAVCLARAVENHSRLTVLNLSHNAFGDPSAACFSHMIAENGVLEDLNLSWNHFRVKGAQELGDGLAENESLKSFNMSWNGAEDKGTEAVGMALNQNSTLQHIDLTSNRISSKGFLTLLKALPHNEALRSIRVGRNNISTEGAKVAVAFLK--TIRNLALHLLDLSDIILNSSIKPLLEELKQMHPDLQISYGYTDSYGKHKMRSYDMVAEALSTMQSFCQENKIQLVEMFARFDADGSTSLTREEFNEGLKEAKIPLTTQHVDKLIEELDKDGDKEIDFS 490          
BLAST of leucine-rich repeat-containing protein 74B vs. TrEMBL
Match: gnl|BL_ORD_ID|17570485 (tr|A0A3M7RJC2|A0A3M7RJC2_BRAPC Leucine-rich repeat-containing 74B-like OS=Brachionus plicatilis OX=10195 GN=BpHYR1_044988 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 2.252e-54
Identity = 137/377 (36.34%), Postives = 213/377 (56.50%), Query Frame = 2
Query:  434 NIEMAHYGLTDQGLRAIISSDITQ--FSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSY 1555
            N+ M H+GL   G+R + ++ +     S L+L DN +      ++   L  N  IT+LNLSD+N +  G + L   + ++  I +L +R N F+D    V  E +S    ++ LDL+ NNF    G  L   I +N S++ L+LSWN +R +GAV+++KGL  N+ +K L + WNGF   G K L +SL ENE LEE +++ NRI   G   I KSL  N TL+ILK+G N +  +     +K+ +  +  ++ I  +DF  II    F++  ++ Q V P  Q   G D    K K++  +P+ +    ++ +IE +HI L++ F KFD D SMSVT  EF+ G+ E G+     +I+QL+  LD DGDGEI++ +
Sbjct:  230 NLSMKHHGLGAPGMRPVSAALMNNSIVSKLDLSDNWLGPEGAHHISKMLKENCFITDLNLSDNNFSSNGCEALRDVLRANNSITHLTMRGNKFNDASATVWAEIISNTIKIEFLDLSHNNFGEESGKILGPAIAENISIKTLNLSWNNIRRKGAVAIAKGLGANSVIKSLDVGWNGFSQDGCKALLKSLKENETLEEFDLSNNRIATEGAVYIAKSLIVNQTLRILKLGLNPMESAGCFSIIKALQKNT--NTKIELIDFSEIIVDKYFKDEFKNFQTVFPHIQIKTGCDGVKLKPKIK-INPIIK----LRNFIEKNHIKLIDFFNKFDKDGSMSVTREEFQVGILELGVRFTQEEIDQLVNELDPDGDGEINYRF 599          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Cavefish
Match: lrrc74a (leucine rich repeat containing 74A [Source:NCBI gene;Acc:103039030])

HSP 1 Score: 182.185 bits (461), Expect = 8.809e-50
Identity = 123/409 (30.07%), Postives = 217/409 (53.06%), Query Frame = 2
Query:  335 CELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSS--LNLKDNIISERSLAYLISTLWTN-QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSY-GKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDF 1549
             ELY   C+ +       F++ L           I + H+GL   G +A+  + +T   +  L L DN +      YL+  L  N  I  L+LS+++L   G + ++  +L +  IK++ L  N F ++D     E  S N  ++ LDL+ N FS   G  L +M+ +N+ +E+LDLSWN LR++GAV+   GL+ N  LK+L L+WNGF + G   L ++L  N  L +L+++ NRIT+ G   + + LE N TL+ LK+ +NS++   A   ++  ++     + I  ++  N++   NF  ++E   +  P  +  +G    +  K+  +  DP    ++ ++ Y++   + L + F   D D +M V  +EFR+ ++++ IP++  QI +LIQ LD +G G +D+
Sbjct:   49 AELYLQACKLVGVIPVSYFLRNLG-------CATINLNHHGLGPLGGKALAIALVTDMHTTRLELADNFLLGEGARYLVEMLRANFTIQNLDLSNNHLQSAGAECVAKMLLDNISIKSIKLSGNGFIEDDAKWFAEAFSSNYRVKELDLSHNQFSGKGGEYLGQMLANNEGIELLDLSWNHLRMKGAVAFCAGLKVNVTLKQLDLSWNGFGNEGALALGEALKFNNTLVDLDLSNNRITNEGVGMLCRGLEANDTLRTLKLAYNSLTVEGALALIRVVKN--TPKTAIEEINICNVLVNENFVQLLELTCQEHPSLEVQYGGVGGFIAKKPPKRADP----MKVIQDYLDERKLRLWDFFRNIDKDGTMRVPVSEFRKAVQQSSIPLDRFQIEELIQRLDREGTGSVDY 444          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 73.559 bits (179), Expect = 2.472e-13
Identity = 63/230 (27.39%), Postives = 118/230 (51.30%), Query Frame = 2
Query:  428 ITNIEMAHYGLTDQGLRAIISSDITQ----FSSLNLKDNIISERSLAYLISTLWTNQITE-LNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKIL 1102
            I +I +    + D+G RA+  +++ Q     +SLN++ N I    +  +  +L  NQI + LN+S ++L   G   L+  ++ +  +  L L++N+  D     L   +  NR L  L+L EN+       ++ + +++N +L  LDL+ N L  EG  +++  ++ N  L+ L L WN  +    K L+QSL  N  ++ L++  N + D G   +  +L+ N +L +L
Sbjct:  541 IVSINLQSNSIEDEGARAL--AEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLTANLLHDEGVTAIAGSVKVNRALRSLHLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVL 768          

HSP 2 Score: 51.2174 bits (121), Expect = 2.797e-6
Identity = 53/195 (27.18%), Postives = 93/195 (47.69%), Query Frame = 2
Query:  398 ILKRISAGSTITNIEMAHYGLTDQGLRAIISSDIT--QFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTK 973
            I + +   ST+  +++    L D+G+ AI  S        SL+L+ N +   +   L  +L +N  I  L+L ++ L   G   L+  + ++  +  LYL+  +        L E +  N++L  LDL  N+       +L   ++ N SL  L+L  N L ++GA+ ++  LR N+ L  + L  NG  +SG K
Sbjct:  671 IARALQENSTLRELDLTANLLHDEGVTAIAGSVKVNRALRSLHLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQGVSAGKAGAEALAEALMVNQTLCTLDLRGNSIGMGGAKALSSALKTNRSLRSLNLQENSLGMDGAIFIATALRGNHQLTYINLQGNGIGESGAK 865          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 69.707 bits (169), Expect = 4.907e-12
Identity = 50/185 (27.03%), Postives = 95/185 (51.35%), Query Frame = 2
Query:  428 ITNIEMAHYGLTDQGLRAIISSDITQ----FSSLNLKDNIISERSLAYLISTLWTNQITE-LNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSG 967
            I +I +    + D+G RA+  +++ Q     +SLN++ N I    +  +  +L  NQI + LN+S ++L   G   L+  ++ +  +  L L++N+  D     L   +  NR L  L+L EN+       ++ + +++N +L  LDL WN +++  A +L++ L  N+ ++ L L  N   D G
Sbjct:  541 IVSINLQSNSIEDEGARAL--AEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEG 723          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Cavefish
Match: carmil2 (capping protein regulator and myosin 1 linker 2 [Source:ZFIN;Acc:ZDB-GENE-050419-197])

HSP 1 Score: 58.9214 bits (141), Expect = 1.131e-8
Identity = 78/323 (24.15%), Postives = 143/323 (44.27%), Query Frame = 2
Query:  503 QFSSLNLKDNIISERSLAYLISTLWTNQ---ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAEN-----NFSTFCGNSLKKMIEDND----SLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQS------AAEDALKSFRDGSLKSSTIRTL-----------DFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQS-YDPVDEALQFMKVYIETHH 1381
            +   + L +  +   +L  L+  L TN      EL++S   L   G +++   I  +K I +L L +N F+ ND   L   +  ++S++ L +  N        T   + +  MI++ D    SL V D   N     G   L   L  ++ L ++ ++ N   D+G K L++ L  N  L  L    N +T VGF ++  +LE+N TL+ + I  + ++Q+        E+A++  ++  L+ ++ RT              K        Q+V + LQ+ +    C       Y  +++QS     +EALQ  ++ I++ H
Sbjct:  397 ELKYVGLANTKLPPEALRLLLQGLATNSHLSELELDISSCELRSSGAQVIQEHIFETKAIGSLNLSDNGFE-NDMVTLVLSIGRSKSIRHLAIGRNFPRKSRALTDVLHRIVHMIQEEDCPLESLSVCDSKLNT----GTTILINSLGSSSALSKIDISGNCIGDTGAKMLAKVLTINTKLRTLVWDRNNVTAVGFMDVANALERNNTLQHMSIPMSDMAQAYRSNPEKTEEAMQKIQE-CLRRNSQRTCTSPDEMLSLQQSLKTSHSEQQVQHVCQKLQETMRPLSC-------YNIQEVQSDILSAEEALQHARIAIKSLH 706          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Cavefish
Match: lrrc45 (leucine rich repeat containing 45 [Source:NCBI gene;Acc:103038066])

HSP 1 Score: 54.6842 bits (130), Expect = 1.729e-7
Identity = 54/208 (25.96%), Postives = 96/208 (46.15%), Query Frame = 2
Query:  344 YEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI---TQFSSLNLKDNIISERSLAYLISTLWTNQITE-LNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDD-NDGCVLF-EGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWN 949
            Y  +C+       +  +  L+   A +  T ++++   LT +   A++   +   T F+ L L D ++SE      +S L +N   + L+L  +NL   G + L   ++ +K ++ L L  N      +G  +F EG++ N  L  LDL  N  +      L   ++ N  L+ LDL WN + L G  +L   L++N  L +L +  N
Sbjct:    8 YMQLCKEAGVEPQESVLAQLQGTRAAAGGTRLDLSGQSLTVESC-AVLGRTLQKDTLFTELGLSDCMLSEEGAKLFLSGLCSNTTVKVLDLKGNNLRGAGAEALGKLLVRNKTLRRLVLEWNALGMWEEGFSIFCEGLASNSCLTQLDLRNNQINHQGAAELALALKRNSVLQELDLRWNNIGLLGGRALMDALQQNRSLLQLEMAGN 214          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002444.1 (pep scaffold:Pmarinus_7.0:GL480979:320698:340261:-1 gene:ENSPMAG00000002230.1 transcript:ENSPMAT00000002444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 3.666e-34
Identity = 95/353 (26.91%), Postives = 168/353 (47.59%), Query Frame = 2
Query:  500 TQFSSLNLKDNIISERSLAYLISTLWTN-QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSY 1555
            T  + L+L DN + E    +L   L  N  I ELN+S + +   G   L   +  +  I +L L  NN  D     L   +S NRSL+ LD++ N         +  MI ++++LE LDL+W+  R  G+V+++  +  N  ++ L L W G    G   L ++L  N  L  L+++  R+ + G   +   L+ NV L+ LK+  N I    A   L + +    K ST++ L+  N++    F  ++ +++   P            G R+  ++ P    +Q ++ ++  + + L + F   D   +MSVT + FR  +++   P+ +  + +LI  LD DG G I++ Y
Sbjct:    2 TVVTKLDLSDNWLQEEGCRHLSRMLKENCYIEELNVSSNRMGVGGAMALCSALRENSTITSLNLSGNNLTDEAARHLHNAMSVNRSLKELDMSHNRIGDAGAMHVAHMIANSETLETLDLAWSLWRWNGSVAIAAAISVNRSVRWLSLAWTGVGIEGALALREALQRNRTLHHLDLSSCRVDERGARALAAGLQTNVALRSLKLALNPIMAEGALALLSAIQKN--KRSTMQDLNISNVVVNEQFVQLLSAMRAERPRAMHVRHGGVGSGLRR--TFQPRVSPMQAIQGHLLKNKLRLWDFFRNMDKSGTMSVTQDVFRSAMQQLSTPLEEQALEELISALDRDGSGWINYRY 350          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Sea Lamprey
Match: lrrc74a (leucine rich repeat containing 74A [Source:ZFIN;Acc:ZDB-GENE-131127-263])

HSP 1 Score: 124.79 bits (312), Expect = 1.824e-32
Identity = 77/270 (28.52%), Postives = 144/270 (53.33%), Query Frame = 2
Query:  746 NRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSY 1555
            N S++ LDL+ N FS   G  L +++  N++LE L+LSWN LRL+GAV+L  GLR N  L  L L+ NG  + G   ++++L  N  L  L++  NRI + G   + + L  N +L++L++ +N  +   A   +K+ +    + S +  LD   +     F + V ++++       + G      ++     DP    ++ ++ Y+  H + L + F   D + +M ++ ++FR  ++   IP++ + +++L+  L+ D DG ID+SY
Sbjct:   13 NYSVKELDLSHNEFSEMGGEHLGQLLAHNETLEELELSWNHLRLKGAVALCAGLRVNYALTHLHLSVNGLGNEGALAMAEALKFNGALLHLDLRNNRIGNTGMEALARGLLTNDSLRVLQLCFNIFTVEGALVLIKAVKVN--EHSALERLDMSTVRVNQGFLHTVSAIRRTQGLTVLHSGVGGPLARKPKPRTDP----MKLIQDYLVEHKLRLWDFFRSADKEGTMKISSDDFRRAVQHLSIPLDKHHLDELMLKLERDKDGRIDYSY 276          

HSP 2 Score: 46.9802 bits (110), Expect = 5.604e-6
Identity = 43/143 (30.07%), Postives = 68/143 (47.55%), Query Frame = 2
Query:  515 LNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKN--NGLKRL 934
            L+L  N  SE    +L   L  N+ + EL LS ++L   G   L   +  +  + +L+L  N   +     + E +  N +L  LDL  N        +L + +  NDSL VL L +N   +EGA+ L K ++ N  + L+RL
Sbjct:   19 LDLSHNEFSEMGGEHLGQLLAHNETLEELELSWNHLRLKGAVALCAGLRVNYALTHLHLSVNGLGNEGALAMAEALKFNGALLHLDLRNNRIGNTGMEALARGLLTNDSLRVLQLCFNIFTVEGALVLIKAVKVNEHSALERL 161          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Sea Lamprey
Match: lrrc74a (leucine rich repeat containing 74A [Source:ZFIN;Acc:ZDB-GENE-131127-263])

HSP 1 Score: 120.168 bits (300), Expect = 6.957e-31
Identity = 75/271 (27.68%), Postives = 143/271 (52.77%), Query Frame = 2
Query:  737 VSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDF 1549
            +  N S++ LDL+ N FS   G  L +++  N++LE L+LSWN LRL+GAV+L  GLR N  L  L L+ NG  + G   ++++L  N  L  L++  NRI + G   + + L  N +L++L++ +N  +   A   +K+ +    + S +  LD   +     F + V ++++       + G      ++     DP    ++ ++ Y+  H + L + F   D + +M ++ ++FR  ++   IP++ + +++L+  L+ D DG ID+
Sbjct:   10 LQSNYSVKELDLSHNEFSEMGGEHLGQLLAHNETLEELELSWNHLRLKGAVALCAGLRVNYALTHLHLSVNGLGNEGALAMAEALKFNGALLHLDLRNNRIGNTGMEALARGLLTNDSLRVLQLCFNIFTVEGALVLIKAVKVN--EHSALERLDMSTVRVNQGFLHTVSAIRRTQGLTVLHSGVGGPLARKPKPRTDP----MKLIQDYLVEHKLRLWDFFRSADKEGTMKISSDDFRRAVQHLSIPLDKHHLDELMLKLERDKDGRIDY 274          

HSP 2 Score: 46.595 bits (109), Expect = 7.483e-6
Identity = 43/143 (30.07%), Postives = 68/143 (47.55%), Query Frame = 2
Query:  515 LNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKN--NGLKRL 934
            L+L  N  SE    +L   L  N+ + EL LS ++L   G   L   +  +  + +L+L  N   +     + E +  N +L  LDL  N        +L + +  NDSL VL L +N   +EGA+ L K ++ N  + L+RL
Sbjct:   19 LDLSHNEFSEMGGEHLGQLLAHNETLEELELSWNHLRLKGAVALCAGLRVNYALTHLHLSVNGLGNEGALAMAEALKFNGALLHLDLRNNRIGNTGMEALARGLLTNDSLRVLQLCFNIFTVEGALVLIKAVKVNEHSALERL 161          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Sea Lamprey
Match: lrrc34 (leucine rich repeat containing 34 [Source:ZFIN;Acc:ZDB-GENE-091118-73])

HSP 1 Score: 47.7506 bits (112), Expect = 3.725e-6
Identity = 41/146 (28.08%), Postives = 72/146 (49.32%), Query Frame = 2
Query:  746 NRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXX--XXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLK 1177
            NR+L+ L LA++    F    L + +  N SL  LDLS N +  +GA SL+  L++ + L+ L L +N   D+G   L++++  +       L +  N  T  G   +  ++  N TL+ + I  N + + A +   +  + G LK
Sbjct:  143 NRALRTLRLAKHGVRDFGARRLSEALASNSSLTHLDLSCNLMARDGAASLALLLKQGSSLRVLDLGFNRIGDAGVTALARAVGSSGRSPLHTLVLVSNGATGEGLRELAVAMTTNRTLRSVHIWGNKLDRVACQVFAELLKSGRLK 288          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Nematostella
Match: EDO31006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ62])

HSP 1 Score: 194.126 bits (492), Expect = 3.592e-55
Identity = 135/391 (34.53%), Postives = 208/391 (53.20%), Query Frame = 2
Query:  425 TITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTN-QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEF--QCYFGYDSSYGKRKLQSYDPVD-------EALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSYWS 1561
            T   +++ H+GL   G +AI+++ +  T  +SLN++D  I       +   L  N  ITEL+++ + L   G    +  I  + V+ +L L  N F+++D     E +  N +L+ LDL+ N F    G  L   I+ ND LE L+LSWN LR  GA++ +KGLR N  L+ L L+WNGF D G   + +SL +N  L EL+++ NRIT  G   + + L+ N TLK+LKIG N I    A   L + R+ +     +  +   N++      +++E + +  P F   C     S     +L +    D       E +  +K Y+E  +  LV+LF +FD D S+SVT +EF  GLK  G+P++D  +  LI  LD DGDGEIDFS ++
Sbjct:  150 TTKAVDIKHHGLGPSGAKAIVTALMNNTTIASLNIRDCGIGSDGGVEVAKLLKENCYITELDVAQNKLKTSGACAFAEVIQDNNVVTSLNLAWNEFNNHDAARFAEALRTNHTLKRLDLSRNKFEEQAGIYLGPAIDANDGLEYLNLSWNHLRGPGAIAFAKGLRANCSLQVLDLSWNGFADEGAHAVGESLKDNNTLLELDLSYNRITCKGALALAEGLKINNTLKVLKIGMNMIQNKGANALLDAMRNNA--ECAMEKVYLNNVVIDVETNHLIEQILETRPNFVVACTKSKRSGDVMNQLNAMFSGDTKKKKILELINMLKEYVERMNYRLVDLFNQFDKDNSLSVTRDEFYTGLKGIGVPMSDKDLTMLIDLLDEDGDGEIDFSEFT 538          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Nematostella
Match: EDO36360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU1])

HSP 1 Score: 187.963 bits (476), Expect = 5.289e-54
Identity = 137/407 (33.66%), Postives = 205/407 (50.37%), Query Frame = 2
Query:  386 RFIKILKRISAGSTITNIE-----MAHYGLTDQGLRAIISS--DITQFSSLNLKDNIISERSLAYLISTLWTN-QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYD------PVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSYWSG 1564
            R  K L      S + NIE     +AH+GL  +G  A+  +    T    L+L++N + E         L  N  ITELNL+ + ++  G K +   I  S  I+ L L  NNF D DG  L +G++   +L+ L L+ N+FS   G  L   I  N S+E LDLSWN LR++GA+++ K + +N  ++ L L+WNGF D G   +  +L  N  L+EL+++ NRIT  G   + K L  N  L++LKIG+N          LK+ R+ +   S +  L   NI         ++   K  P FQ   G   +  +  +   D        ++ L  +K Y+    +  V+LF   D D+S SV+  E  EGLK A IP+ D+Q+ +LI  LD DGDG ID+S ++ 
Sbjct:   19 RACKTLNVTPISSLLQNIENKEISLAHHGLGPRGAMALARALAKSTTVEKLDLEENRLQEEGAESFAKMLKDNCYITELNLAGNAMSSRGAKAMGEIIGYSNYIRKLDLSFNNFIDKDGEALSKGLAATLTLKELRLSHNSFSESGGELLAPGIAANYSVEYLDLSWNHLRMKGAIAICKAMGENASIRVLDLSWNGFADDGAAAMGNALRHNSTLKELDLSHNRITKKGAFALSKGLAVNDALRVLKIGFNPFESDGTMALLKAMRNNA--KSAMEELHLNNITVGKGVLEFLDEYMKHNPNFQITLGVSPTDRREAMDDDDKNGKMKSKNQLLTILKEYLIEKRLRAVDLFNCLDKDKSRSVSPEELIEGLKRARIPLTDSQLKRLITLLDKDGDGMIDYSEFAA 423          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Nematostella
Match: EDO31618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXE5])

HSP 1 Score: 184.882 bits (468), Expect = 3.649e-53
Identity = 132/407 (32.43%), Postives = 206/407 (50.61%), Query Frame = 2
Query:  341 LYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTN-QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            +Y   C  L       F++ L +         + + HY L  +G  A+  + +  T+  +LN+ +N I E    Y+   L  N  ITEL++S++NL   G   +S  +  +  I  + L  N F + D   + E +  N +L+ L+L+ N F    G  L   ++ N  LE L+L WNQ+R +GAV++  GLR N  LK L L+WNGF D G K + ++L  N  L EL+I+ NRI+  G ++I   L KN TL+IL+IG N      A+D L +       +S I  L F +I   + F++ +E +    P      G  +  GK +++     D  L  +  YIE   + +V+ F + D D S  +T  EF  G+K+ GIP+   Q+ +L+  LD D DG ID+S
Sbjct:    4 VYLKACSSLGLVPCSPFLRQLHK-------PEMNLMHYNLGPRGAEAVAVALMQNTKVLTLNISNNDIQEEGAIYISKMLTENFYITELDISNNNLQSQGAYAVSEMLRQNSEILEVNLSENKFIEKDVEPIVEAMKDNYTLKSLNLSRNAFCEIGGQLLGPALDANVGLEYLNLRWNQIRRKGAVAIGYGLRHNCSLKSLDLSWNGFADDGAKSVGEALALNTTLTELDISSNRISGEGASSIAAGLAKNETLQILRIGINPFLSQGAQDILSAVHQNP--NSAIEELGFDDIPVNSEFEDFLEEVMDARPNLSVQCGA-AMRGKDRVKKIKQRD-VLNLLLEYIELRGLRMVDFFRQLDKDNSKKITRAEFMAGVKKTGIPMTRRQLKKLVNILDVDNDGNIDYS 399          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Nematostella
Match: EDO36359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU0])

HSP 1 Score: 159.844 bits (403), Expect = 4.091e-43
Identity = 120/407 (29.48%), Postives = 212/407 (52.09%), Query Frame = 2
Query:  341 LYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            LY   C +L    +  F++ +       T   + M H+GL   G++AI  + +  T  + LN++DN I E     +   L  N  ITEL++S++ +   G   ++  +  +  +  L +  N+  D +  +L   +  N ++  +DL+ N FS      +  +++++ SLE LDLSWN ++++GA  ++KGL  N  LK L L WNG    G   L++SL  N  L EL+++ NR+ D G     ++L+ N +L+ L    N+I+++ A   L +    S   ST+  +D    I +++F ++VE L+ V PE            + +  + DP       ++ Y+   H+ +V+LF + D DQSM V+  EF EGL+++ + +   ++ ++I+ LD D DGEID+S
Sbjct:   78 LYLRACNKLGIVPASYFVRHM-------TNPEMTMMHHGLGPVGVQAISLALLYNTTITVLNIRDNGIGEEGGEIIAKLLRENYYITELDISENQVGARGTLEIAETLKMNNTLTKLGMAGNDLSDKEAALLCSALLVNSTVTRIDLSGNKFSNKACEYIGALLDESYSLEYLDLSWNHIQVKGAQRIAKGLEGNMKLKTLKLAWNGVATDGAIALAKSLEGNTTLVELDLSSNRVGDEGAIAFARTLKNNSSLESLYAAKNNITENGACSLLNAVMQSS--GSTMIKIDLTGAILKDDFHSLVEELKIVKPEMVVVTDI-CPEPRSRADTPDPS----TLLRNYLAREHVRVVDLFRRLDKDQSMQVSVREFVEGLRKSDVGLTAFEVEKIIESLDVDDDGEIDYS 470          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Nematostella
Match: EDO31478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXT1])

HSP 1 Score: 151.754 bits (382), Expect = 8.854e-41
Identity = 117/381 (30.71%), Postives = 191/381 (50.13%), Query Frame = 2
Query:  437 IEMAHYGLTDQGLRAIISSDI--TQFSSLNLKDNIISERSLAYLISTLWTN-QITEL-------NLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDF 1549
            +++ H+GL   G +AI  + +  T    LNL DN +     +Y+   L  N  IT+L       ++S++ L   G + ++  +L +  I  L    N FD+    +L E +  N  L+ L L+ N F    G  L   +  N+++  L+LSWN LR  GA +++  L++N  LK L L WNGF + G   + ++L  N  L EL++  NRIT  G   + K L  N TL++LKIG N +  + A   L + ++     S +  ++  +I   N+F  +   +    P  +   G   S G        P    ++ +K YI  + + L++ F   D D+SMS+T  EF +GLKE GI +N  ++  LI+ LD + DGEI++
Sbjct:   35 VDIKHHGLGAMGSKAIAIALVSNTSVVKLNLSDNWMGPEGASYVAEMLRENCYITDLLCEVLSDDMSENKLGDHGSESIADVLLHNPNIHRLTANGNGFDEKAAKILAEAIKLNNRLKYLCLSHNKFGEKAGLELAPALAANETISELNLSWNHLRNRGACAIALSLKENITLKILNLAWNGFGNDGALAMGEALKVNASLLELDLTNNRITAEGAVLLGKGLTINTTLQVLKIGKNPMQSAGAYAILNAMKNNP--ESALVEVELSDITVNNDFLQLCGEVIAARPNVKITHG--GSGGALHKPKGRPA--PMKILKNYISDNRMRLLDFFNTLDKDKSMSLTIKEFVDGLKETGIDMNYVELFNLIETLDKNKDGEINY 409          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Medaka
Match: lrrc74a (leucine rich repeat containing 74A [Source:ZFIN;Acc:ZDB-GENE-131127-263])

HSP 1 Score: 138.272 bits (347), Expect = 8.603e-36
Identity = 124/406 (30.54%), Postives = 213/406 (52.46%), Query Frame = 2
Query:  338 ELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISS-DITQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYF-GYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEID 1546
            E+Y   C RLE     R I +   +    T T + + H GL   G +AI+++   TQ   L+L  N I      YL+  L  N  I  L+LS+++L   G + ++  +  +  +K++ L ++ F D+D   L + +S N  L+ LDL+ N F    G  L +++ +N+ LEVLDLSWN LR++GAV+ S GL+ N  LK L L+WNGF + G   + ++L  N  L  L +  NR+T+ G + + + LE N T   L++ +NS++    E AL       +K++    LD  ++    NF +++E  ++  P  + ++ G      K+  +  DP    ++ ++ Y++   + L + F   D D +M V   +FR  ++++ IP++  Q+ +LIQ LD    G +D
Sbjct:    1 EVYMQAC-RLE-----RVIPVSHFVRNVGTAT-MTLNHCGLGPLGCKAIVTALGDTQIRILDLAGNYIQAEGSRYLMQLLRFNSTIEHLDLSNNHLKSDGAEWVAKILSDNISLKSIKL-SSRFIDDDAKHLADALSMNSRLKELDLSHNEFCGKGGEYLGQLL-NNEGLEVLDLSWNHLRMKGAVAFSAGLKVNTMLKHLDLSWNGFGNDGALAIGEALKFNNTLVHLNLNNNRLTNEGVSMLCRGLEYNDT---LQLAYNSLT---VEGALVLVN--IVKNTPKTALDEIDLCVNQNFVHLLEVTRQEHPGLKVHYRGVGGFIAKKPQKRIDP----MKVVQDYLDKRKLRLWDFFRNIDKDGTMQVPVTDFRRAIQQSSIPLDGYQVEELIQRLDRGRTGMVD 385          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 65.855 bits (159), Expect = 8.646e-11
Identity = 66/266 (24.81%), Postives = 136/266 (51.13%), Query Frame = 2
Query:  425 TITNIEMAHYGLTDQGLRAIISSDITQ----FSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFK 1207
             +T+I   +  + ++G +A+  +++ Q      SLN++ N I       +   L  NQ +T+L L  + L   G   L+  +  ++ + +L L++N+  +     L + +  N  L  L+L EN+       ++ + +++N+SL+ LDL+ N L  EG  ++S  ++ N GL  L L WN  + + TK L+ +L+ N  ++ L++  N I + G   + ++L+ N +L+ L +   S   S A     +  +  +++ +++TLD +
Sbjct:  791 VLTSINFQNNSIEEEGAQAL--AEVLQCNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGA----VALAEALMENQSLQTLDLR 1050          

HSP 2 Score: 64.3142 bits (155), Expect = 2.157e-10
Identity = 54/194 (27.84%), Postives = 100/194 (51.55%), Query Frame = 2
Query:  584 QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRD 1165
             I +L+L+D+ ++  G K LS  +L ++ +  L LRNNN        L E +  N+ L  ++   N+       +L ++++ N  L  L++  N++  +GA  ++  L+ N  L +LIL  N   D GT  L+++L  N+ L  L++  N I++ G   + K+L  N  L  L +  NSI    A++  ++ ++
Sbjct:  735 HIQKLSLADNAISNKGAKALSRALLVNRTLTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKE 928          

HSP 3 Score: 55.0694 bits (131), Expect = 1.508e-7
Identity = 45/153 (29.41%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  515 LNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGT 970
            L+L  N++ +  +  + + +  NQ +T L+L  + +     K+L+  ++S+  IK L L+ N   +     L E +  N SLQ L L   +  T    +L + + +N SL+ LDL  N + +EGA +L+  L+ N  LK L L  N     G 
Sbjct:  935 LDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMENQSLQTLDLRGNSIGMEGAKALANALKCNRSLKSLNLQENSLGMDGA 1087          

HSP 4 Score: 50.447 bits (119), Expect = 4.797e-6
Identity = 46/171 (26.90%), Postives = 88/171 (51.46%), Query Frame = 2
Query:  425 TITNIEMAHYGLTDQGLRAIISSDI---TQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGL 925
            ++ N+++    L D+G++AI S+ I      +SL+L+ N I   +   L + L +N  I  L+L ++ +   G   L+  +  +  ++ L L+  +   +    L E +  N+SLQ LDL  N+       +L   ++ N SL+ L+L  N L ++GA+ ++  L+ N+ L
Sbjct:  931 SLQNLDLTANLLHDEGVQAI-SAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMENQSLQTLDLRGNSIGMEGAKALANALKCNRSLKSLNLQENSLGMDGAIFIATALKGNHQL 1100          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 65.855 bits (159), Expect = 8.646e-11
Identity = 66/266 (24.81%), Postives = 136/266 (51.13%), Query Frame = 2
Query:  425 TITNIEMAHYGLTDQGLRAIISSDITQ----FSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFK 1207
             +T+I   +  + ++G +A+  +++ Q      SLN++ N I       +   L  NQ +T+L L  + L   G   L+  +  ++ + +L L++N+  +     L + +  N  L  L+L EN+       ++ + +++N+SL+ LDL+ N L  EG  ++S  ++ N GL  L L WN  + + TK L+ +L+ N  ++ L++  N I + G   + ++L+ N +L+ L +   S   S A     +  +  +++ +++TLD +
Sbjct:  791 VLTSINFQNNSIEEEGAQAL--AEVLQCNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGA----VALAEALMENQSLQTLDLR 1050          

HSP 2 Score: 64.3142 bits (155), Expect = 2.157e-10
Identity = 54/194 (27.84%), Postives = 100/194 (51.55%), Query Frame = 2
Query:  584 QITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRD 1165
             I +L+L+D+ ++  G K LS  +L ++ +  L LRNNN        L E +  N+ L  ++   N+       +L ++++ N  L  L++  N++  +GA  ++  L+ N  L +LIL  N   D GT  L+++L  N+ L  L++  N I++ G   + K+L  N  L  L +  NSI    A++  ++ ++
Sbjct:  735 HIQKLSLADNAISNKGAKALSRALLVNRTLTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKE 928          

HSP 3 Score: 55.0694 bits (131), Expect = 1.508e-7
Identity = 45/153 (29.41%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  515 LNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGT 970
            L+L  N++ +  +  + + +  NQ +T L+L  + +     K+L+  ++S+  IK L L+ N   +     L E +  N SLQ L L   +  T    +L + + +N SL+ LDL  N + +EGA +L+  L+ N  LK L L  N     G 
Sbjct:  935 LDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMENQSLQTLDLRGNSIGMEGAKALANALKCNRSLKSLNLQENSLGMDGA 1087          

HSP 4 Score: 50.447 bits (119), Expect = 4.797e-6
Identity = 46/171 (26.90%), Postives = 88/171 (51.46%), Query Frame = 2
Query:  425 TITNIEMAHYGLTDQGLRAIISSDI---TQFSSLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGL 925
            ++ N+++    L D+G++AI S+ I      +SL+L+ N I   +   L + L +N  I  L+L ++ +   G   L+  +  +  ++ L L+  +   +    L E +  N+SLQ LDL  N+       +L   ++ N SL+ L+L  N L ++GA+ ++  L+ N+ L
Sbjct:  931 SLQNLDLTANLLHDEGVQAI-SAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMENQSLQTLDLRGNSIGMEGAKALANALKCNRSLKSLNLQENSLGMDGAIFIATALKGNHQL 1100          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Medaka
Match: lrrc45 (leucine rich repeat containing 45 [Source:NCBI gene;Acc:101174918])

HSP 1 Score: 53.5286 bits (127), Expect = 3.959e-7
Identity = 47/158 (29.75%), Postives = 78/158 (49.37%), Query Frame = 2
Query:  497 ITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLA-------ENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWN 949
            + + S L+L    +S  + + L   L     T+++LSD  L++ G KIL   +  +  +K+L ++ NN       VL + ++ N++L  L L        E  FS FC       +  N++L  LDL  NQ+   GA +L+  LR++  L+ L L WN
Sbjct:   27 LQEGSRLDLSGQSLSADTCSVLARALQDGAFTQVSLSDCMLSEEGAKILLSGLFGNTTVKSLDMKGNNLRSAGAEVLGKLLARNKTLCRLVLEWNALGVWEEAFSAFCDG-----LGSNNTLTHLDLRNNQISHHGAAALALALRRSGSLEELDLRWN 179          
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Medaka
Match: lrrc34 (leucine rich repeat containing 34 [Source:NCBI gene;Acc:101175273])

HSP 1 Score: 52.7582 bits (125), Expect = 5.619e-7
Identity = 61/217 (28.11%), Postives = 108/217 (49.77%), Query Frame = 2
Query:  503 QFSSLNLKDNIISERSLAYLISTLW--TNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQL---RLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAA 1138
            + + L++  N IS+    +L   L   ++ +  L+L  +N+   G + L+  + S+  + +L L  N F D  G  +   +  N +LQ+L L++ N +     +L   +  N +L+ LD+S   L   + E AV  S+ L  N  L  L L   G  DSG + L++ L  N  L  L++ CNR+T  G  ++ + L+++ TL+I+ +  N I    A
Sbjct:  120 RVTGLDVSYNNISDGGAKHLADALQLSSSALKFLDLKFNNIQADGAEFLANSLKSNSSLLSLSLSGNRFGDRGGVSMSRMLQVNSTLQMLQLSDCNLADRSVAALGAALNRNTALQALDISRPLLFSRQEEWAVHFSQMLTVNCSLLELHLGRMGLTDSGMETLAEGLTRNRSLRYLDLRCNRVTRDGAHHLAEVLKQSKTLEIIDLSSNRIEDEGA 336          
BLAST of leucine-rich repeat-containing protein 74B vs. Planmine SMEST
Match: SMESG000008282.1 (SMESG000008282.1)

HSP 1 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 499/502 (99.40%), Postives = 502/502 (100.00%), Query Frame = 2
Query:   86 MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFESLTDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSYWSGDSRTKRGKT 1591
            MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFESLTDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQSLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFR+GSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEAL+FMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSYWSG+SRTKRGKT
Sbjct:    1 MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFESLTDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQSLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFREGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALRFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSYWSGNSRTKRGKT 502          
BLAST of leucine-rich repeat-containing protein 74B vs. Planmine SMEST
Match: SMESG000008282.1 (SMESG000008282.1)

HSP 1 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 487/489 (99.59%), Postives = 489/489 (100.00%), Query Frame = 2
Query:   86 MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFESLTDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFESLTDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQSLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFR+GSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEAL+FMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS
Sbjct:    1 MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFESLTDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQSLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFREGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALRFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 489          
BLAST of leucine-rich repeat-containing protein 74B vs. Planmine SMEST
Match: SMESG000008282.1 (SMESG000008282.1)

HSP 1 Score: 941.028 bits (2431), Expect = 0.000e+0
Identity = 486/509 (95.48%), Postives = 488/509 (95.87%), Query Frame = 2
Query:   86 MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFESL--------------------TDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFE L                    TDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQSLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFR+GSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEAL+FMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS
Sbjct:    1 MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFEKLISFAGINNLFWYFISQQIYLTDHPLTEVEPNSIPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQSLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFREGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALRFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 509          
BLAST of leucine-rich repeat-containing protein 74B vs. Planmine SMEST
Match: SMESG000008282.1 (SMESG000008282.1)

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 405/407 (99.51%), Postives = 407/407 (100.00%), Query Frame = 2
Query:  332 MCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            MCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQSLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFR+GSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEAL+FMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS
Sbjct:    1 MCELYEGICERLECPSSKRFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNIISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQSLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFREGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYGKRKLQSYDPVDEALRFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 407          
BLAST of leucine-rich repeat-containing protein 74B vs. Planmine SMEST
Match: SMESG000073508.1 (SMESG000073508.1)

HSP 1 Score: 127.487 bits (319), Expect = 3.866e-32
Identity = 117/382 (30.63%), Postives = 188/382 (49.21%), Query Frame = 2
Query:  437 IEMAHYGLTDQGLRAIISSDITQFS--SLNLKDNIISERSLAYLISTLWTNQ-ITELNLSDSNLTKFGPKILSPWILSSKVIKNLYLRNNNFDDNDGCV-LFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDNDSLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKXXXXXXXXXXXXXXXXIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSAAEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYFGYDSSYG------KRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSVTYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFS 1552
            + + H+GL   G +A+  S  + FS  +L+L  N I       +   L  N  I++L L D+ +   G       +  ++ +K+L +  N   D+ GC+ L + +  ++ L  L L+ NN  +     L   I  ND LE LDLSWNQ+R EGAV ++KGL+ N  +K   L++NGF   G   L+ +L +N  L  L I  NRI     A I K+L+ N TLK L+IG N+I  +     + S    S  +S +R+L   N+        V+E +Q    +F+C  G++   G      +++L +Y  +   L  +K ++      L+++  K D D    VT  +F + L+E GIP    Q+N +   LD  G+G I + 
Sbjct:    6 LSVKHHGLGPFGTKALAKSLESNFSVDTLDLSGNWIYPIGSIAIGKMLEENNFISKLVLCDNMIGDQGLVGFHRALEVNRGLKHLDISGNQITDH-GCIELCKLIVKSKYLTELVLSRNNIDSKGAQLLATAISSNDILEYLDLSWNQIRREGAVDIAKGLKDNIRIKNCNLSYNGFAKDGGFALADTLKDNSALIVLNIESNRIDGETAALIGKALKSNETLKELRIGNNTIDTNGILSLMSSIN--SYDASPLRSLYLTNVPIDFEISKVIEHIQLKRRDFKCIHGFEIGVGNTQEDIRKRLTNYKHI---LILLKEHVLIKDKRLIDILMKIDEDNKKFVTLEQFSQALQELGIPFKKVQLNDIKNQLDKLGNGTIYYG 381          
The following BLAST results are available for this feature:
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC74A2.761e-3727.82leucine rich repeat containing 74A [Source:HGNC Sy... [more]
LRRC74B6.879e-2429.79leucine rich repeat containing 74B [Source:HGNC Sy... [more]
NLRC37.898e-1226.72NLR family CARD domain containing 3 [Source:HGNC S... [more]
NOD11.013e-1131.02nucleotide binding oligomerization domain containi... [more]
NLRC31.139e-1126.72NLR family CARD domain containing 3 [Source:HGNC S... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F28C1.34.495e-925.72Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.37.881e-925.72Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.33.210e-825.56Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.33.659e-825.56Protein phosphatase 1 regulatory subunit 37 homolo... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc74a4.244e-5331.37leucine rich repeat containing 74A [Source:ZFIN;Ac... [more]
lrrc74b3.362e-2832.97leucine rich repeat containing 74B [Source:ZFIN;Ac... [more]
nlrc31.794e-1326.48NLR family, CARD domain containing 3 [Source:ZFIN;... [more]
lrrc451.829e-830.07leucine rich repeat containing 45 [Source:ZFIN;Acc... [more]
lrrc452.811e-830.07leucine rich repeat containing 45 [Source:ZFIN;Acc... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000010017.11.596e-2431.91pep primary_assembly:Xenopus_tropicalis_v9.1:1:141... [more]
tent25.311e-2035.91terminal nucleotidyltransferase 2 [Source:Xenbase;... [more]
NLRC31.601e-927.82NLR family, CARD domain containing 3 [Source:NCBI ... [more]
pth2r2.694e-925.84parathyroid hormone 2 receptor [Source:Xenbase;Acc... [more]
pth2r3.542e-925.84parathyroid hormone 2 receptor [Source:Xenbase;Acc... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc74a1.435e-3728.47leucine rich repeat containing 74A [Source:MGI Sym... [more]
Lrrc74a2.252e-3728.16leucine rich repeat containing 74A [Source:MGI Sym... [more]
Lrrc74b1.415e-2230.14leucine rich repeat containing 74B [Source:MGI Sym... [more]
Lrrc74b5.076e-1730.30leucine rich repeat containing 74B [Source:MGI Sym... [more]
Lrrc74b5.235e-1630.40leucine rich repeat containing 74B [Source:MGI Sym... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VAA2|LR74A_HUMAN1.326e-3627.82Leucine-rich repeat-containing protein 74A OS=Homo... [more]
sp|A0JPI9|LR74A_RAT1.348e-3627.96Leucine-rich repeat-containing protein 74A OS=Ratt... [more]
sp|Q6ZQY2|LR74B_HUMAN3.304e-2329.79Leucine-rich repeat-containing protein 74B OS=Homo... [more]
sp|Q14BP6|LR74B_MOUSE9.901e-2230.14Leucine-rich repeat-containing protein 74B OS=Mus ... [more]
sp|Q9Y239|NOD1_HUMAN4.863e-1131.02Nucleotide-binding oligomerization domain-containi... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203085015.218e-7638.18tr|A0A1S3K3B1|A0A1S3K3B1_LINUN leucine-rich repeat... [more]
gnl|BL_ORD_ID|224715361.050e-7337.44tr|X2ATT6|X2ATT6_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|235317151.622e-6736.76tr|A0A210Q7P6|A0A210Q7P6_MIZYE Uncharacterized pro... [more]
gnl|BL_ORD_ID|211344085.756e-6432.72tr|A0A2T7NPI2|A0A2T7NPI2_POMCA Uncharacterized pro... [more]
gnl|BL_ORD_ID|175704852.252e-5436.34tr|A0A3M7RJC2|A0A3M7RJC2_BRAPC Leucine-rich repeat... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc74a8.809e-5030.07leucine rich repeat containing 74A [Source:NCBI ge... [more]
nlrc32.472e-1327.39NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc34.907e-1227.03NLR family CARD domain containing 3 [Source:NCBI g... [more]
carmil21.131e-824.15capping protein regulator and myosin 1 linker 2 [S... [more]
lrrc451.729e-725.96leucine rich repeat containing 45 [Source:NCBI gen... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002444.13.666e-3426.91pep scaffold:Pmarinus_7.0:GL480979:320698:340261:-... [more]
lrrc74a1.824e-3228.52leucine rich repeat containing 74A [Source:ZFIN;Ac... [more]
lrrc74a6.957e-3127.68leucine rich repeat containing 74A [Source:ZFIN;Ac... [more]
lrrc343.725e-628.08leucine rich repeat containing 34 [Source:ZFIN;Acc... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310063.592e-5534.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363605.289e-5433.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316183.649e-5332.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363594.091e-4329.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314788.854e-4130.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc74a8.603e-3630.54leucine rich repeat containing 74A [Source:ZFIN;Ac... [more]
nlrc38.646e-1124.81NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc38.646e-1124.81NLR family CARD domain containing 3 [Source:NCBI g... [more]
lrrc453.959e-729.75leucine rich repeat containing 45 [Source:NCBI gen... [more]
lrrc345.619e-728.11leucine rich repeat containing 34 [Source:NCBI gen... [more]
back to top
BLAST of leucine-rich repeat-containing protein 74B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008282.10.000e+099.40SMESG000008282.1[more]
SMESG000008282.10.000e+099.59SMESG000008282.1[more]
SMESG000008282.10.000e+095.48SMESG000008282.1[more]
SMESG000008282.10.000e+099.51SMESG000008282.1[more]
SMESG000073508.13.866e-3230.63SMESG000073508.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022359 ID=SMED30022359|Name=leucine-rich repeat-containing protein 74B|organism=Schmidtea mediterranea sexual|type=transcript|length=1603bp
ATCAGAGTATAATAACGGAATGATTATTTGATTGCTTTATTTGTTATAAG
TTAGAAACATTTTTAATTAATGTTAATTGCACAGTATGAATTCACATAAT
AAATCCAAGTTACCGTTAACAGCAAATTGGTGGCGAAATGATAAGAATTA
TAATAAAACTTCAAAAGCTTTTGTGCGTTCGGAATCATTCGAGAGCTTGA
CGGACCATCCACTAACCGAAGTGGAACCTAATTCCATTCCAAAGGAAATT
ATATTGCAGAAAGAAACCACTATCGACACGCCTGGAACTATAGATATTTC
AAAGGTGTTTGCGAAAGACCAATTGTCTAACATGTGTGAATTGTATGAAG
GCATTTGTGAGAGATTGGAATGTCCGAGTAGTAAAAGATTCATAAAAATT
TTAAAGCGTATCTCAGCGGGGTCAACAATAACAAATATAGAAATGGCTCA
TTACGGACTGACCGATCAAGGATTAAGGGCAATAATTTCATCGGATATAA
CGCAATTTTCATCTCTAAACCTCAAGGATAATATAATCTCAGAAAGGTCT
CTCGCCTATTTGATATCAACATTGTGGACGAATCAAATAACCGAACTAAA
CCTTTCTGATTCTAATCTTACCAAGTTTGGACCCAAAATATTGTCGCCCT
GGATTTTGTCGTCAAAAGTGATTAAAAATCTGTATTTAAGAAATAATAAT
TTTGACGACAACGACGGGTGCGTTTTGTTTGAAGGAGTCTCTGGAAACCG
ATCATTGCAACTTCTAGACTTAGCGGAAAATAATTTTTCCACTTTCTGTG
GTAATTCATTGAAAAAAATGATTGAAGACAACGATTCTTTGGAAGTGCTC
GATCTCAGTTGGAACCAACTGAGGCTGGAAGGTGCTGTATCTCTGTCGAA
AGGTTTACGAAAAAATAACGGCCTTAAAAGGCTGATTTTAAATTGGAACG
GTTTTGAAGATTCCGGTACAAAAGAATTATCCCAATCACTTTTAGAGAAT
GAAGATTTAGAAGAATTGGAAATTGCCTGTAATAGAATAACTGATGTTGG
GTTTGCAAATATTTTGAAGTCTCTCGAAAAGAATGTTACTCTTAAAATAC
TAAAAATTGGTTGGAATTCAATTTCCCAGTCGGCAGCTGAAGATGCTCTG
AAATCATTTCGAGATGGATCGCTTAAAAGTAGCACGATCAGGACATTGGA
TTTCAAAAATATAATTTTTCGAAATAATTTTCAAAATGTCGTTGAATCTT
TGCAAAAAGTTCTTCCGGAATTCCAATGCTATTTCGGTTACGATTCTTCT
TATGGAAAACGAAAACTGCAGTCATACGACCCGGTTGACGAAGCTTTGCA
ATTTATGAAAGTTTACATTGAAACTCATCACATTAACTTAGTAGAATTAT
TTGAGAAATTTGATGTAGACCAAAGTATGAGTGTGACTTATAACGAATTT
CGAGAAGGTTTGAAAGAGGCAGGCATTCCTATTAATGACAATCAAATCAA
CCAACTCATACAGTATTTGGATTCTGATGGTGACGGCGAAATTGACTTTA
GTTATTGGAGCGGAGACTCACGCACAAAAAGAGGCAAAACATGAAGATTT
GAC
back to top

protein sequence of SMED30022359-orf-1

>SMED30022359-orf-1 ID=SMED30022359-orf-1|Name=SMED30022359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=503bp
MNSHNKSKLPLTANWWRNDKNYNKTSKAFVRSESFESLTDHPLTEVEPNS
IPKEIILQKETTIDTPGTIDISKVFAKDQLSNMCELYEGICERLECPSSK
RFIKILKRISAGSTITNIEMAHYGLTDQGLRAIISSDITQFSSLNLKDNI
ISERSLAYLISTLWTNQITELNLSDSNLTKFGPKILSPWILSSKVIKNLY
LRNNNFDDNDGCVLFEGVSGNRSLQLLDLAENNFSTFCGNSLKKMIEDND
SLEVLDLSWNQLRLEGAVSLSKGLRKNNGLKRLILNWNGFEDSGTKELSQ
SLLENEDLEELEIACNRITDVGFANILKSLEKNVTLKILKIGWNSISQSA
AEDALKSFRDGSLKSSTIRTLDFKNIIFRNNFQNVVESLQKVLPEFQCYF
GYDSSYGKRKLQSYDPVDEALQFMKVYIETHHINLVELFEKFDVDQSMSV
TYNEFREGLKEAGIPINDNQINQLIQYLDSDGDGEIDFSYWSGDSRTKRG
KT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR032675LRR_dom_sf
IPR011992EF-hand-dom_pair
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 470..498
e-value: 6.4
score: 11.3
coord: 434..462
e-value: 0.29
score: 20.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 466..501
score: 6.982
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 430..465
score: 10.999
IPR002048EF-hand domainCDDcd00051EFhcoord: 435..489
e-value: 4.93546E-11
score: 56.0169
NoneNo IPR availableSMARTSM00368LRR_RI_2coord: 221..248
e-value: 4.8
score: 12.3
coord: 305..332
e-value: 2.2
score: 14.7
coord: 277..304
e-value: 1.9
score: 15.1
coord: 249..276
e-value: 0.0025
score: 27.1
coord: 333..360
e-value: 140.0
score: 2.0
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 420..492
e-value: 3.7E-14
score: 54.6
NoneNo IPR availablePANTHERPTHR24114:SF30LEUCINE-RICH REPEAT-CONTAINING PROTEIN 74Acoord: 56..493
NoneNo IPR availablePANTHERPTHR24114FAMILY NOT NAMEDcoord: 56..493
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 108..360
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 68..399
e-value: 4.5E-49
score: 168.8
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 305..322
e-value: 0.2
score: 11.8
coord: 276..298
e-value: 1.1
score: 9.5
coord: 251..271
e-value: 0.0029
score: 17.5
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 417..490