Beta-galactosidase

Overview
NameBeta-galactosidase
Smed IDSMED30022332
Length (bp)2180
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-galactosidase (SMED30022332) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-galactosidase (SMED30022332) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Beta-galactosidase (SMED30022332) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Beta-galactosidase (SMED30022332) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022332

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30022332SMESG000012792.1 dd_Smed_v4_4056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022332SMESG000012792.1 dd_Smed_v4_4056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022332SMESG000012792.1 dd_Smed_v4_4056_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-galactosidase vs. Ensembl Human
Match: GLB1 (galactosidase beta 1 [Source:HGNC Symbol;Acc:HGNC:4298])

HSP 1 Score: 502.286 bits (1292), Expect = 8.617e-169
Identity = 277/643 (43.08%), Postives = 389/643 (60.50%), Query Frame = 1
Query:  217 KGLSN---RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPI--------HLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS--------PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CTIEFVDEPILDGPV 2064
            +GL N   R F ID++ + FLKDG+PFRYISGS+ Y+R+P +YW DRLLKMK AGLNAIQ Y+PWN+HE   G Y F  + D+  FL +A +L LLV+LR GPY+C EW+ GGLPAWLL+K   ++LRSSD DYL++V KW  VLLP +KP LYQN GP++ VQVENEYGS++ CD +YLR L    R HLGDD+++++TDG   ++L CG+  + +++TVDFGT    N   AF   ++ +PKGP +NSE+Y+GWLD WG  H+ + T+ V   L  +   +   +VN+YMF GGT+F +WNGAN  PY  Q +SYDYDAPLSEAGD+T KY A+RN +       P  P+PP+T K AYG + LE+   V   L  L      KS YP+T   + Q+ G+++Y T+  +  S  +   +    + + D AY+         +      R  +  L++T K    L +L+EN G +N+G   IND KG++ N+T++  IL++W  +P+        HL           + + +  +        +    S        P DTF++   ++KG V INGFNLGRYW  +GPQ TLFVP+ +L     NT+ + ELE A C  +    C + FVD P++   V
Sbjct:   22 RGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKE-SILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGAL-QGLYTTVDFGTGS--NITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDI--LARGASVNLYMFIGGTNFAYWNGANS-PYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFE-KVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCS--NPAPLSSPLNGVHDRAYVAVDGIPQGVLE-----RNNVITLNITGKAGATLDLLVENMGRVNYG-AYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSV 648          
BLAST of Beta-galactosidase vs. Ensembl Human
Match: GLB1 (galactosidase beta 1 [Source:HGNC Symbol;Acc:HGNC:4298])

HSP 1 Score: 498.434 bits (1282), Expect = 9.589e-168
Identity = 273/633 (43.13%), Postives = 384/633 (60.66%), Query Frame = 1
Query:  238 FTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPI--------HLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS--------PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CTIEFVDEPILDGPV 2064
            F ID++ + FLKDG+PFRYISGS+ Y+R+P +YW DRLLKMK AGLNAIQ Y+PWN+HE   G Y F  + D+  FL +A +L LLV+LR GPY+C EW+ GGLPAWLL+K   ++LRSSD DYL++V KW  VLLP +KP LYQN GP++ VQVENEYGS++ CD +YLR L    R HLGDD+++++TDG   ++L CG+  + +++TVDFGT    N   AF   ++ +PKGP +NSE+Y+GWLD WG  H+ + T+ V   L  +   +   +VN+YMF GGT+F +WNGAN  PY  Q +SYDYDAPLSEAGD+T KY A+RN +       P  P+PP+T K AYG + LE+   V   L  L      KS YP+T   + Q+ G+++Y T+  +  S  +   +    + + D AY+         +      R  +  L++T K    L +L+EN G +N+G   IND KG++ N+T++  IL++W  +P+        HL           + + +  +        +    S        P DTF++   ++KG V INGFNLGRYW  +GPQ TLFVP+ +L     NT+ + ELE A C  +    C + FVD P++   V
Sbjct:    2 FEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKE-SILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGAL-QGLYTTVDFGTGS--NITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDI--LARGASVNLYMFIGGTNFAYWNGANS-PYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFE-KVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCS--NPAPLSSPLNGVHDRAYVAVDGIPQGVLE-----RNNVITLNITGKAGATLDLLVENMGRVNYG-AYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVCSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSV 618          
BLAST of Beta-galactosidase vs. Ensembl Human
Match: GLB1L (galactosidase beta 1 like [Source:HGNC Symbol;Acc:HGNC:28129])

HSP 1 Score: 452.21 bits (1162), Expect = 1.222e-149
Identity = 267/620 (43.06%), Postives = 377/620 (60.81%), Query Frame = 1
Query:  229 NRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDP-PYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSP----YPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSD-LSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPS---VSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVL--KLGYNTVRLFELEGANCQGNCTIEFVDEPILD 2055
             R+F +D  ++ FL DG PFRY+SGS+ Y R+P   W DRLLKM+ +GLNAIQFY+PWNYHE + G+YNF G+ DL  FL  A   +LLV+LR GPY+C EW+ GGLP+WLL+K P++ LR+SD D+L++V  W+ VLLP I P LY N G I+ +QVENEYGS+  CD +Y+R L    R+ LG+ I++++TDG     L CGS  R +++TVDFG   A N    F  L++++P GP VNSEYY+GWLD WG  H+  S   V +GL+ +    +  +VNMYMFHGGT+FG+WNGA+    +LP  +SYDYDAP+SEAGD T K  A+R+ +     + P  P+PP + K   GP+ L  V  +L   L  +  + P     P+T E++ Q  G+M+Y T  +   + F      +  + + D AY+           + G + R M D L LT KL   L +L+EN G ++FG    +D KG++    +   IL+ WM +P+ + N+       Q P      AP+    ++ TF +  S  DTFL    ++KG V INGFNLGRYW  +GPQ TL+VP+ +L  +   N + L ELE    Q    ++F+D+PIL+
Sbjct:   27 TRSFVVDRGHDRFLLDGAPFRYVSGSLHYFRVPRVLWADRLLKMRWSGLNAIQFYVPWNYHEPQPGVYNFNGSRDLIAFLNEAALANLLVILRPGPYICAEWEMGGLPSWLLRK-PEIHLRTSDPDFLAAVDSWFKVLLPKIYPWLYHNGGNIISIQVENEYGSYRACDFSYMRHLAGLFRALLGEKILLFTTDGP--EGLKCGSL-RGLYTTVDFGP--ADNMTKIFTLLRKYEPHGPLVNSEYYTGWLDYWGQNHSTRSVSAVTKGLENMLK--LGASVNMYMFHGGTNFGYWNGADKKGRFLPITTSYDYDAPISEAGDPTPKLFALRDVISKFQ-EVPLGPLPPPSPKMMLGPVTLHLV-GHLLAFLDLLCPRGPIHSILPMTFEAVKQDHGFMLYRTYMT--HTIFEPTPFWVPNNGVHDRAYVMVDG------VFQGVVERNMRDKLFLTGKLGSKLDILVENMGRLSFGSNS-SDFKGLLKPPILGQTILTQWMMFPLKIDNLVKWWFPLQLPKWPYPQAPSGPTFYSKTFPILGSVGDTFLYLPGWTKGQVWINGFNLGRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQ--VQFLDKPILN 625          
BLAST of Beta-galactosidase vs. Ensembl Human
Match: GLB1L (galactosidase beta 1 like [Source:HGNC Symbol;Acc:HGNC:28129])

HSP 1 Score: 452.21 bits (1162), Expect = 1.222e-149
Identity = 267/620 (43.06%), Postives = 377/620 (60.81%), Query Frame = 1
Query:  229 NRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDP-PYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSP----YPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSD-LSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPS---VSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVL--KLGYNTVRLFELEGANCQGNCTIEFVDEPILD 2055
             R+F +D  ++ FL DG PFRY+SGS+ Y R+P   W DRLLKM+ +GLNAIQFY+PWNYHE + G+YNF G+ DL  FL  A   +LLV+LR GPY+C EW+ GGLP+WLL+K P++ LR+SD D+L++V  W+ VLLP I P LY N G I+ +QVENEYGS+  CD +Y+R L    R+ LG+ I++++TDG     L CGS  R +++TVDFG   A N    F  L++++P GP VNSEYY+GWLD WG  H+  S   V +GL+ +    +  +VNMYMFHGGT+FG+WNGA+    +LP  +SYDYDAP+SEAGD T K  A+R+ +     + P  P+PP + K   GP+ L  V  +L   L  +  + P     P+T E++ Q  G+M+Y T  +   + F      +  + + D AY+           + G + R M D L LT KL   L +L+EN G ++FG    +D KG++    +   IL+ WM +P+ + N+       Q P      AP+    ++ TF +  S  DTFL    ++KG V INGFNLGRYW  +GPQ TL+VP+ +L  +   N + L ELE    Q    ++F+D+PIL+
Sbjct:   27 TRSFVVDRGHDRFLLDGAPFRYVSGSLHYFRVPRVLWADRLLKMRWSGLNAIQFYVPWNYHEPQPGVYNFNGSRDLIAFLNEAALANLLVILRPGPYICAEWEMGGLPSWLLRK-PEIHLRTSDPDFLAAVDSWFKVLLPKIYPWLYHNGGNIISIQVENEYGSYRACDFSYMRHLAGLFRALLGEKILLFTTDGP--EGLKCGSL-RGLYTTVDFGP--ADNMTKIFTLLRKYEPHGPLVNSEYYTGWLDYWGQNHSTRSVSAVTKGLENMLK--LGASVNMYMFHGGTNFGYWNGADKKGRFLPITTSYDYDAPISEAGDPTPKLFALRDVISKFQ-EVPLGPLPPPSPKMMLGPVTLHLV-GHLLAFLDLLCPRGPIHSILPMTFEAVKQDHGFMLYRTYMT--HTIFEPTPFWVPNNGVHDRAYVMVDG------VFQGVVERNMRDKLFLTGKLGSKLDILVENMGRLSFGSNS-SDFKGLLKPPILGQTILTQWMMFPLKIDNLVKWWFPLQLPKWPYPQAPSGPTFYSKTFPILGSVGDTFLYLPGWTKGQVWINGFNLGRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQ--VQFLDKPILN 625          
BLAST of Beta-galactosidase vs. Ensembl Human
Match: GLB1L3 (galactosidase beta 1 like 3 [Source:HGNC Symbol;Acc:HGNC:25147])

HSP 1 Score: 309.686 bits (792), Expect = 7.186e-95
Identity = 225/658 (34.19%), Postives = 324/658 (49.24%), Query Frame = 1
Query:  175 SEPNFSTKISLLTDKGLSNRTFTIDFTNN-----VFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFN----PASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQ----ISSYDYDAPLSEAGDITSKYLAIRNALLSINPDH-PFLP-VPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESL------NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSL-TMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHL----------ANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEPIL 2052
            S+P F+   S LT   L NR+  +   +       F  +G  F    GS+ Y R+P  YW DRLLK+KA G N +  Y+PWN HE E G ++F GN DL  F+ +A ++ L V+LR G Y+C E D GGLP+WLL ++P+++LR+++K ++ +V K++  L+P + P  Y+  GP++ VQVENEYGSF   D  Y+  L+  +    G   ++ ++DG           ++ + S    G   A N        F  L + Q   P +  EY+ GW D WG +H+     +V   +     Y +S NV  YMFHGGT+FGF NGA    Y  +    ++SYDYDA L+EAGD T KYL ++    S++    P +P +PP        P +   + D L +L   V  +S  P+ ME+L       Q  G ++Y  S        +H           D A +F         T IG L     DL +  ++    L +L+EN G +NF   + N+ KGI G+V++N+  L  +  Y + +          A    V DS Q P+           GT     SP DTFL   N++ G V ING NLGRYWN  GPQ TL++P   L    N V LFE           I+  D+P L
Sbjct:   47 SQPRFNW--SHLTPLELKNRSVGLGTESTGRGKPHFTLEGHKFLIFGGSIHYFRVPREYWRDRLLKLKACGFNTVTTYVPWNLHEPERGKFDFSGNLDLEAFVLMAAEIGLWVILRPGRYICSEMDLGGLPSWLL-QDPRLLLRTTNKSFIEAVEKYFDHLIPRVIPLQYRQAGPVIAVQVENEYGSF-NKDKTYMPYLHKALLRR-GIVELLLTSDG-----------EKHVLSGHTKGVLAAINLQKLHQDTFNQLHKVQRDKPLLIMEYWVGWFDRWGDKHHVKDAKEVEHAVSEFIKYEISFNV--YMFHGGTNFGFMNGAT---YFGKHSGIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKAVYPPVRPSLYLPLWDALSYLNEPV--RSRQPVNMENLPINNGSGQSYGLVLYEKSICSGGRLRAHAH---------DVAQVFLDE------TMIGILNENNKDLHIPELRDCRYLRILVENQGRVNFSWQIQNEQKGITGSVSINNSSLEGFTIYSLEMKMSFFERLRSATWKPVPDSHQGPAFYC--------GTLKAGPSPKDTFLSLLNWNYGFVFINGRNLGRYWNI-GPQKTLYLPGVWLHPEDNEVILFE----KMMSGSDIKSTDKPTL 653          
BLAST of Beta-galactosidase vs. Ensembl Celegans
Match: bgal-1 (Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:Q27526])

HSP 1 Score: 417.542 bits (1072), Expect = 1.180e-136
Identity = 255/642 (39.72%), Postives = 354/642 (55.14%), Query Frame = 1
Query:  235 TFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIA-RKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFG-TSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGL-RHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINP-DHPFLPVPPNTTKTAYGPLILEQVPDY----LFHLLGQVG--FKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAE--------NLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLA-------------NISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGAN--C--QGNCTIEFVDEPILD 2055
            +F ID + N FL DG PFRYISGS+ Y RIP   W +RL K++A G NAIQ+YIPWN HE EEG ++F G  D ++F  +A  K  L  +LR GPY+CGE + GGLP WLL KN     RSSD+ +   V  W+ +LLP +KP L +N GP++M+Q+ENEYGS+  CD  YLR L D  RS +GDD+++++TDG+  S L CG+ +  +F TVDFG T  A    + F+  +++ P GP VNSEYY GWL  WG  + N  S   ++ G +T+  YS+  + N YM HGGT+FGFWNGA      P I+SYDYDAP+SE+GD+T+KYL IR  +  +     P L VP N+ K  +G + +  V           LG  G   ++  PI+ E+L    G + Y    +   +        +     GDF +++ + K      YI +L R   +L+    + E         LF+L+EN G   F    IND KGI+ +V +N + +  W    I L              N      S Q   V                 +P DT+L T+ + KG+ ++NG N GRYW TKGPQ TL++P   LK+G N+V + ELEGA   C    +C  +F+D P+ D
Sbjct:   41 SFLIDESKNQFLLDGLPFRYISGSIHYFRIPRDRWDERLGKVRALGFNAIQYYIPWNMHELEEGNHDFSGLLDFAEFSMMAFHKYGLWTILRVGPYICGELENGGLPWWLLNKNVTK-QRSSDRVFTREVENWFEILLPRVKPLLRKNGGPVLMLQIENEYGSYDACDQQYLRFLRDLTRSLVGDDVLLFTTDGSAESLLKCGTVE-GVFPTVDFGPTDDAKEIENNFKLQRKFAPNGPLVNSEYYPGWLVLWGQKKQNLPSPQTIINGSQTM--YSLGASFNYYMIHGGTNFGFWNGAETEA--PCITSYDYDAPISESGDVTTKYLEIRKWIKGLTDWPTPPLDVPGNSPKGRFGKIKMRLVHSVEKLKTLTSLGDPGDCVETDKPISFETLKHPLGLVAYQAKINSCGN--------LTIPSFGDFVHVYLNGK------YIDTLTRRYYNLTRNSVIIEGCLENEENRLFMLVENQGRKTF--ETINDRKGILSDVFMNGQAIQFWTQCGIKLPLQEDFYFRKAMRNNYRKNVKSNQKQGV---------FIGILSVDAPTDTWLDTTGWGKGIAIVNGRNFGRYWPTKGPQMTLYIPAEFLKIGENSVMMVELEGAEEACTSTSSCIADFIDHPVFD 651          
BLAST of Beta-galactosidase vs. Ensembl Celegans
Match: bgal-1 (Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:Q27526])

HSP 1 Score: 417.542 bits (1072), Expect = 1.180e-136
Identity = 255/642 (39.72%), Postives = 354/642 (55.14%), Query Frame = 1
Query:  235 TFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIA-RKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFG-TSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGL-RHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINP-DHPFLPVPPNTTKTAYGPLILEQVPDY----LFHLLGQVG--FKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAE--------NLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLA-------------NISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGAN--C--QGNCTIEFVDEPILD 2055
            +F ID + N FL DG PFRYISGS+ Y RIP   W +RL K++A G NAIQ+YIPWN HE EEG ++F G  D ++F  +A  K  L  +LR GPY+CGE + GGLP WLL KN     RSSD+ +   V  W+ +LLP +KP L +N GP++M+Q+ENEYGS+  CD  YLR L D  RS +GDD+++++TDG+  S L CG+ +  +F TVDFG T  A    + F+  +++ P GP VNSEYY GWL  WG  + N  S   ++ G +T+  YS+  + N YM HGGT+FGFWNGA      P I+SYDYDAP+SE+GD+T+KYL IR  +  +     P L VP N+ K  +G + +  V           LG  G   ++  PI+ E+L    G + Y    +   +        +     GDF +++ + K      YI +L R   +L+    + E         LF+L+EN G   F    IND KGI+ +V +N + +  W    I L              N      S Q   V                 +P DT+L T+ + KG+ ++NG N GRYW TKGPQ TL++P   LK+G N+V + ELEGA   C    +C  +F+D P+ D
Sbjct:   41 SFLIDESKNQFLLDGLPFRYISGSIHYFRIPRDRWDERLGKVRALGFNAIQYYIPWNMHELEEGNHDFSGLLDFAEFSMMAFHKYGLWTILRVGPYICGELENGGLPWWLLNKNVTK-QRSSDRVFTREVENWFEILLPRVKPLLRKNGGPVLMLQIENEYGSYDACDQQYLRFLRDLTRSLVGDDVLLFTTDGSAESLLKCGTVE-GVFPTVDFGPTDDAKEIENNFKLQRKFAPNGPLVNSEYYPGWLVLWGQKKQNLPSPQTIINGSQTM--YSLGASFNYYMIHGGTNFGFWNGAETEA--PCITSYDYDAPISESGDVTTKYLEIRKWIKGLTDWPTPPLDVPGNSPKGRFGKIKMRLVHSVEKLKTLTSLGDPGDCVETDKPISFETLKHPLGLVAYQAKINSCGN--------LTIPSFGDFVHVYLNGK------YIDTLTRRYYNLTRNSVIIEGCLENEENRLFMLVENQGRKTF--ETINDRKGILSDVFMNGQAIQFWTQCGIKLPLQEDFYFRKAMRNNYRKNVKSNQKQGV---------FIGILSVDAPTDTWLDTTGWGKGIAIVNGRNFGRYWPTKGPQMTLYIPAEFLKIGENSVMMVELEGAEEACTSTSSCIADFIDHPVFD 651          
BLAST of Beta-galactosidase vs. Ensembl Celegans
Match: bgal-2 (Beta GALactosidase homolog [Source:UniProtKB/TrEMBL;Acc:O76632])

HSP 1 Score: 309.301 bits (791), Expect = 2.466e-95
Identity = 203/613 (33.12%), Postives = 316/613 (51.55%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHE-YEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLR-HNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSI-NPDHPFLPVPPNTTKTAYGPL---ILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIF-SSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNW--MHYPIHLANISSV------------TDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEG 2001
            S+ +F ID  N+ FL DG PF YI+G + Y RIP   W DRL +++A G NAI   +PWN H+ Y++      GN DL KF+  A    L  +LR GPY+  EWD GGLP WL++       RSSD  +++ V +W+  LLP I P + +N GP++MVQ+E+ YG+   CD  YL  L +  + +LG+D+++++ +     ++ CG+    + +      + A    S F   K +    P V S++       WG    +    + +++  KT   ++++ +++ +M HGGT+FG+WNGA DP   P  +SYD  AP+SEAGD+   Y++IRN + +I    +P  P+P N  +TAY  +   + + +  ++     +       P T E + Q  GY+ Y T+  E  S +             D AYIF + N   +     GS+     D+   +    +L ++IE +G  +    +++  +GI GNV + +  L NW     PI    IS V            T  F+    +A  Q  +F G   + T+P DTFL T  + KGVV IN +N+GRYW + GPQ TL++P   L  G N +  +E EG
Sbjct:   22 SSPSFKIDTVNSQFLLDGDPFTYIAGEIHYFRIPHQKWDDRLKRVRALGFNAITVPVPWNLHQFYQDETPILSGNLDLVKFIKAAESNGLYTILRIGPYISAEWDNGGLPWWLIRNTKIGKYRSSDPSFMTEVTQWWKHLLPKIYPLMRKNAGPVLMVQIEHFYGALGICDQQYLLQLANMAKENLGNDVVLFTVNPPVLQFMRCGTLPNILPTIEIVPNANAGEIESWFSMQKAFMQGAPAVASQFLINPFKLWGKNVSDPYPNNLIIQTAKTA--FALNASLSFHMTHGGTNFGYWNGAVDP--YPVTTSYDSFAPISEAGDVNPLYISIRNWISNIPGWQNPPTPIPANLPRTAYPDVQLTVFDTISGFIIGANPECWSSPETPRTAEYIRQGYGYIYYNTTIIECGSLY--------IPTFADNAYIFLNQNFVGALYKQFGSIHNNTIDVQGCLDQFNSLEIIIEITGRDHNNYPVMS--RGIQGNVYMRNITLENWESCEVPIETYEISLVKNYESLKQHVFETIDFEKSQSAAIEQPSVFIGNLIIKTAPADTFLDTRGWGKGVVTINQYNIGRYWASIGPQQTLYIPSEFLHKGENLIMFYEFEG 620          
BLAST of Beta-galactosidase vs. Ensembl Fly
Match: Ect3 (gene:FBgn0260746 transcript:FBtr0082487)

HSP 1 Score: 397.512 bits (1020), Expect = 5.805e-129
Identity = 242/636 (38.05%), Postives = 338/636 (53.14%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAND---PPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLG---QVGF-KSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMS--DLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNW--MHYPIH---------LANISSVTDSFQN-----PSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEPILDG 2058
            +NRTF +D+  + FLKDG+PFR+I+GS  Y R     W   L  M+AAGLNA+  Y+ W+ H   +G+Y + G  DL  F+ +A   DLLV+LR GPY+C E D GG P WLL K P + LR++D +YLS +  WY+ L   +  +LY N GPI+MVQVENEYGSFY CD NY   L D   SH+    ++++ DG   S L CG   + + +T+DFG +    P  A    +R+QPKGP VN+EYY GWL  W      VST  +      + ++  S  VN YMF+GGT+FGF  GAND     Y+  I+SYDYDAP++EAGD T KY A+R  +    P  P  PVP    K +YG + L      L          GF +S  P + E+L QY G ++Y T    +Q + S   V      + D  Y++   +      ++G L R     +L L+        +++EN G IN+G+  +ND KGI+ +V ++ ++LSNW    +P+            +  +V   FQ        +                +   DT+L  S + KG+V +NG NLGRYW   GPQ TL+VP  VLK G N  RL  +E      +  + F D PIL+ 
Sbjct:   20 ANRTFVVDYEKDQFLKDGEPFRFIAGSFHYFRAHPATWQRHLRTMRAAGLNAVTTYVEWSLHNPRDGVYVWSGIADLEHFIRLAVGEDLLVILRPGPYICAERDMGGFPYWLLNKYPGIQLRTADVNYLSEIRIWYTQLFAKMNKYLYGNGGPIIMVQVENEYGSFYACDLNYRNWLRDETESHVKGQAVLFTNDGP--SVLRCGKI-QGVLATMDFGATNDLKPIWA--KFRRYQPKGPLVNAEYYPGWLTHWTEPMANVSTQSITSTFINMLDHGAS--VNFYMFYGGTNFGFTAGANDIGPGNYMADITSYDYDAPMTEAGDPTPKYQALRRIIGRYLP-LPNQPVPGPVPKRSYGTVRLTTCCSLLSSEARSRLSTGFVQSAKPKSFEALGQYSGLVLYETWLPSFQRDPSILSV----PGLADRGYVYVDGE------FVGILARETPVFELPLSASAGRRFQIIVENQGRINYGR-QLNDFKGILRDVRLDKQVLSNWNMTQFPLESYDNLEQLITQSDEAVRQGFQELKKLRTMLRTGPAIYHGQLDIQKESDLADTYLDMSGWGKGIVFVNGENLGRYWPLVGPQVTLYVPAAVLKAGSN--RLVVVEYQQTPASQELHFRDTPILNA 634          
BLAST of Beta-galactosidase vs. Ensembl Fly
Match: Gal (gene:FBgn0001089 transcript:FBtr0079230)

HSP 1 Score: 348.206 bits (892), Expect = 1.195e-109
Identity = 223/635 (35.12%), Postives = 324/635 (51.02%), Query Frame = 1
Query:  211 TDKGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-----DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNT----TKTAYGPLILEQVPDY-LFHLLGQVGF------KSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVK---IKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMS--DLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDK-----ILSNW--MHYPIHLANISSVTDSFQNPSVSAPXXXXXXX--------XXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGAN 2007
            TD       FTID   N F+ DG+PFRY+SGS  Y R     W  RL  M+A+GLNA+  Y+ W+ H   +G YN+ G  D+ KFL IA++ D  ++LR GPY+C E D GGLP WL  K P + +R++D +Y+S V KWY+ L+P ++     N G I+MVQVENEYG  Y CD++YL  L D    ++    ++++ D      ++CG  +  +F+T DFG          +  L+  QP GP VNSE+Y GWL  W  ++ +    +V   L+T+ +Y+ S  VN+YMF GGT+FGF  GAN        Y   I+SYDYDA + EAG +T+KY  ++  +        FLP+P  T     + AYG   +E  P   L    G+         +S  P T E L+ Y G ++       Y++E    D+    +K  +I D A++F   +       +G+L R      L L+      L +L+EN G +NF   + ND KGI G V++         L NW    +P+  + +        +     P                     T   DT+L  + + KGV  +NGFNLGRYW   GPQ TL+VP  +LK+G N++ + E + AN
Sbjct:   37 TDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGD-YACDHDYLNWLRDETEKYVSGKALLFTVDIPN-EKMSCGKIE-NVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNAS--VNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAVI------GEFLPLPEITLNPAKRLAYGR--VELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLYSGLVL-------YETELPSMDLDPALLKIDQINDRAHVFVDQE------LVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILEYQRAN 643          
BLAST of Beta-galactosidase vs. Ensembl Fly
Match: Gal (gene:FBgn0001089 transcript:FBtr0332603)

HSP 1 Score: 347.436 bits (890), Expect = 2.163e-109
Identity = 223/639 (34.90%), Postives = 325/639 (50.86%), Query Frame = 1
Query:  199 ISLLTDKGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-----DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNT----TKTAYGPLILEQVPDY-LFHLLGQVGF------KSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVK---IKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMS--DLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDK-----ILSNW--MHYPIHLANISSVTDSFQNPSVSAPXXXXXXX--------XXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGAN 2007
            + L  D       FTID   N F+ DG+PFRY+SGS  Y R     W  RL  M+A+GLNA+  Y+ W+ H   +G YN+ G  D+ KFL IA++ D  ++LR GPY+C E D GGLP WL  K P + +R++D +Y+S V KWY+ L+P ++     N G I+MVQVENEYG  Y CD++YL  L D    ++    ++++ D      ++CG  +  +F+T DFG          +  L+  QP GP VNSE+Y GWL  W  ++ +    +V   L+T+ +Y+ S  VN+YMF GGT+FGF  GAN        Y   I+SYDYDA + EAG +T+KY  ++  +        FLP+P  T     + AYG   +E  P   L    G+         +S  P T E L+ Y G ++       Y++E    D+    +K  +I D A++F   +       +G+L R      L L+      L +L+EN G +NF   + ND KGI G V++         L NW    +P+  + +        +     P                     T   DT+L  + + KGV  +NGFNLGRYW   GPQ TL+VP  +LK+G N++ + E + AN
Sbjct:   31 VGLSGDTDAPEPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGD-YACDHDYLNWLRDETEKYVSGKALLFTVDIPN-EKMSCGKIE-NVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNAS--VNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAVI------GEFLPLPEITLNPAKRLAYGR--VELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLYSGLVL-------YETELPSMDLDPALLKIDQINDRAHVFVDQE------LVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILEYQRAN 641          
BLAST of Beta-galactosidase vs. Ensembl Zebrafish
Match: glb1 (galactosidase, beta 1 [Source:ZFIN;Acc:ZDB-GENE-050410-9])

HSP 1 Score: 498.049 bits (1281), Expect = 2.532e-167
Identity = 281/630 (44.60%), Postives = 391/630 (62.06%), Query Frame = 1
Query:  238 FTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSP----YPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMS-DLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISS------------VTDSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANC-QGNCTIEFVDEPILDGPVH 2067
            F++D+  N FLKDG+PFRYISGS+ Y+RIP  YW DRLLKM  AGLNAIQ Y+PWN+HE   G Y+F G+ DL +FL + + + LLV++R GPY+C EWD GGLPAWLLKK   ++LRSSD DYL++V KW   LLPIIK +LYQN GPI+ VQVENEYGS++ CD NY+R L    R +LG++ ++++TDG G  YL CGS  + +++TVDFG     N  +AF   +  +P+GP VNSE+Y GWLD WG +H+ V T  VV+ L  +    +  NVN+YMF GGT+FG+WNGAN  PY PQ +SYDYD+PL+EAGD+T KY AIR  ++ +  D P   +PP+T K AYG + ++++   +   L  + F  P    YP T   +NQ  G+++Y T      +      +    + + D AYI      + + T  G L R  +  +++T K    + VL+EN G IN+G+G IND KG++ N+T+   +L NW  Y + +    S             + S   P++S PT               P DT+++  ++ KG V INGFN+GRYW ++GPQ TLFVP  +L     N + + ELE + C  G+C +EF D PIL+G V+
Sbjct:   51 FSVDYHRNCFLKDGEPFRYISGSIHYSRIPRVYWKDRLLKMYMAGLNAIQTYVPWNFHEAVPGQYDFSGDRDLEQFLQLCQDIGLLVIMRPGPYICAEWDMGGLPAWLLKKK-DIVLRSSDPDYLAAVDKWMGKLLPIIKRYLYQNGGPIITVQVENEYGSYFACDFNYMRHLSQLFRFYLGEEAVLFTTDGAGLGYLKCGSL-QGLYATVDFGPGA--NVTAAFEAQRHVEPRGPLVNSEFYPGWLDHWGEKHSVVPTSAVVKTLNEI--LEIGANVNLYMFIGGTNFGYWNGANT-PYGPQPTSYDYDSPLTEAGDLTEKYFAIRE-VIKMYKDVPEGILPPSTPKFAYGKVQMKKL-KTVSETLDVLSFSGPVKTLYPPTFIEMNQAFGFVLYQTVLP--VNCVKPTPLSSPLNGVHDRAYI------SIDGTAAGILERNKALSINITGKAGSRVDVLVENMGRINYGKG-INDFKGLVFNLTLGADVLVNWTVYSLSVDEAVSKGLLLASGSSSTSSTSTPPPALSPPTFYTGSFIIPDGIPDLPQDTYIQFPDWRKGQVWINGFNVGRYWPSRGPQITLFVPAHLLSTSVQNNITVLELEASPCSSGSCMVEFTDTPILNGTVN 662          
BLAST of Beta-galactosidase vs. Ensembl Zebrafish
Match: glb1l (galactosidase, beta 1-like [Source:ZFIN;Acc:ZDB-GENE-050309-196])

HSP 1 Score: 494.582 bits (1272), Expect = 1.125e-166
Identity = 277/620 (44.68%), Postives = 388/620 (62.58%), Query Frame = 1
Query:  232 RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPD---YLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRR-TMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHL----AN--ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLG-YNTVRLFELEGANCQGNCTIEFVDEPILD 2055
            R+F+ID+ NN F KDGKPF+YISGS+ Y+RIP  YW DRLLKM   GLNAIQ Y+PWN+HE  +G+YNF G+ DL  FL +A +  LLV+LR GPY+C EW+ GGLPAWLL+K P +ILRS+DK+YL +   W +VLL  ++P LYQN G I+ VQVENEYGS++ CD NY+R L+   R  LG+D+I+++TDGN    ++CG+ +  +++T+DFGT    N  +AF   +R++PKGP VNSE+Y+GWLD WG +H  V T+ V + L  +   SM  +VNMYMF GGT+FG+WNGA+ D  +   ++SYDY+APL+EAGD T K LAIR+ + +   D P  P+PP T K AYG + L +V +    L  L  Q   +S YP+T E + QY G+++Y T+      E +   +    + I D AY+  +        Y G + R T   +++T +  + L +L+EN G +NFG   IND KG++GN+ + + +LS+W  YP+ +    AN  + S        +   P                 DTF+K + ++KG V +NGFNLGRYW  +GPQ TL+VP   L     N + + ELE A    +C I F+D P LD
Sbjct:   25 RSFSIDYKNNCFRKDGKPFQYISGSIHYSRIPREYWQDRLLKMYMTGLNAIQVYVPWNFHETVQGVYNFAGDRDLEYFLNLANQTGLLVILRPGPYICAEWEMGGLPAWLLQK-PNIILRSADKEYLQAASDWLAVLLAKMRPWLYQNGGNIISVQVENEYGSYFACDYNYMRHLHTLFRLFLGEDVILFTTDGNTDKEMSCGTLE-GLYATIDFGTDT--NITTAFIRQRRFEPKGPLVNSEFYTGWLDHWGDKHASVDTNKVSKMLGEM--LSMGASVNMYMFEGGTNFGYWNGADHDTRFRSVVTSYDYNAPLTEAGDPTDKLLAIRDVIKNFR-DIPVGPMPPATPKLAYGFVTLHKVGNISSLLDTLSPQGPVRSQYPLTFEEIKQYYGFLLYRTTLPRNVPEPT--PLISPLNGIHDRAYVSVNG------VYQGLMERDTGLVMNITGRQGDQLDILVENMGRVNFGS-YINDNKGLLGNLILGNDVLSDWSVYPLDIDTAVANGWLQSAHSGLLTEAGDGPIFYSGTLKPTGRAW---DTFVKLNGWTKGQVWVNGFNLGRYWPKRGPQQTLYVPGPFLSANQLNNITVLELERA--PPHCRILFMDRPQLD 623          
BLAST of Beta-galactosidase vs. Ensembl Zebrafish
Match: glb1l (galactosidase, beta 1-like [Source:ZFIN;Acc:ZDB-GENE-050309-196])

HSP 1 Score: 481.1 bits (1237), Expect = 5.130e-161
Identity = 277/646 (42.88%), Postives = 388/646 (60.06%), Query Frame = 1
Query:  232 RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYI--------------------------PWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPD---YLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRR-TMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHL----AN--ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLG-YNTVRLFELEGANCQGNCTIEFVDEPILD 2055
            R+F+ID+ NN F KDGKPF+YISGS+ Y+RIP  YW DRLLKM   GLNAIQ Y+                          PWN+HE  +G+YNF G+ DL  FL +A +  LLV+LR GPY+C EW+ GGLPAWLL+K P +ILRS+DK+YL +   W +VLL  ++P LYQN G I+ VQVENEYGS++ CD NY+R L+   R  LG+D+I+++TDGN    ++CG+ +  +++T+DFGT    N  +AF   +R++PKGP VNSE+Y+GWLD WG +H  V T+ V + L  +   SM  +VNMYMF GGT+FG+WNGA+ D  +   ++SYDY+APL+EAGD T K LAIR+ + +   D P  P+PP T K AYG + L +V +    L  L  Q   +S YP+T E + QY G+++Y T+      E +   +    + I D AY+  +        Y G + R T   +++T +  + L +L+EN G +NFG   IND KG++GN+ + + +LS+W  YP+ +    AN  + S        +   P                 DTF+K + ++KG V +NGFNLGRYW  +GPQ TL+VP   L     N + + ELE A    +C I F+D P LD
Sbjct:   25 RSFSIDYKNNCFRKDGKPFQYISGSIHYSRIPREYWQDRLLKMYMTGLNAIQVYVKQTLHTEHSHVTHLAKIFGLFTCRYVPWNFHETVQGVYNFAGDRDLEYFLNLANQTGLLVILRPGPYICAEWEMGGLPAWLLQK-PNIILRSADKEYLQAASDWLAVLLAKMRPWLYQNGGNIISVQVENEYGSYFACDYNYMRHLHTLFRLFLGEDVILFTTDGNTDKEMSCGTLE-GLYATIDFGTDT--NITTAFIRQRRFEPKGPLVNSEFYTGWLDHWGDKHASVDTNKVSKMLGEM--LSMGASVNMYMFEGGTNFGYWNGADHDTRFRSVVTSYDYNAPLTEAGDPTDKLLAIRDVIKNFR-DIPVGPMPPATPKLAYGFVTLHKVGNISSLLDTLSPQGPVRSQYPLTFEEIKQYYGFLLYRTTLPRNVPEPT--PLISPLNGIHDRAYVSVNG------VYQGLMERDTGLVMNITGRQGDQLDILVENMGRVNFGS-YINDNKGLLGNLILGNDVLSDWSVYPLDIDTAVANGWLQSAHSGLLTEAGDGPIFYSGTLKPTGRAW---DTFVKLNGWTKGQVWVNGFNLGRYWPKRGPQQTLYVPGPFLSANQLNNITVLELERA--PPHCRILFMDRPQLD 649          
BLAST of Beta-galactosidase vs. Ensembl Zebrafish
Match: si:dkey-224e22.2 (si:dkey-224e22.2 [Source:ZFIN;Acc:ZDB-GENE-061207-59])

HSP 1 Score: 338.191 bits (866), Expect = 1.361e-106
Identity = 220/604 (36.42%), Postives = 328/604 (54.30%), Query Frame = 1
Query:  265 FLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAND-PPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHL-LGQVGFKSPYPITMESL------NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAEN-LFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNW-MHYPIHLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEP 2046
            F   G PFR + GS+ Y R+P  +W DRLLK+KA GLN +  Y+PWN HE E G+Y F    DL  ++ +A +LDL V+LR GPY+C EWD GGLP+WLL ++ KM LR++   + S+V  ++  L+P I P  Y+  GPI+ VQVENEYGS Y  D  YL V+ + + S    ++++ S +  G   L CG  D  +  TV+       +     + L   QP+ P +  EY+SGW D WG  H+  S  +++  ++ L +    V++N YMFHGG+SFGF +GA D   Y PQ SSYDYDAPL+E+GD T+KY  +R+ L S + + P L  P   ++  Y P+++ Q       L   +  F++  P++ME+L       Q  GY +Y T        +S  ++  + + + D A +F   +       IG L      + +    +E  L +L+EN G +N+G  + +  KG++G++T+ +  L  + MH         +   S +  SVS       F     V   P DTF+K  N+SKGVV +NG NLGR+W+  GPQ  L++P   LK G N + +FE      +   TI F + P
Sbjct:   14 FTLAGAPFRILGGSIHYFRVPRAHWRDRLLKLKACGLNTLTTYVPWNLHEPERGVYVFQDQLDLEAYIRLAAELDLWVILRPGPYICAEWDLGGLPSWLL-QDKKMKLRTTYSGFTSAVNSFFDKLIPRITPLQYKKGGPIIAVQVENEYGS-YAKDEQYLSVVKEALMSRGISELLMTSDNREG---LKCGGVD-GVLQTVNLQKLSYGD----VQHLAELQPQKPLMVMEYWSGWFDVWGELHHVFSAQEMISIVRELLD--RGVSINFYMFHGGSSFGFMSGAVDLGTYKPQTSSYDYDAPLTESGDYTTKYHLLRSLLSSYSKE-PILEPPAVQSRRVYEPVVVTQHISLWESLQCVETSFRADDPVSMENLPANNNNGQSYGYTLYQTDI------YSGGELNSR-NHVRDRALVFIDRE------LIGVLDYRTQKVKIPQSKSERTLSLLVENCGRVNYGPALDSQQKGLVGDITLENVPLKKFTMHCLDMKPGFINRLQSRKWTSVSEKPTYPAFFRGSLVVDQPTDTFIKLPNWSKGVVFVNGQNLGRHWSV-GPQKALYLPGPWLKTGENEIIVFE----EFKATETIHFAENP 586          
BLAST of Beta-galactosidase vs. Ensembl Zebrafish
Match: si:dkey-224e22.2 (si:dkey-224e22.2 [Source:ZFIN;Acc:ZDB-GENE-061207-59])

HSP 1 Score: 338.191 bits (866), Expect = 1.361e-106
Identity = 220/604 (36.42%), Postives = 328/604 (54.30%), Query Frame = 1
Query:  265 FLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAND-PPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHL-LGQVGFKSPYPITMESL------NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAEN-LFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNW-MHYPIHLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEP 2046
            F   G PFR + GS+ Y R+P  +W DRLLK+KA GLN +  Y+PWN HE E G+Y F    DL  ++ +A +LDL V+LR GPY+C EWD GGLP+WLL ++ KM LR++   + S+V  ++  L+P I P  Y+  GPI+ VQVENEYGS Y  D  YL V+ + + S    ++++ S +  G   L CG  D  +  TV+       +     + L   QP+ P +  EY+SGW D WG  H+  S  +++  ++ L +    V++N YMFHGG+SFGF +GA D   Y PQ SSYDYDAPL+E+GD T+KY  +R+ L S + + P L  P   ++  Y P+++ Q       L   +  F++  P++ME+L       Q  GY +Y T        +S  ++  + + + D A +F   +       IG L      + +    +E  L +L+EN G +N+G  + +  KG++G++T+ +  L  + MH         +   S +  SVS       F     V   P DTF+K  N+SKGVV +NG NLGR+W+  GPQ  L++P   LK G N + +FE      +   TI F + P
Sbjct:   14 FTLAGAPFRILGGSIHYFRVPRAHWRDRLLKLKACGLNTLTTYVPWNLHEPERGVYVFQDQLDLEAYIRLAAELDLWVILRPGPYICAEWDLGGLPSWLL-QDKKMKLRTTYSGFTSAVNSFFDKLIPRITPLQYKKGGPIIAVQVENEYGS-YAKDEQYLSVVKEALMSRGISELLMTSDNREG---LKCGGVD-GVLQTVNLQKLSYGD----VQHLAELQPQKPLMVMEYWSGWFDVWGELHHVFSAQEMISIVRELLD--RGVSINFYMFHGGSSFGFMSGAVDLGTYKPQTSSYDYDAPLTESGDYTTKYHLLRSLLSSYSKE-PILEPPAVQSRRVYEPVVVTQHISLWESLQCVETSFRADDPVSMENLPANNNNGQSYGYTLYQTDI------YSGGELNSR-NHVRDRALVFIDRE------LIGVLDYRTQKVKIPQSKSERTLSLLVENCGRVNYGPALDSQQKGLVGDITLENVPLKKFTMHCLDMKPGFINRLQSRKWTSVSEKPTYPAFFRGSLVVDQPTDTFIKLPNWSKGVVFVNGQNLGRHWSV-GPQKALYLPGPWLKTGENEIIVFE----EFKATETIHFAENP 586          
BLAST of Beta-galactosidase vs. Ensembl Xenopus
Match: bcar1 (BCAR1, Cas family scaffold protein [Source:Xenbase;Acc:XB-GENE-955189])

HSP 1 Score: 530.406 bits (1365), Expect = 5.027e-180
Identity = 285/644 (44.25%), Postives = 401/644 (62.27%), Query Frame = 1
Query:  178 EPNFST-KISLLTDKGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVP---DYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGS-----LRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN------ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLG-YNTVRLFELEGANC-QGNCTIEFVDEPILD 2055
             P F T K+  L D   S+RTF IDF +N F KDG+PFRYISGS+ Y+R+P+YYW DRLLKMK AGL+AI  Y+PWN+HE + G+YNF G+ D+  FL +A ++ LLV+LR+GPY+C EWD GGLPAWLL K   ++LRSSD DYL +V  W  V LP +KP LY N GPI+ VQVENEYGS++TCD NYLR L    R HLGD++++++TDG+G  Y+ CG+  + +++TVDFG     N    F   +  +PKGP VNSE+Y+GWLD WG  H+ V+T+ V + L  +  +    NVNMYMF GGT+FG+WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R  +       P  P+PP T K AYG + +E+V    + L  L      +  YP+T + + QY G+++Y T+            + I  S       + +  +D + +T  G       R   + +++T      L +L+E+ G +NFG+   ND KG++ NVT+N ++L NW  YP+ + +      +S++   + + + SAP                P DTF++   ++KG + INGFNLGRYW  +GPQ TL+VP+++L     N + + ELE + C  G C +EFVD+P+L+
Sbjct:   14 RPAFQTGKLLHLIDSTTSSRTFEIDFEHNCFRKDGQPFRYISGSIHYSRVPQYYWKDRLLKMKMAGLDAIYTYVPWNFHETKPGVYNFSGDHDIESFLKLANEIGLLVILRAGPYICAEWDMGGLPAWLLAKE-SIVLRSSDPDYLQAVDNWMGVFLPKMKPLLYHNGGPIISVQVENEYGSYFTCDYNYLRHLLQLFRHHLGDEVVLFTTDGSGLQYVRCGTI-QGLYTTVDFGPGS--NVTETFSVQRYCEPKGPLVNSEFYTGWLDHWGEPHSVVATEMVTKSLDEILAH--GANVNMYMFIGGTNFGYWNGANT-PYAPQPTSYDYDAPLSEAGDLTDKYFAVREVIKKYK-QIPEGPIPPTTPKYAYGEIKMEKVKTVTEALDILASHGAIQGTYPLTFDQMKQYFGFVLYRTT------------LPINCSNPTTLTTLSNGVRDRAYVTVNGVPQGVLERDKQTAINVTGVAGAELDLLVESMGRVNFGR-YNNDFKGLLTNVTLNGELLVNWTMYPLDIDSAVNGGLLSTIHIPYAS-AFSAPMFYKGSLIIPTGIPDLPQDTFIQFPGWTKGQIWINGFNLGRYWPVRGPQVTLYVPRSILTTTLVNNITVLELENSPCNSGKCVVEFVDKPVLN 635          
BLAST of Beta-galactosidase vs. Ensembl Xenopus
Match: bcar1 (BCAR1, Cas family scaffold protein [Source:Xenbase;Acc:XB-GENE-955189])

HSP 1 Score: 529.25 bits (1362), Expect = 1.086e-179
Identity = 285/644 (44.25%), Postives = 401/644 (62.27%), Query Frame = 1
Query:  178 EPNFST-KISLLTDKGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVP---DYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGS-----LRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN------ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLG-YNTVRLFELEGANC-QGNCTIEFVDEPILD 2055
             P F T K+  L D   S+RTF IDF +N F KDG+PFRYISGS+ Y+R+P+YYW DRLLKMK AGL+AI  Y+PWN+HE + G+YNF G+ D+  FL +A ++ LLV+LR+GPY+C EWD GGLPAWLL K   ++LRSSD DYL +V  W  V LP +KP LY N GPI+ VQVENEYGS++TCD NYLR L    R HLGD++++++TDG+G  Y+ CG+  + +++TVDFG     N    F   +  +PKGP VNSE+Y+GWLD WG  H+ V+T+ V + L  +  +    NVNMYMF GGT+FG+WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R  +       P  P+PP T K AYG + +E+V    + L  L      +  YP+T + + QY G+++Y T+            + I  S       + +  +D + +T  G       R   + +++T      L +L+E+ G +NFG+   ND KG++ NVT+N ++L NW  YP+ + +      +S++   + + + SAP                P DTF++   ++KG + INGFNLGRYW  +GPQ TL+VP+++L     N + + ELE + C  G C +EFVD+P+L+
Sbjct:   11 RPAFQTGKLLHLIDSTTSSRTFEIDFEHNCFRKDGQPFRYISGSIHYSRVPQYYWKDRLLKMKMAGLDAIYTYVPWNFHETKPGVYNFSGDHDIESFLKLANEIGLLVILRAGPYICAEWDMGGLPAWLLAKE-SIVLRSSDPDYLQAVDNWMGVFLPKMKPLLYHNGGPIISVQVENEYGSYFTCDYNYLRHLLQLFRHHLGDEVVLFTTDGSGLQYVRCGTI-QGLYTTVDFGPGS--NVTETFSVQRYCEPKGPLVNSEFYTGWLDHWGEPHSVVATEMVTKSLDEILAH--GANVNMYMFIGGTNFGYWNGANT-PYAPQPTSYDYDAPLSEAGDLTDKYFAVREVIKKYK-QIPEGPIPPTTPKYAYGEIKMEKVKTVTEALDILASHGAIQGTYPLTFDQMKQYFGFVLYRTT------------LPINCSNPTTLTTLSNGVRDRAYVTVNGVPQGVLERDKQTAINVTGVAGAELDLLVESMGRVNFGR-YNNDFKGLLTNVTLNGELLVNWTMYPLDIDSAVNGGLLSTIHIPYAS-AFSAPMFYKGSLIIPTGIPDLPQDTFIQFPGWTKGQIWINGFNLGRYWPVRGPQVTLYVPRSILTTTLVNNITVLELENSPCNSGKCVVEFVDKPVLN 632          
BLAST of Beta-galactosidase vs. Ensembl Xenopus
Match: bcar1 (BCAR1, Cas family scaffold protein [Source:Xenbase;Acc:XB-GENE-955189])

HSP 1 Score: 522.702 bits (1345), Expect = 3.665e-177
Identity = 278/625 (44.48%), Postives = 392/625 (62.72%), Query Frame = 1
Query:  232 RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVP---DYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGS-----LRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN------ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLG-YNTVRLFELEGANC-QGNCTIEFVDEPILD 2055
            RTF IDF +N F KDG+PFRYISGS+ Y+R+P+YYW DRLLKMK AGL+AI  Y+PWN+HE + G+YNF G+ D+  FL +A ++ LLV+LR+GPY+C EWD GGLPAWLL K   ++LRSSD DYL +V  W  V LP +KP LY N GPI+ VQVENEYGS++TCD NYLR L    R HLGD++++++TDG+G  Y+ CG+  + +++TVDFG     N    F   +  +PKGP VNSE+Y+GWLD WG  H+ V+T+ V + L  +  +    NVNMYMF GGT+FG+WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R  +       P  P+PP T K AYG + +E+V    + L  L      +  YP+T + + QY G+++Y T+            + I  S       + +  +D + +T  G       R   + +++T      L +L+E+ G +NFG+   ND KG++ NVT+N ++L NW  YP+ + +      +S++   + + + SAP                P DTF++   ++KG + INGFNLGRYW  +GPQ TL+VP+++L     N + + ELE + C  G C +EFVD+P+L+
Sbjct:   28 RTFEIDFEHNCFRKDGQPFRYISGSIHYSRVPQYYWKDRLLKMKMAGLDAIYTYVPWNFHETKPGVYNFSGDHDIESFLKLANEIGLLVILRAGPYICAEWDMGGLPAWLLAKE-SIVLRSSDPDYLQAVDNWMGVFLPKMKPLLYHNGGPIISVQVENEYGSYFTCDYNYLRHLLQLFRHHLGDEVVLFTTDGSGLQYVRCGTI-QGLYTTVDFGPGS--NVTETFSVQRYCEPKGPLVNSEFYTGWLDHWGEPHSVVATEMVTKSLDEILAH--GANVNMYMFIGGTNFGYWNGANT-PYAPQPTSYDYDAPLSEAGDLTDKYFAVREVIKKYK-QIPEGPIPPTTPKYAYGEIKMEKVKTVTEALDILASHGAIQGTYPLTFDQMKQYFGFVLYRTT------------LPINCSNPTTLTTLSNGVRDRAYVTVNGVPQGVLERDKQTAINVTGVAGAELDLLVESMGRVNFGR-YNNDFKGLLTNVTLNGELLVNWTMYPLDIDSAVNGGLLSTIHIPYAS-AFSAPMFYKGSLIIPTGIPDLPQDTFIQFPGWTKGQIWINGFNLGRYWPVRGPQVTLYVPRSILTTTLVNNITVLELENSPCNSGKCVVEFVDKPVLN 630          
BLAST of Beta-galactosidase vs. Ensembl Xenopus
Match: bcar1 (BCAR1, Cas family scaffold protein [Source:Xenbase;Acc:XB-GENE-955189])

HSP 1 Score: 521.161 bits (1341), Expect = 9.815e-177
Identity = 280/627 (44.66%), Postives = 393/627 (62.68%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVP---DYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGS-----LRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN------ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLG-YNTVRLFELEGANC-QGNCTIEFVDEPILD 2055
            S+RTF IDF +N F KDG+PFRYISGS+ Y+R+P+YYW DRLLKMK AGL+AI  Y+PWN+HE + G+YNF G+ D+  FL +A ++ LLV+LR+GPY+C EWD GGLPAWLL K   ++LRSSD DYL +V  W  V LP +KP LY N GPI+ VQVENEYGS++TCD NYLR L    R HLGD++++++TDG+G  Y+ CG+  + +++TVDFG     N    F   +  +PKGP VNSE+Y+GWLD WG  H+ V+T+ V + L  +  +    NVNMYMF GGT+FG+WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A  N  L      P  P+PP T K AYG + +E+V    + L  L      +  YP+T + + QY G+++Y T+            + I  S       + +  +D + +T  G       R   + +++T      L +L+E+ G +NFG+   ND KG++ NVT+N ++L NW  YP+ + +      +S++   + + + SAP                P DTF++   ++KG + INGFNLGRYW  +GPQ TL+VP+++L     N + + ELE + C  G C +EFVD+P+L+
Sbjct:   14 SSRTFEIDFEHNCFRKDGQPFRYISGSIHYSRVPQYYWKDRLLKMKMAGLDAIYTYVPWNFHETKPGVYNFSGDHDIESFLKLANEIGLLVILRAGPYICAEWDMGGLPAWLLAKE-SIVLRSSDPDYLQAVDNWMGVFLPKMKPLLYHNGGPIISVQVENEYGSYFTCDYNYLRHLLQLFRHHLGDEVVLFTTDGSGLQYVRCGTI-QGLYTTVDFGPGS--NVTETFSVQRYCEPKGPLVNSEFYTGWLDHWGEPHSVVATEMVTKSLDEILAH--GANVNMYMFIGGTNFGYWNGANT-PYAPQPTSYDYDAPLSEAGDLTDKYFA--NLGLIFQFKIPEGPIPPTTPKYAYGEIKMEKVKTVTEALDILASHGAIQGTYPLTFDQMKQYFGFVLYRTT------------LPINCSNPTTLTTLSNGVRDRAYVTVNGVPQGVLERDKQTAINVTGVAGAELDLLVESMGRVNFGR-YNNDFKGLLTNVTLNGELLVNWTMYPLDIDSAVNGGLLSTIHIPYAS-AFSAPMFYKGSLIIPTGIPDLPQDTFIQFPGWTKGQIWINGFNLGRYWPVRGPQVTLYVPRSILTTTLVNNITVLELENSPCNSGKCVVEFVDKPVLN 617          
BLAST of Beta-galactosidase vs. Ensembl Xenopus
Match: bcar1 (BCAR1, Cas family scaffold protein [Source:Xenbase;Acc:XB-GENE-955189])

HSP 1 Score: 521.931 bits (1343), Expect = 1.174e-176
Identity = 277/627 (44.18%), Postives = 392/627 (62.52%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVP---DYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGS-----LRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN------ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLG-YNTVRLFELEGANC-QGNCTIEFVDEPILD 2055
            +  TF IDF +N F KDG+PFRYISGS+ Y+R+P+YYW DRLLKMK AGL+AI  Y+PWN+HE + G+YNF G+ D+  FL +A ++ LLV+LR+GPY+C EWD GGLPAWLL K   ++LRSSD DYL +V  W  V LP +KP LY N GPI+ VQVENEYGS++TCD NYLR L    R HLGD++++++TDG+G  Y+ CG+  + +++TVDFG     N    F   +  +PKGP VNSE+Y+GWLD WG  H+ V+T+ V + L  +  +    NVNMYMF GGT+FG+WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R  +       P  P+PP T K AYG + +E+V    + L  L      +  YP+T + + QY G+++Y T+            + I  S       + +  +D + +T  G       R   + +++T      L +L+E+ G +NFG+   ND KG++ NVT+N ++L NW  YP+ + +      +S++   + + + SAP                P DTF++   ++KG + INGFNLGRYW  +GPQ TL+VP+++L     N + + ELE + C  G C +EFVD+P+L+
Sbjct:   41 TTTTFEIDFEHNCFRKDGQPFRYISGSIHYSRVPQYYWKDRLLKMKMAGLDAIYTYVPWNFHETKPGVYNFSGDHDIESFLKLANEIGLLVILRAGPYICAEWDMGGLPAWLLAKE-SIVLRSSDPDYLQAVDNWMGVFLPKMKPLLYHNGGPIISVQVENEYGSYFTCDYNYLRHLLQLFRHHLGDEVVLFTTDGSGLQYVRCGTI-QGLYTTVDFGPGS--NVTETFSVQRYCEPKGPLVNSEFYTGWLDHWGEPHSVVATEMVTKSLDEILAH--GANVNMYMFIGGTNFGYWNGANT-PYAPQPTSYDYDAPLSEAGDLTDKYFAVREVIKKYK-QIPEGPIPPTTPKYAYGEIKMEKVKTVTEALDILASHGAIQGTYPLTFDQMKQYFGFVLYRTT------------LPINCSNPTTLTTLSNGVRDRAYVTVNGVPQGVLERDKQTAINVTGVAGAELDLLVESMGRVNFGR-YNNDFKGLLTNVTLNGELLVNWTMYPLDIDSAVNGGLLSTIHIPYAS-AFSAPMFYKGSLIIPTGIPDLPQDTFIQFPGWTKGQIWINGFNLGRYWPVRGPQVTLYVPRSILTTTLVNNITVLELENSPCNSGKCVVEFVDKPVLN 645          
BLAST of Beta-galactosidase vs. Ensembl Mouse
Match: Glb1 (galactosidase, beta 1 [Source:MGI Symbol;Acc:MGI:88151])

HSP 1 Score: 520.005 bits (1338), Expect = 2.338e-176
Identity = 285/634 (44.95%), Postives = 392/634 (61.83%), Query Frame = 1
Query:  223 LSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPI--------HLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS--------PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CTIEFVDEPIL 2052
            ++ RTF +D++ + FLKDG+PFRYISGS+ Y RIP +YW DRLLKMK AGLNAIQ Y+PWN+HE + G Y F G+ D+  F+ +A +L LLV+LR GPY+C EWD GGLPAWLL+K   ++LRSSD DYL +V KW +VLLP +KP LYQN GPI+ VQVENEYGS++ CD +YLR L    R HLG+D+I+++TDG     L CG+  + +++TVDFGT    N   AF   ++++PKGP +NSE+Y+GWLD WG  H+ V T  +   L  L   +   NVN+YMF GGT+F +WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R  ++ +  + P  P+PP+T K AYG + L +   V + L  L      KS YP+T   + QY GY++Y T+  +  S          F+ + D AY+         +      R  M+ L++  K    L +L+EN G +N+G+  IND KG+I N+T+N  +L+NW  +P+        HL    +  +   +   ++ +   +    +    S        P DTF++   +SKG V INGFNLGRYW T GPQ TLFVP+ +L     N + + ELE A C       CT+EFVD P++
Sbjct:   28 VTQRTFKLDYSRDRFLKDGQPFRYISGSIHYFRIPRFYWEDRLLKMKMAGLNAIQMYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVILRPGPYICAEWDMGGLPAWLLEKQ-SIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGPIITVQVENEYGSYFACDYDYLRFLVHRFRYHLGNDVILFTTDGASEKMLKCGTL-QDLYATVDFGTGN--NITQAFLVQRKFEPKGPLINSEFYTGWLDHWGKPHSTVKTKTLATSLYNL--LARGANVNLYMFIGGTNFAYWNGANT-PYEPQPTSYDYDAPLSEAGDLTKKYFALRE-VIQMFKEVPEGPIPPSTPKFAYGKVALRKFKTVAEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYRTTLPQDCSN-PKPIFSSPFNGVRDRAYVSVDGVPQGILD-----RNLMTALNIRGKAGATLDILVENMGRVNYGR-FINDFKGLISNMTINSTVLTNWTVFPLNTEAMVRNHLWGREASDEGHLDGRSTSNSSDLILPTFYVGNFSIPSGIPDLPQDTFIQFPGWSKGQVWINGFNLGRYWPTMGPQKTLFVPRNILTTSAPNNITVLELEFAPCSEGTPELCTVEFVDTPVI 646          
BLAST of Beta-galactosidase vs. Ensembl Mouse
Match: Glb1l (galactosidase, beta 1-like [Source:MGI Symbol;Acc:MGI:1921827])

HSP 1 Score: 439.499 bits (1129), Expect = 5.146e-145
Identity = 262/621 (42.19%), Postives = 368/621 (59.26%), Query Frame = 1
Query:  232 RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDP-PYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILE---QVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTM-SDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS---PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVL-KLGYNTVRLFELEGANCQGNCTIEFVDEPILDGPVH 2067
            R+F +D  ++ FL DG PFRY+SGS+ Y R+P   W DRLLKM+ +GLNA+QFY+PWNYHE E GIYNF G+ DL  FL  A K++LLV+LR GPY+C EW+ GGLP+WLL +NP + LR+SD  +L +V  W+ VLLP I P LY N G I+ +QVENEYGS+  CD  Y+R L    R+ LGD I++++TDG     L CGS  + +++T+DFG   A N    F  L+ ++P GP VNSEYY+GWLD WG  H+  S+  V +GL+ +    +  +VNMYMFHGGT+FG+WNGA++   +LP  +SYDYDAP+SEAGD T K  AIRN +     + P  P+PP + K  +GPL +     +  +L  L  Q    S  P+T E++    G+M+Y T  +    E +     +  + I D AY+             G L R++  +L LT  +   L +L+EN G ++FG    +D KG++    +   IL+ WM +P+ +  +       Q    + P    +               DTFL    ++KG V INGFNLGRYW  +GPQ TL+VP+ +L     N + L ELE  N   N  ++F+D+PIL+  +H
Sbjct:   24 RSFVVDREHDRFLLDGVPFRYVSGSLHYFRVPPVLWADRLLKMQLSGLNAVQFYVPWNYHEPEPGIYNFNGSRDLIAFLNEAAKVNLLVILRPGPYICAEWEMGGLPSWLL-RNPNIHLRTSDPAFLEAVDSWFKVLLPKIYPFLYHNGGNIISIQVENEYGSYKACDFKYMRHLAGLFRALLGDKILLFTTDGP--HGLRCGSL-QGLYTTIDFGP--ADNVTRIFSLLREYEPHGPLVNSEYYTGWLDYWGQNHSTRSSPAVAQGLEKMLK--LGASVNMYMFHGGTNFGYWNGADEKGRFLPITTSYDYDAPISEAGDPTPKLFAIRNVISKFQ-EIPLGPLPPPSPKMKFGPLTMSLDGNLLSFLDFLCPQGPIHSVLPLTFEAVKLDHGFMLYRTYLTSPVLEPT--PFWVPNNGIHDRAYVMVDG------VLKGVLERSLKQELYLTGTVGTRLDILLENMGRLSFGSNH-SDFKGLLEAPLLGQTILTEWMMFPLKVDKLVKWWFPLQLMKRALPQASSVPAFYSAKFPVFGLLGDTFLYLPGWTKGQVWINGFNLGRYWTMRGPQQTLYVPRLLLFGRSINKITLLELE--NVPHNPQVQFLDKPILNSTLH 624          
BLAST of Beta-galactosidase vs. Ensembl Mouse
Match: Glb1l (galactosidase, beta 1-like [Source:MGI Symbol;Acc:MGI:1921827])

HSP 1 Score: 439.499 bits (1129), Expect = 5.146e-145
Identity = 262/621 (42.19%), Postives = 368/621 (59.26%), Query Frame = 1
Query:  232 RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDP-PYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILE---QVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTM-SDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS---PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVL-KLGYNTVRLFELEGANCQGNCTIEFVDEPILDGPVH 2067
            R+F +D  ++ FL DG PFRY+SGS+ Y R+P   W DRLLKM+ +GLNA+QFY+PWNYHE E GIYNF G+ DL  FL  A K++LLV+LR GPY+C EW+ GGLP+WLL +NP + LR+SD  +L +V  W+ VLLP I P LY N G I+ +QVENEYGS+  CD  Y+R L    R+ LGD I++++TDG     L CGS  + +++T+DFG   A N    F  L+ ++P GP VNSEYY+GWLD WG  H+  S+  V +GL+ +    +  +VNMYMFHGGT+FG+WNGA++   +LP  +SYDYDAP+SEAGD T K  AIRN +     + P  P+PP + K  +GPL +     +  +L  L  Q    S  P+T E++    G+M+Y T  +    E +     +  + I D AY+             G L R++  +L LT  +   L +L+EN G ++FG    +D KG++    +   IL+ WM +P+ +  +       Q    + P    +               DTFL    ++KG V INGFNLGRYW  +GPQ TL+VP+ +L     N + L ELE  N   N  ++F+D+PIL+  +H
Sbjct:   24 RSFVVDREHDRFLLDGVPFRYVSGSLHYFRVPPVLWADRLLKMQLSGLNAVQFYVPWNYHEPEPGIYNFNGSRDLIAFLNEAAKVNLLVILRPGPYICAEWEMGGLPSWLL-RNPNIHLRTSDPAFLEAVDSWFKVLLPKIYPFLYHNGGNIISIQVENEYGSYKACDFKYMRHLAGLFRALLGDKILLFTTDGP--HGLRCGSL-QGLYTTIDFGP--ADNVTRIFSLLREYEPHGPLVNSEYYTGWLDYWGQNHSTRSSPAVAQGLEKMLK--LGASVNMYMFHGGTNFGYWNGADEKGRFLPITTSYDYDAPISEAGDPTPKLFAIRNVISKFQ-EIPLGPLPPPSPKMKFGPLTMSLDGNLLSFLDFLCPQGPIHSVLPLTFEAVKLDHGFMLYRTYLTSPVLEPT--PFWVPNNGIHDRAYVMVDG------VLKGVLERSLKQELYLTGTVGTRLDILLENMGRLSFGSNH-SDFKGLLEAPLLGQTILTEWMMFPLKVDKLVKWWFPLQLMKRALPQASSVPAFYSAKFPVFGLLGDTFLYLPGWTKGQVWINGFNLGRYWTMRGPQQTLYVPRLLLFGRSINKITLLELE--NVPHNPQVQFLDKPILNSTLH 624          
BLAST of Beta-galactosidase vs. Ensembl Mouse
Match: Glb1 (galactosidase, beta 1 [Source:MGI Symbol;Acc:MGI:88151])

HSP 1 Score: 314.694 bits (805), Expect = 1.487e-101
Identity = 152/285 (53.33%), Postives = 200/285 (70.18%), Query Frame = 1
Query:  388 FYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINP 1242
             Y+PWN+HE + G Y F G+ D+  F+ +A +L LLV+LR GPY+C EWD GGLPAWLL+K   ++LRSSD DYL +V KW +VLLP +KP LYQN GPI+ VQVENEYGS++ CD +YLR L    R HLG+D+I+++TDG     L CG+  + +++TVDFGT    N   AF   ++++PKGP +NSE+Y+GWLD WG  H+ V T  +   L  L   +   NVN+YMF GGT+F +WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R  +  + P
Sbjct:    1 MYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVILRPGPYICAEWDMGGLPAWLLEKQ-SIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGPIITVQVENEYGSYFACDYDYLRFLVHRFRYHLGNDVILFTTDGASEKMLKCGTL-QDLYATVDFGTGN--NITQAFLVQRKFEPKGPLINSEFYTGWLDHWGKPHSTVKTKTLATSLYNL--LARGANVNLYMFIGGTNFAYWNGANT-PYEPQPTSYDYDAPLSEAGDLTKKYFALREVIQMVGP 278          
BLAST of Beta-galactosidase vs. Ensembl Mouse
Match: Glb1l2 (galactosidase, beta 1-like 2 [Source:MGI Symbol;Acc:MGI:2388283])

HSP 1 Score: 294.664 bits (753), Expect = 1.656e-89
Identity = 216/632 (34.18%), Postives = 325/632 (51.42%), Query Frame = 1
Query:  184 NFSTKISL-LTDKGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGA---NDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGF-----KSPYPITMESL------NQYQGYMIYFTS--TSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLF-VLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS--PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFE--LEGANCQ 2013
            N+ST + L L  + L  RT   DF     L+D   F+ + GS+ Y R+P  YW DRLLK+KA GLN +  Y+PWN HE E G ++F GN DL  F+ +A K+ L V+LR GPY+C E D GGLP+WLL ++P M LR++   +  +V  ++  L+  + P  Y++ GPI+ VQVENEYGS Y  D  Y+  +   +      ++++ S + +G   L  G  D  + +T++  +       +    L   Q   P++  EY++GW DSWG  HN + + +V++ +  +     S  +N+YMFHGGT+FGF NGA   ND  Y   ++SYDYDA L+EAGD T+KY  +R    +++   P  P    T K  Y P+     P     L   + +      S  PI ME+L       Q  GY++Y T+  +S   S       ++  +R+                  IG L    + +++ +     +  +L+EN G +N+G  + +  KG+IGN+ +N+K L N+  Y + +           N SV              ++    P DTFLK   + KGVV +NG NLGRYWN  GPQ TL++P   L  G N V +FE  + G+  Q
Sbjct:   31 NWSTLVPLWLQHQRLGLRTKGPDF----ILED-SIFQILGGSIHYFRVPREYWRDRLLKLKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFIQLAAKIGLWVILRPGPYICSEIDLGGLPSWLL-QDPDMKLRTTYHGFTKAVDLYFDHLMSRVVPLQYKHGGPIIAVQVENEYGS-YNKDRAYMPYIKKALEDRGIIEMLLTSDNKDG---LEKGVVD-GVLATINLQSQQELMALNTV--LLSIQGIQPKMVMEYWTGWFDSWGGSHNILDSSEVLQTVSAIIKDGSS--INLYMFHGGTNFGFINGAMHFND--YKADVTSYDYDAILTEAGDYTAKYTKLRELFGTVSGIPPPPPPEL-TAKMVYEPM----SPALYLSLWDAIQYMDKPVTSETPINMENLPVNNGNGQAFGYVLYETTIFSSGVLSGLVRDRGQVFLNRVS-----------------IGFLDYKTTKITIPLTQGYTILRILVENRGRVNYGNNIDSQRKGLIGNLYLNNKALKNFKIYSLDMTKQFLQRFDMDNWSVIPKELTFPAFFLGALSVGIYPSDTFLKLEGWVKGVVFVNGHNLGRYWNV-GPQETLYLPGVWLDKGINKVIIFEETMSGSMVQ 622          
BLAST of Beta-galactosidase vs. UniProt/SwissProt
Match: sp|P23780|BGAL_MOUSE (Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1)

HSP 1 Score: 520.005 bits (1338), Expect = 1.636e-175
Identity = 285/634 (44.95%), Postives = 392/634 (61.83%), Query Frame = 1
Query:  223 LSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPI--------HLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS--------PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CTIEFVDEPIL 2052
            ++ RTF +D++ + FLKDG+PFRYISGS+ Y RIP +YW DRLLKMK AGLNAIQ Y+PWN+HE + G Y F G+ D+  F+ +A +L LLV+LR GPY+C EWD GGLPAWLL+K   ++LRSSD DYL +V KW +VLLP +KP LYQN GPI+ VQVENEYGS++ CD +YLR L    R HLG+D+I+++TDG     L CG+  + +++TVDFGT    N   AF   ++++PKGP +NSE+Y+GWLD WG  H+ V T  +   L  L   +   NVN+YMF GGT+F +WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R  ++ +  + P  P+PP+T K AYG + L +   V + L  L      KS YP+T   + QY GY++Y T+  +  S          F+ + D AY+         +      R  M+ L++  K    L +L+EN G +N+G+  IND KG+I N+T+N  +L+NW  +P+        HL    +  +   +   ++ +   +    +    S        P DTF++   +SKG V INGFNLGRYW T GPQ TLFVP+ +L     N + + ELE A C       CT+EFVD P++
Sbjct:   28 VTQRTFKLDYSRDRFLKDGQPFRYISGSIHYFRIPRFYWEDRLLKMKMAGLNAIQMYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVILRPGPYICAEWDMGGLPAWLLEKQ-SIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGPIITVQVENEYGSYFACDYDYLRFLVHRFRYHLGNDVILFTTDGASEKMLKCGTL-QDLYATVDFGTGN--NITQAFLVQRKFEPKGPLINSEFYTGWLDHWGKPHSTVKTKTLATSLYNL--LARGANVNLYMFIGGTNFAYWNGANT-PYEPQPTSYDYDAPLSEAGDLTKKYFALRE-VIQMFKEVPEGPIPPSTPKFAYGKVALRKFKTVAEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYRTTLPQDCSN-PKPIFSSPFNGVRDRAYVSVDGVPQGILD-----RNLMTALNIRGKAGATLDILVENMGRVNYGR-FINDFKGLISNMTINSTVLTNWTVFPLNTEAMVRNHLWGREASDEGHLDGRSTSNSSDLILPTFYVGNFSIPSGIPDLPQDTFIQFPGWSKGQVWINGFNLGRYWPTMGPQKTLFVPRNILTTSAPNNITVLELEFAPCSEGTPELCTVEFVDTPVI 646          
BLAST of Beta-galactosidase vs. UniProt/SwissProt
Match: sp|Q58D55|BGAL_BOVIN (Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1)

HSP 1 Score: 520.005 bits (1338), Expect = 2.573e-175
Identity = 293/639 (45.85%), Postives = 395/639 (61.82%), Query Frame = 1
Query:  217 KGLSN---RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPI--------HLANISSVTDSFQN-------PSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CTIEFVDEPIL 2052
            +GL N   RTF ID+  N FLKDG+PFRYISGS+ Y R+P +YW DRLLKMK AGLNAIQ Y+ WN+HE + G YNF G+ D+  F+ +A +L LLV+LR GPY+C EWD GGLPAWLL+K   ++LRSSD DYL++V KW  VLLP ++P LY+N GPI+ VQVENEYGS+ +CD +YLR L      HLG+D+++++TDG     L CG+  + +++TVDF  S   N  +AF   ++++P GP VNSE+Y+GWLD WG RH+ VS+  V   L  +   ++  NVNMYMF GGT+F +WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R+ +       P  P+PP+T K AYG + L +   V D L  L      KS YP+T   + QY G+++Y T   E  S+ +   +    S + D AY+ S N     I      R ++  L++T K    L +L+EN G +N+G   IND KG++ N+T+  KIL+NW  +P+        HL         + N       P+ + PT               P DTF++   ++KG V INGFNLGRYW  +GPQ TLFVP+ +L     NT+ + ELE A CQ      CT+EFVD+P+ 
Sbjct:   21 RGLHNATQRTFQIDYRRNRFLKDGQPFRYISGSIHYFRVPRFYWKDRLLKMKMAGLNAIQTYVAWNFHELQPGRYNFSGDHDVEHFIQLAHELGLLVILRPGPYICAEWDMGGLPAWLLEKK-SIVLRSSDPDYLAAVDKWLGVLLPKMRPLLYKNGGPIITVQVENEYGSYLSCDYDYLRFLQKRFHDHLGEDVLLFTTDGVNERLLQCGAL-QGLYATVDF--SPGTNLTAAFMLQRKFEPTGPLVNSEFYTGWLDHWGQRHSTVSSKAVAFTLHDM--LALGANVNMYMFIGGTNFAYWNGANI-PYQPQPTSYDYDAPLSEAGDLTEKYFALRDIIQKFA-KVPEGPIPPSTPKFAYGKVALNKLKTVEDALNILCPSGPIKSVYPLTFIDVKQYFGFVLYRTMLPEDCSDPT--PLSSPLSGVHDRAYV-SVNGVAQGILE----RESVITLNITGKAGATLDLLVENMGRVNYGSS-INDFKGLVSNLTLGSKILTNWEIFPLDMEDAVRSHLGTWGGRDRGYHNKARAHSPPTYALPTFYVGNFTIPSGIADLPQDTFIQFPGWTKGQVWINGFNLGRYWPVRGPQMTLFVPQHILVTSTPNTIVVLELEHAPCQDGGPELCTVEFVDKPVF 643          
BLAST of Beta-galactosidase vs. UniProt/SwissProt
Match: sp|O19015|BGAL_FELCA (Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1)

HSP 1 Score: 516.538 bits (1329), Expect = 7.622e-174
Identity = 289/638 (45.30%), Postives = 392/638 (61.44%), Query Frame = 1
Query:  217 KGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRT-MSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPI--------HLANISSVTDSFQNPSVSAPXXXXXXXXX---------XXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CTIEFVDEPIL 2052
            +  S RTF ID+ +N FLKDG+PFRYISGS+ Y R+P +YW DRLLKMK AGLNAIQ Y+PWN+HE + G Y F G  D+  FL +A +L LLV+LR GPY+C EWD GGLPAWLL K   +ILRSSD DYL++V KW  VLLP +KP LYQN GPI+ VQVENEYGS++TCD +YLR L    R HLG D+++++TDG    +L CG+  + I++TVDFG     N  +AF+  ++ +P+GP VNSE+Y+GWLD WG  H++V T+ V   L  +  +    NVN+YMF GGT+F +WNGAN  PY PQ +SYDYDAPLSEAGD+T KY A+R+ +       P   +PP+T K AYG + L++   V D L  L      KS YP+T   + QY G+++Y T+  +  S  +   +    + + D AY+             G L R+ +  L++T +    L +L+EN G +N+G+  IND KG+I N+T+   +L++WM +P+        HL          Q+    A                     +   P DTF++ S ++KG V INGFNLGRYW  +GPQ TLFVP+ +L     NT+ + ELE A C  N    CT+EFVD P++
Sbjct:   26 RNASQRTFKIDYGHNRFLKDGQPFRYISGSIHYFRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPQPGQYQFSGEHDVEYFLKLAHELGLLVILRPGPYICAEWDMGGLPAWLLLKE-SIILRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPIITVQVENEYGSYFTCDYDYLRFLQRRFRDHLGGDVLLFTTDGAHEKFLQCGAL-QGIYATVDFGPDA--NITAAFQIQRKSEPRGPLVNSEFYTGWLDHWGQPHSRVRTEVVASSLHDVLAH--GANVNLYMFIGGTNFAYWNGANI-PYQPQPTSYDYDAPLSEAGDLTDKYFALRDVIRKFE-KVPEGFIPPSTPKFAYGKVALQKLKTVEDALNVLCPAGPIKSLYPLTFIQVKQYFGFVLYRTTLPQDCS--NPTPLSSPLNGVRDRAYVAVDGVPQ------GVLERSYVITLNITGQAGATLDLLVENMGRVNYGR-YINDFKGLISNLTLGSSVLTDWMIFPLDTEDAVRSHLGGWHGRNHGRQDNKAFAHHSSNYTLPAFYAGNFSIPSGIPDLPQDTFIQFSGWTKGQVWINGFNLGRYWPGRGPQVTLFVPRHILVTSAPNTIMVLELERAPCDDNGPELCTVEFVDRPLI 646          
BLAST of Beta-galactosidase vs. UniProt/SwissProt
Match: sp|Q9TRY9|BGAL_CANLF (Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3)

HSP 1 Score: 513.072 bits (1320), Expect = 1.889e-172
Identity = 285/636 (44.81%), Postives = 392/636 (61.64%), Query Frame = 1
Query:  217 KGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPI-------------HLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPD---DTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CTIEFVDEPIL 2052
            +  S RTFTID+++N FLKDG+PFRYISGS+ Y+R+P +YW DRLLKMK AGLNAIQ Y+PWN+HE + G Y F G  D+  F+ +A +L LLV+LR GPY+C EWD GGLPAWLL K   +ILRSSD DYL++V KW  VLLP +KP LYQN GPI+ +QVENEYGS++TCD +YLR L      HLG+D+++++TDG    +L CG+  + +++TVDFG     N  +AF+  ++ +PKGP VNSE+Y+GWLD WG  H+ V T+ V   L  +  +    NVN+YMF GGT+F +WNGAN  PY  Q +SYDYDAPLSEAGD+T KY A+R  +       P   +PP+T K AYG + L++   V + L  L       S YP+T   + QY G+++Y T+  +  S+ +   +    S + D AY+         +      R  +  L++T K    L +L+EN G +N+G+  IND KG+I N+T+   IL+NWM +P+             H  N      +F + S +              +  PD   DTF++   ++KG V INGFNLGRYW  +GPQ TLFVP+ +L     NT+ + ELE A C  +    CT+EFVD P++
Sbjct:   26 RNASQRTFTIDYSHNRFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPQPGQYQFSGEQDVEYFIKLAHELGLLVILRPGPYICAEWDMGGLPAWLLLKE-SIILRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPIITMQVENEYGSYFTCDYDYLRFLQKLFHHHLGNDVLLFTTDGANEKFLQCGAL-QGLYATVDFGPGA--NITAAFQIQRKSEPKGPLVNSEFYTGWLDHWGQPHSTVRTEVVASSLHDILAH--GANVNLYMFIGGTNFAYWNGANM-PYQAQPTSYDYDAPLSEAGDLTEKYFALREVIRKFE-KVPEGFIPPSTPKFAYGKVALKKLKTVEEALNVLCPPGPINSLYPLTFIQVKQYFGFVMYRTTLPQDCSDPT--PLSSPLSGVHDRAYVSVDGVPQGVME-----RSNVITLNITGKAGATLDLLVENMGRVNYGR-YINDFKGLISNLTLGSSILTNWMIFPLNTEDAVRSHLGGWHGPNNGRHDKTFAHRSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQMTLFVPRHILVTSTPNTIMVLELEHAPCGDSGPEVCTVEFVDRPVI 645          
BLAST of Beta-galactosidase vs. UniProt/SwissProt
Match: sp|Q5R7P4|BGAL_PONAB (Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 1.053e-169
Identity = 278/643 (43.23%), Postives = 390/643 (60.65%), Query Frame = 1
Query:  217 KGLSN---RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPI--------HLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS--------PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CTIEFVDEPILDGPV 2064
            +GL N   R F ID++ + FLKDG+PFRYISGS+ Y+R+P +YW DRLLKMK AGLNAIQ Y+PWN+HE   G Y F  + D+  FL +A +L LLV+LR GPY+C EW+ GGLPAWLL+K   ++LRSSD DYL++V KW  VLLP +KP LYQN GP++ VQVENEYGS++ CD +YLR L    R HLGDD+++++TDG   ++L CG+  + +++TVDFGT    N   AF   ++ +PKGP +NSE+Y+GWLD WG  H+ + T+ V   L  +   +   +VN+YMF GGT+F +WNGAN  PY  Q +SYDYDAPLSEAGD+T KY A+RN +       P  P+PP+T K AYG + LE+   V   L  L      KS YP+T   + Q+ G+++Y T+  +  S  +   +   F+ + D AY+         +      R  +  L++T K    L +L+EN G +N+G   IND KG++ N+T++  IL++W  +P+        HL           + + +  +        +    S        P DTF++   ++KG V INGFNLGRYW  +GPQ TLFVP+ +L     NT+ + ELE A C  +    C + FVD P++   V
Sbjct:   22 RGLRNATQRMFEIDYSRDCFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLQLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKE-SILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKCFRHHLGDDVVLFTTDGAHKTFLKCGAL-QGLYTTVDFGTGS--NITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDI--LARGASVNLYMFIGGTNFAYWNGANT-PYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFE-KVPEGPIPPSTPKFAYGKVALEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCS--NPAPLSSPFNGVHDRAYVAVDGIPQGVLE-----RNNVITLNITGKAGATLDLLVENMGRVNYG-AYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHSSSNYTLPAFYVGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITMLELERAPCSNDDPELCAVTFVDRPVIGSSV 648          
BLAST of Beta-galactosidase vs. TrEMBL
Match: G3VDU9 (Beta-galactosidase OS=Sarcophilus harrisii OX=9305 GN=GLB1 PE=3 SV=1)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 301/626 (48.08%), Postives = 399/626 (63.74%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN-----ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS--PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKL-GYNTVRLFELEGANC--QGNCTIEFVDEPILDGPV 2064
            +NRTFTID+  + FLKDGKPFRYISGS+ Y+RIP +YW DRL KMK AGLNAI+ Y+PWN+HE   G Y F G  DL  FL +  ++ LLV+LR GPY+C EWD GGLP WLL+K   + LRSSD DYL +V KW  VLLP +KP+LYQN GPI+ VQVENEYGS++ CD NYLR L    R HLG+++++++TDG G +YL CG+  + +++TVDFGTS   N   AF   ++ +PKGP VNSE+Y+GWLD WG  H  VST ++V  L  +   S   NVN+YMF GGT+FGFWNGAN  PYLPQ +SYDYDAPLSEAGD+T KY A+R A+       P  P+PP+T K AYG + ++Q   V D L  L     F S YP+T   + QY G+++Y T   +  SE     +      + D AY+ S N  +  I      R  +  +++T K  + L VL+EN G INFG+  IND KG+I N+T+   +L +W+ +P+ L N     +     S  NPS S      +   +        P DTF++  +++KG V INGFNLGRYW  +GPQ TL+VP+ +L     N + + ELE + C  Q  C +E VD+PIL+GP+
Sbjct:   26 ANRTFTIDYEGDQFLKDGKPFRYISGSIHYSRIPRFYWKDRLFKMKMAGLNAIETYVPWNFHEPFPGQYQFSGEQDLEYFLQLVHEVGLLVILRPGPYICAEWDMGGLPVWLLEKK-SIFLRSSDPDYLKAVDKWLEVLLPKMKPYLYQNGGPIITVQVENEYGSYFACDYNYLRFLLKVFRQHLGEEVVLFTTDGAGENYLKCGTL-QDLYATVDFGTSS--NITQAFMIQRKVEPKGPLVNSEFYTGWLDHWGESHQTVSTKNIVASLTDM--LSRGANVNLYMFIGGTNFGFWNGANM-PYLPQPTSYDYDAPLSEAGDLTEKYYAVREAIGKFE-KLPEGPIPPSTPKFAYGKVAMKQVNTVQDSLDVLCPAGPFNSTYPLTFVQMKQYFGFVLYRTILPKNCSE--PVLLSSPLGGVHDRAYV-SVNGVSQGILE----RNRVLSINITGKAGDTLDVLVENLGRINFGED-INDFKGLISNLTLGSDVLKDWLMFPLDLQNEVDPDLEKKVTSRSNPSNSTLPSFYVGQFSIPSGIPDFPQDTFIQFPDWTKGQVWINGFNLGRYWPGRGPQVTLYVPRHILVTSALNNITVLELERSPCESQQRCFVEMVDKPILNGPL 635          
BLAST of Beta-galactosidase vs. TrEMBL
Match: A0A0R3W9I1 (Beta-galactosidase OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7110 PE=3 SV=2)

HSP 1 Score: 534.643 bits (1376), Expect = 5.000e-179
Identity = 288/620 (46.45%), Postives = 387/620 (62.42%), Query Frame = 1
Query:  220 GLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPD-HPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTM-KLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSA---PXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGAN--CQGN---CTIEFVDEPI 2049
            G S+RTF+ID  N VFLKDG+PFRYISGS+ Y RIP  YW DRL+K K+AGL+AIQ YIPWNYHE   G Y F    D+ +F+ +A+K+ LLVL+R+GPY+C EWDFGGLP WL+  NP++ LRSSD +Y+  V++W+  LLP +KP +YQN GPI+M+Q+ENEYGS+ TCD  YL  LY+  R  LGD+II+Y+TDG+    L CGSSDRR+F+TVDFG  GA +PA  F+ L+++QP GP VNSEYYSGWLD WG + + V    +  G   L+N S  V+ N+YMFHGGT+FG WNGAN P     I+SYDYDAP+SEAGDIT+KYL +++    +     P  P P N +K  YG + L+     L+ L  Q G  S  P+ ME+L QYQG M Y T       E       + F  + D   +F+++     I + GS+    S L++TM K    L V+ E  GHIN+G  M  DVKGI+G V ++ K L NWM   +    ++        P       P  G ++ G F V + P DTF   + F++G + +NG  +GRY+ + GPQ +L+VP ++L  G N V + EL+     C  N   C + F D P+
Sbjct:   10 GKSSRTFSIDRENGVFLKDGEPFRYISGSLHYFRIPRIYWEDRLVKAKSAGLDAIQIYIPWNYHEPRPGEYIFENERDVVEFIELAQKIGLLVLVRAGPYICAEWDFGGLPPWLMSSNPRLNLRSSDPEYIKPVIRWFGQLLPKLKPLIYQNGGPIIMIQLENEYGSYITCDQEYLSALYEYARYVLGDEIILYTTDGSSTLQLKCGSSDRRLFATVDFGIDGAKHPAETFKALEQFQPHGPLVNSEYYSGWLDHWGEKRHVVDATALAWGALNLWNVSHRVSFNIYMFHGGTNFGLWNGANSPNQF-IITSYDYDAPISEAGDITTKYLVLQDLFYKLKQQVQP--PPPVNISKADYGKIGLKFFSHLLYEL--QEGISSVKPLYMEALGQYQGLMAYTTHL-----ERDEGKANLTFENVKDIGLVFTTDLQAKSIIFHGSVSGRAS-LNITMDKEHSFLTVVTECRGHINYGPLMAGDVKGIVGRVLLDGKELLNWMMKALDFRAVNP--PGLMRPDTEGTAFPAPGMIYKGVFQVPSPPMDTFAVVTGFTRGFLAVNGHIVGRYYPSAGPQVSLYVPTSMLIPGENVVSILELQNVEPACLKNVSFCFVSFRDYPV 616          
BLAST of Beta-galactosidase vs. TrEMBL
Match: A0A068Y5S4 (Beta-galactosidase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000741700 PE=3 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 1.235e-178
Identity = 286/615 (46.50%), Postives = 392/615 (63.74%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTM-KLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSA-PXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEG--ANCQGN---CTIEFVDEPI 2049
            S+ TF+ID  N VFLKDG+PFRYISGS+ Y RIP  YW DRLLK K+AGL+AIQ YIPWN+HE + G Y F    D+ +F+ +A+++ LLVL+R+GPY+C EWDFGGLP WLL  NPK+ LRSSD +YL  V++W+  LLP +KP +YQN GPI+M+Q+ENEYGS++TCD  YL  LY+  R  LGD+II+Y+TDGN    L CGSSDRR+F+TVDFG   A +P  +F+ L+++QP GP VNSEYYSGWLD WG + + V  + V  G   L+N S  V+ N+YMFHGGT+FG WNGAN P     I+SYDYDAP+SEAGDIT+KYL +R+    +    P  P+P N +K  YG + L      L+ L G  G  S  P+ ME+L QYQG M Y T+  E+          + F  + D   IF+++     I + GS+    S L++T+ K    L ++ E  GH+NFG  M  D+KGI+G V ++ + L NW+   +    ++       N   +A P  G ++ G F V   P DTF   + F++GV+ +NG  +GR++ + GPQ +L+VP ++L  G N V + E E   + C  N   C++ F D P+
Sbjct:   72 SSHTFSIDQENGVFLKDGEPFRYISGSLHYFRIPRIYWEDRLLKAKSAGLDAIQIYIPWNFHEPKPGDYLFDNERDVVEFINLAQRIGLLVLVRAGPYICAEWDFGGLPPWLLSSNPKLELRSSDPEYLKPVIRWFGQLLPKLKPLIYQNGGPIIMIQLENEYGSYFTCDQEYLSALYEYARFILGDEIILYTTDGNNIIELKCGSSDRRLFATVDFGVDEAKHPNDSFKALQQFQPHGPLVNSEYYSGWLDHWGEKRHVVDANAVAEGALNLWNMSQGVSFNIYMFHGGTNFGLWNGANSPTEF-IITSYDYDAPISEAGDITAKYLILRDLFYRLKQQVP-PPIPVNISKAHYGVIGLNFFSHLLYDLQG--GVASFKPLYMEALEQYQGLMAY-TAILEHD----EGKANLTFEGVKDTGLIFTTDFRAGSIIFHGSVSGCGS-LNITVDKEHPFLIIVTECRGHVNFGPLMFGDIKGIVGRVLLDGEELLNWVMKALDFRTVNPPDPIRINTEGTAFPAPGAIYKGVFHVPFPPMDTFAVVTGFTRGVLAVNGHIVGRFYPSAGPQVSLYVPSSMLICGENVVSILEFEKIQSTCLKNASFCSVTFRDSPV 676          
BLAST of Beta-galactosidase vs. TrEMBL
Match: A0A068WBF1 (Beta-galactosidase OS=Echinococcus granulosus OX=6210 GN=EgrG_000741700 PE=3 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 1.533e-178
Identity = 285/615 (46.34%), Postives = 392/615 (63.74%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTM-KLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSA-PXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEG--ANCQGN---CTIEFVDEPI 2049
            S+ TF+ID  N VFLKDG+PFRYISGS+ Y RIP  YW DRLLK K+AGL+AIQ YIPWN+HE + G Y F    D+ +F+ +A+++ LLVL+R+GPY+C EWDFGGLP WLL  NPK+ LRSSD +YL  V++W+  LLP +KP +YQN GPI+M+Q+ENEYGS++TCD  YL  LY+  R  LGD+II+Y+TDGN    L CGSSDRR+F+TVDFG   A +P  +F+ L+++QP GP VNSEYYSGWLD WG + + V  + V  G   L+N S  V+ N+YMFHGGT+FG W+GAN P     I+SYDYDAP+SEAGDIT+KYL +R+    +    P  P+P N +K  YG + L      L+ L G  G  S  P+ ME+L QYQG M Y T+  E+          + F  + D   +F+++     I + GS+    S L++T+ K    L ++ E  GH+NFG  M  D+KGI+G V ++ K L NW+   +    ++       N   +A P  G ++ G F V   P DTF   + F++GV+ +NG  +GR++ + GPQ +L+VP ++L  G N V + E E   + C  N   C++ F D P+
Sbjct:   72 SSHTFSIDQENGVFLKDGEPFRYISGSLHYFRIPRIYWEDRLLKAKSAGLDAIQIYIPWNFHEPKPGEYLFDNERDVVEFINLAQRIGLLVLVRAGPYICAEWDFGGLPPWLLSSNPKLELRSSDPEYLKPVIRWFGQLLPKLKPLIYQNGGPIIMIQLENEYGSYFTCDQEYLSALYEYARFILGDEIILYTTDGNNMIELRCGSSDRRLFATVDFGVDEAKHPNDSFKALQQFQPHGPLVNSEYYSGWLDHWGEKRHVVDANAVAEGALNLWNMSQGVSFNIYMFHGGTNFGLWSGANSPTEF-IITSYDYDAPISEAGDITAKYLILRDLFYRLKQQVP-PPIPVNISKAHYGVIGLNFFSHLLYDLQG--GVASFKPLYMEALEQYQGLMAY-TAILEHD----EGKANLTFEGVKDTGLVFTTDFRAGSIIFHGSVSGCGS-LNITVDKEHPFLIIVTECRGHVNFGPLMFGDIKGIVGRVLLDGKELLNWVMKALDFRTVNPPDPIRTNTEGTAFPAPGAIYKGVFHVPFPPMDTFAVVTGFTRGVLAVNGHIVGRFYPSAGPQVSLYVPSSMLICGENVVSILEFEKIQSTCLKNASFCSVTFRDSPV 676          
BLAST of Beta-galactosidase vs. TrEMBL
Match: A0A0X3PRQ2 (Beta-galactosidase OS=Schistocephalus solidus OX=70667 GN=TR101340 PE=3 SV=1)

HSP 1 Score: 533.872 bits (1374), Expect = 4.729e-178
Identity = 282/617 (45.71%), Postives = 392/617 (63.53%), Query Frame = 1
Query:  223 LSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAEN-LFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN-ISSVTDSFQNPSVSA-PXXXXXXXXXXXXXXS---PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEG--ANCQGN---CTIEFVD 2040
            L+ R+F+ID  N  FLKD  PFRY+SGS+ Y RIP+ YW DRL+K KAAGLNAIQ YIPWN+HE   G Y F GN D+ KF+++A  + LLVL+R+GPY+C EWDFGGLPAWLL  NP M LRSSD ++L  V++W+  L P + P+LY+N GPI+M+Q+ENEYGS+ TCD +YL  LY+  R  LG ++I+Y+TDG   + L CGSSDRR+F+T+DF  S A  P   F DL+ +QP  P VNSE+Y+GW D+WG   +    + +V   +T++NYS  V++N YMFHGG++FGFW+G          +SYDYDAP+SEAGDIT+KY+ +R+ +  +  + P  P+P N TK AYG   +      L+ L G  G ++  P TMES  QYQG+M Y TS     S        ++   I D  ++F++     +  Y  S+++  S++SL +    + L +L+EN GHIN+G+ M++DVKGI+G+V + D+ L +W    I   N I + T    +P+  A P  G LFTG   V  +   P DTF   + F++G+++IN   +GRY    GPQ +L++P   L LG NTV+L EL G    C  N   CT+ F D
Sbjct:   57 LTTRSFSIDTKNGTFLKDDAPFRYVSGSLHYFRIPQIYWMDRLIKAKAAGLNAIQIYIPWNFHEPFPGKYVFYGNHDVVKFISMAHDVGLLVLVRAGPYICAEWDFGGLPAWLLSINPNMKLRSSDPEFLGPVIRWFQQLFPRLHPYLYENGGPIIMIQLENEYGSYVTCDQDYLSTLYEFARYQLGPNVILYTTDGPSMNDLKCGSSDRRLFTTIDFNVSEALLPNETFSDLENFQPNHPLVNSEFYTGWFDTWGGGRHMTPAEQLVVASETIWNYSTRVSLNYYMFHGGSNFGFWSGGPSASNAAITTSYDYDAPISEAGDITTKYIMLRDLIFKLRKETP-PPLPSNITKKAYGTFPVRPYSHILYKLTG--GIEAFRPATMESCGQYQGFMAYTTSIESLLSGLL-TTATLRLPFIKDVGHVFTTTLSGDDFLYHASVKKP-SNVSLPLDANHSVLAILVENQGHINYGEAMVSDVKGILGSVYLGDQELLSWTMTAIDPRNAIPAPTGQKTSPTHPALPEVGKLFTGDLEVPVTDERPQDTFAVLNGFTRGILMINDVVIGRYAPDAGPQISLYIPANALFLGTNTVKLLELSGLQEKCHKNGTSCTVTFRD 668          
BLAST of Beta-galactosidase vs. Ensembl Cavefish
Match: glb1 (galactosidase beta 1 [Source:NCBI gene;Acc:103023617])

HSP 1 Score: 484.182 bits (1245), Expect = 3.089e-162
Identity = 276/626 (44.09%), Postives = 375/626 (59.90%), Query Frame = 1
Query:  235 TFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMS-DLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYP---------------IHLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANC-QGNCTIEFVDEP 2046
            +F++D+  N FLKDG+ FRYISGS+ Y+RIP  YW DRLLKM  AGLNAIQ YIPWN+HE   G Y+F G+ DL  FL + + L L+V+LR GPY+C EWD GGLP WLLKK   ++LRSSD  Y+++V KW   LLP+IKP+LYQN GPI+ VQVENEYGS++ CD +YLR L    RS+LGD++++++TDG   SYL CGS  +  ++TVDFG  G  N  +AF   +  +P GP VNSE+Y+GWLD WG  H  VST  +V+ L  +    +  NVN+YMF GGT+FG+WNGAN  PY PQ +SYDYDAPL+EAGD+T KY AIR+ +       P   VPP+T K AYG + +++   V + L  L      KS YP+T   + Q  G+M Y T         +   +    + + D AY+      + +    G L R  +  +++T K    L +L+EN G +NFG+  IND KG++ N+T+   +L+NW  Y                + L    + T       +S P                P DT+++  ++ KG V INGFNLGRYW ++GPQ TLFVP  +L     N + + ELE + C  G C +EF + P
Sbjct:   26 SFSVDYKRNSFLKDGERFRYISGSIHYSRIPRVYWKDRLLKMYMAGLNAIQTYIPWNFHEPTPGSYDFSGDRDLEHFLQLCQDLGLVVILRPGPYICAEWDMGGLPTWLLKKK-DIVLRSSDPAYIAAVDKWMGKLLPMIKPYLYQNGGPIITVQVENEYGSYFACDFDYLRHLIRLYRSYLGDEVVLFTTDGARVSYLKCGSI-QGAYATVDFGAGG--NVTAAFEAQRHAEPHGPLVNSEFYTGWLDHWGEPHAVVSTAILVKSLNEILE--VGANVNLYMFIGGTNFGYWNGANT-PYAPQPTSYDYDAPLTEAGDLTQKYFAIRDVIKKYR-KIPDGMVPPSTPKYAYGQVPMKKLRTVAESLDILSFSGPVKSTYPLTFTDMKQAFGFMQYQTVLP--VDCINPTPLSSPLNGVRDRAYV------SVDGVVAGILERDKAITINITGKAGSRLDILVENLGRVNFGKD-INDFKGLVYNLTLGASVLANWTVYSLSIDEAVKGGLLLDTVSLRPPKTTTPKTPPTKLSPPAFYAGSFSIPDDIPDLPQDTYIQFPDWRKGQVWINGFNLGRYWPSRGPQITLFVPAYLLSTSAPNNITVLELEASPCSSGPCAVEFTNTP 634          
BLAST of Beta-galactosidase vs. Ensembl Cavefish
Match: glb1 (galactosidase beta 1 [Source:NCBI gene;Acc:103023617])

HSP 1 Score: 470.315 bits (1209), Expect = 3.202e-157
Identity = 272/620 (43.87%), Postives = 371/620 (59.84%), Query Frame = 1
Query:  235 TFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQ---VPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMS-DLSLTMKLAENLFVLIENSGHINFGQGMINDVK----GIIGNVTV-----NDKILSNWMHYPIHLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANC-QGNCTIEFVDEP 2046
            +F++D+  N FLKDG+ FRYISGS+ Y+RIP  YW DRLLKM  AGLNAIQ YIPWN+HE   G Y+F G+ DL  FL + + L L+V+LR GPY+C EWD GGLP WLLKK   ++LRSSD  Y+++V KW   LLP+IKP+LYQN GPI+ VQVENEYGS++ CD +YLR L    RS+LGD++++++TDG   SYL CGS  +  ++TVDFG  G  N  +AF   +  +P GP VNSE+Y+GWLD WG  H  VST  +V+ L  +    +  NVN+YMF GGT+FG+WNGAN  PY PQ +SYDYDAPL+EAGD+T KY AIR+ +       P   VPP+T K AYG + +++   V + L  L      KS YP+T   + Q  G+M Y T         +   +    + + D AY+      + +    G L R  +  +++T K    L +L+EN G +NFG+  IND K     ++ N TV     ++ +    +   + L    + T       +S P                P DT+++  ++ KG V INGFNLGRYW ++GPQ TLFVP  +L     N + + ELE + C  G C +EF + P
Sbjct:   11 SFSVDYKRNSFLKDGERFRYISGSIHYSRIPRVYWKDRLLKMYMAGLNAIQTYIPWNFHEPTPGSYDFSGDRDLEHFLQLCQDLGLVVILRPGPYICAEWDMGGLPTWLLKKK-DIVLRSSDPAYIAAVDKWMGKLLPMIKPYLYQNGGPIITVQVENEYGSYFACDFDYLRHLIRLYRSYLGDEVVLFTTDGARVSYLKCGSI-QGAYATVDFGAGG--NVTAAFEAQRHAEPHGPLVNSEFYTGWLDHWGEPHAVVSTAILVKSLNEILE--VGANVNLYMFIGGTNFGYWNGANT-PYAPQPTSYDYDAPLTEAGDLTQKYFAIRDVIKKYR-KIPDGMVPPSTPKYAYGQVPMKKLRTVAESLDILSFSGPVKSTYPLTFTDMKQAFGFMQYQTVLP--VDCINPTPLSSPLNGVRDRAYV------SVDGVVAGILERDKAITINITGKAGSRLDILVENLGRVNFGKD-INDFKVSLTSVLANWTVYSLSIDEAVKGGLLLDTVSLRPPKTTTPKTPPTKLSPPAFYAGSFSIPDDIPDLPQDTYIQFPDWRKGQVWINGFNLGRYWPSRGPQITLFVPAYLLSTSAPNNITVLELEASPCSSGPCAVEFTNTP 613          
BLAST of Beta-galactosidase vs. Ensembl Cavefish
Match: GLB1L (galactosidase beta 1 like [Source:HGNC Symbol;Acc:HGNC:28129])

HSP 1 Score: 417.542 bits (1072), Expect = 1.485e-137
Identity = 225/514 (43.77%), Postives = 326/514 (63.42%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPF----LPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRR-TMSDLSLTMKLAENLFVLIENSGHINF-GQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISS 1746
              RTF+ID   N FLKDGKPF+YISGS+ Y+R+P  YW DRL KM  +GLNAIQ YIPWN+HE E+G++ F G  D+  FL +A +  LLV+LR GPY+C EW+ GGLPAWLL  NP +ILRS+D DYL +V  W +VLL  ++P LYQN G I+ VQVENEYGS++ CD NYLR L    R  LG+D+ +++TDGN    L CG+ +  +++T+DFGT    N  +AF+  +R++PKGP VNSE+Y+GWLD WG +H  V T  V R L+ +   SM  +VNMYMF GGT+FG+WNGA+ D  +   ++SYDY+APLSEAGD T K LAIR+ + + +P H      + +  + + +  G      V   L  L  Q   +S +P+T E +  Y G+M+Y T       + +   +    + I D AY+F    + +    +G L R  M  +++T +  + L +L+EN G +NF    ++  ++G++GN+ + + +L++W+ +P+ L  + S
Sbjct:    9 EERTFSIDLDRNCFLKDGKPFQYISGSIHYSRVPRSYWKDRLTKMYMSGLNAIQVYIPWNFHESEQGVFEFEGQKDVEYFLNLANQTGLLVILRPGPYICAEWEMGGLPAWLL-HNPNIILRSADSDYLQAVSDWMAVLLTKMRPWLYQNGGNIISVQVENEYGSYFACDYNYLRHLRTLFRFFLGEDVFLFTTDGNTDKELICGTLE-GLYATIDFGTDT--NITTAFKRQRRFEPKGPLVNSEFYTGWLDHWGDKHASVETQKVSRMLEDM--LSMGASVNMYMFEGGTNFGYWNGADLDSRFRSVVTSYDYNAPLSEAGDPTDKLLAIRDVIKNTHPRHIHDIDGVHISLSVSLSQVG-----NVSGLLDTLCPQGPVQSHHPLTFEEIKHYYGFMLYRTLLPRNIPDPT--PLISPMNGIHDRAYVFCEWGEEN----LGVLERDIMLVMNVTGRQGDQLDILVENMGRVNFVSLCVLFFLQGLLGNLILGNDVLTDWLIFPLDLDAVIS 505          
BLAST of Beta-galactosidase vs. Ensembl Cavefish
Match: ENSAMXT00000045467.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001049.1:9533:25232:-1 gene:ENSAMXG00000043517.1 transcript:ENSAMXT00000045467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 387.882 bits (995), Expect = 9.110e-126
Identity = 244/634 (38.49%), Postives = 353/634 (55.68%), Query Frame = 1
Query:  217 KGLSNRTFTIDFTN----NVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGP-----------QVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPD---YLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMS-DLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISS----VTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGNCTIEFVDEP 2046
            K L+  T T D  N    + FLKDGKPF+YISGS+ Y+R+P  YW DRL KM  +GLNAIQ YIPWN+HE E+G++ F G  D+  FL +A +  LLV+LR GPY+C EW+ GGLPAWLL  NP +ILRS+D DYL +V  W +VLL  ++P LYQN G I+ VQVENEYGS++ CD NYLR L    R  LG+D+ +++TDGN    L CG+ +  +++T+DFGT    N  +AF+  +R++PKGP           QVNSE+Y+GWLD WG +H  V T  V R L+ +   SM  +VNM++                  L  + S D D+     GD T K LAIR+ + ++           ++ K +YG + L++V +    L  L  Q   +S +P+T E +  Y G+M+Y T       + +   +    + I D AY+  +        Y G L R ++  +++T +  + L +L+EN G +NFG   IND KG++GN+ + + +L++W+ +P+ L  + S           P      +G        +  +P   +   S  S G V ING NLGRYW  +GPQ TL+VP T+L     N + + ELE      +  + F+D P
Sbjct:    2 KNLNTVTTTSDVLNRSGSDCFLKDGKPFQYISGSIHYSRVPRSYWKDRLTKMYMSGLNAIQVYIPWNFHESEQGVFEFEGEKDVEYFLNLANQTGLLVILRPGPYICAEWEMGGLPAWLL-HNPNIILRSADSDYLQAVSDWMAVLLTKMRPWLYQNGGNIISVQVENEYGSYFACDYNYLRHLRTLFRFFLGEDVFLFTTDGNTDKELICGTLE-GLYATIDFGTDT--NITTAFKRQRRFEPKGPPGEIYMWVCVLQVNSEFYTGWLDHWGDKHASVETQKVSRMLEDM--LSMGASVNMWV----------------KVLTIVFSADLDSRF--PGDPTDKLLAIRDVIKNVRRT--------SSPKFSYGFVTLKKVGNVSGLLDTLCPQGPVQSHHPLTFEEIKHYYGFMLYRTLLPRNIPDPT--PLISPMNGIHDRAYVSVNG------VYQGVLERDVTLVMNVTGRQGDQLDILVENMGRVNFGN-KINDYKGLLGNLILGNDVLTDWLIFPLDLDAVISGGWPQAGGINVPPKPKTKEGRGPAVYSGILKTPGVAWEHLSQNSPGQVWINGVNLGRYWPKRGPQQTLYVPGTLLSPSLPNNITMLELESE--PDHLRVLFMDRP 592          
BLAST of Beta-galactosidase vs. Ensembl Cavefish
Match: b3gat1b (beta-galactosidase-1-like protein 2 [Source:NCBI gene;Acc:103036043])

HSP 1 Score: 296.204 bits (757), Expect = 3.149e-90
Identity = 216/630 (34.29%), Postives = 326/630 (51.75%), Query Frame = 1
Query:  229 NRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASA----FRDLK---RWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHL----LGQVGFKSPYPITMESL------NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTM-KLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNP---SVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEPIL 2052
            +RT  +   ++ F   G+ FR + GS+ Y RIP  YW DR+LKMKA G+N +   +PWN HE E G + F GN DL  FL  A  L L V+LR GPY+  + D GGLP+WLL ++ KM LR++   +  +V  ++  L+P + P  ++  GPI+ VQVE+ YGSF   D++Y+  L + ++S    ++++ S    G   L  G            G SGA    +     + D+K     QP  P +  E+++GW D WG  H+    +D+V  ++ +    MS  +N+Y+FHGGT+FGF +GA+ +P Y P ++SYDYDAPLSE GD T KY  +R+     N ++    VP    K  Y   I+ Q   +LF           FKS  P+ ME+L       Q  GY +Y T+ +      S  +++       D A +F +        +IG       +L++   K    L +L+EN G  + G+ + +  KGI+G++ +N+  L ++  Y + +   S +   ++ P       P+  G F G  FV   P DTF+K   +SKGVV IN  NLGRYW+  GPQ  L++P   L  G N V +FE   A+ +    + F D P L
Sbjct:   40 SRTHGLSVNSSQFSLGGESFRLLGGSLHYFRIPRAYWKDRMLKMKACGVNTLTTSVPWNLHEPERGEFQFRGNLDLEMFLIQAADLGLWVVLRPGPYIGSDLDLGGLPSWLL-RDKKMKLRTTYPGFTEAVNAFFDKLIPKVVPLQFKKGGPIIAVQVEHAYGSF-AVDSDYMPFLKEALQSRGVSELLLTSDSHEG---LKSG------------GLSGALRTLNLRKLNYEDIKYLEAVQPNSPILIMEHWTGWFDGWGDLHHTFPAEDMVAVVREVLRQGMS--INLYVFHGGTNFGFMSGASANPSYKPLVTSYDYDAPLSEDGDYTPKYHLLRDIFSRYN-NYLLSDVPGLRRKKGYEAAIMFQ---HLFLWDALPFTHEPFKSRIPVNMENLPVNNKNGQAYGYTLYETTITTGGFLKSRDNIR-------DRALVFVNR------GFIGLFNYKTLELAVPEGKQERTLSLLVENCGRAHSGKALDHQRKGIVGDIFLNNTPLRDFTIYSLDMTQ-SFIDSLYRAPWKFLPEKPSFPGFFQGRLFVDGYPSDTFVKLPGWSKGVVFINRQNLGRYWDL-GPQQALYIPGPFLNSGLNLVTVFEEHDADFK----LHFEDTPDL 627          
BLAST of Beta-galactosidase vs. Ensembl Sea Lamprey
Match: glb1l (galactosidase, beta 1-like [Source:ZFIN;Acc:ZDB-GENE-050309-196])

HSP 1 Score: 442.965 bits (1138), Expect = 4.826e-147
Identity = 261/631 (41.36%), Postives = 382/631 (60.54%), Query Frame = 1
Query:  232 RTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDY--LFHLLGQVG-FKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANI-----------SSVT-DSFQNPSVSAPXXXXXXXXXXXXXXS-PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN----CT--IEFVDEPIL 2052
            ++F ID   + F+KDG+PFRYI+GS+ Y+R+P  YW DRLLKM   GLNA+Q Y+PWNYHE + G++ F G  DL +F+   ++  LL++LR GPY+C EWD GGLPAWL++K   ++LRSSDK+YL +V  W SVLLP +KP LYQN GPI+ +QVENEYGSF  CD  Y+R L +  RS LG D+++++TD       +CGS  + ++ST+DFG     N   AF   ++++P GP VNSE+Y+GWLD WG  H+   +  V   L  +   S+  +VNMYMF GGT+FG+W+G + +  +LP  +SYDYDAPLSEAGD T K   IR+ +     D P  P+PP T K AYG + +    +   L  +L   G  KS +P++ E +NQ+ G+M+Y T   +  S  +   ++   + + D AY+      N  +  +    R  S +S+   + E L VL+EN G I+FG+  + + KG++  + ++ ++L++WM Y + + ++           SSV         ++APT             S P DTFLK   ++KG V +NGFNLGRYW  +GPQ TL+VP +++     N V + ELEG +C G+    C+  ++F+D PIL
Sbjct:   35 QSFGIDRARDCFVKDGEPFRYIAGSLHYSRVPRVYWKDRLLKMYTTGLNAVQTYVPWNYHETKPGVFEFSGEKDLEEFIRTVKETGLLLILRPGPYICAEWDMGGLPAWLIQKR-GIVLRSSDKEYLKAVDSWMSVLLPKVKPWLYQNGGPIITIQVENEYGSF-GCDMEYMRHLTEVFRSKLGRDVVLFTTDEPSLHSQSCGSL-QDLYSTIDFGIET--NITQAFEMQRKFEPNGPLVNSEFYTGWLDYWGYAHSTRDSSLVASALDQM--LSLGASVNMYMFEGGTNFGYWSGGDFNVSFLPVPTSYDYDAPLSEAGDPTEKLYIIRDVIRKYA-DIPAGPMPPPTPKYAYGYVHMTPYKNLTELLDILAPYGPVKSKHPLSFEEMNQHHGFMLYRTKLPKNYSNPAQ--LRPPPNGLNDRAYV----SINGVVQGVLDRDRRRS-VSIEGNVGEWLDVLVENMGRISFGK-HLGERKGLLSGLILDGEVLTDWMIYSLDIDSVIAEGLLPSSFHSSVKMKRLDQAGIAAPTFYHGSFSIPPDIPSFPWDTFLKMYGWTKGQVWLNGFNLGRYWPRQGPQMTLYVPASLISASLPNNVTVLELEGVSCLGHESAGCSYLVQFLDRPIL 649          
BLAST of Beta-galactosidase vs. Ensembl Sea Lamprey
Match: b3gat1b (beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P) b [Source:ZFIN;Acc:ZDB-GENE-131101-1])

HSP 1 Score: 285.419 bits (729), Expect = 3.098e-88
Identity = 198/549 (36.07%), Postives = 293/549 (53.37%), Query Frame = 1
Query:  454 LSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAND-PPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLIL-EQVPDYLFHLLGQVG--FKSPYPITMESL------NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN--ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEPILDGPV 2064
            L  F+ +A++LDL V+LR GPY+C EWD GGLP+WLL  +P M LR++   ++ +V  ++  L+P + P  Y   GPI+ VQVENEYG+ Y  D  Y+  +   +  H   + ++ S + +G   L+ G+ D  + ST++F         S F  L   QP  P++  E+++GW DSWG  H   + + ++  +K + +   S  +N+YMFHGGT+FGF NGA + P Y P I+SYDYDAPLSEAGD T KY  IR  L++   +   +  PP T K AYG + + E +P  L+  L  VG    S  P+ ME         Q  GY +       Y+++  H  +      + D A IF ++K    + Y    +  +    L       L  L+EN G +N+G  +    KG+ GN+T+++K L  +  YP+ +    I+S+  +        P     F GT  ++ +P DTF++   F KGVV +NG NLGRYW   GPQ TL++P   LK G N + LFE      +G   I FV+EP L  PV
Sbjct:    1 LRAFIQLAKELDLHVILRPGPYICAEWDLGGLPSWLL-ADPDMKLRTTYSGFIDAVDIFFEKLMPSVAPLQYTYGGPIIAVQVENEYGA-YAKDTGYMESVKQILLKHGIIEFLMTSDNKDG---LSQGAVDGAL-STMNF----KHFQRSYFEHLDSVQPNLPKMVMEFWTGWFDSWGNYHMVFNAEALIDNMKKILDQKAS--INLYMFHGGTNFGFMNGALELPSYQPDITSYDYDAPLSEAGDYTPKYKKIRQLLMT-QFNLKLIDPPPPTHKAAYGIVAMNEYLP--LWSSLELVGKPIHSALPMNMEKFPINDGNGQSYGYAL-------YETKIRHGGLLKSNLNVHDRAQIFFNSKSQGFLDYK---KNRLCVPVLQSYEKSTLSFLVENRGRVNYGLNLDTQRKGLTGNLTLDEKPLEEFKIYPMEMKQDFINSLEKAKWTKVPLQPWLPAFFRGTLQISGTPRDTFVRLDEFEKGVVFVNGKNLGRYW-ILGPQKTLYLPAPWLKEGDNKIVLFE----ESKGGGAISFVNEPELGKPV 519          
BLAST of Beta-galactosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002943.1 (pep scaffold:Pmarinus_7.0:GL488193:410:6860:1 gene:ENSPMAG00000002693.1 transcript:ENSPMAT00000002943.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 5.162e-27
Identity = 70/186 (37.63%), Postives = 98/186 (52.69%), Query Frame = 1
Query: 1549 RRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN---------ISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLK-LGYNTVRLFELEG--ANCQG-NCTIEFVDEPILDGPVH 2067
            R   S +++T K    L +L+EN G IN+G+  IND KG+  N+T+    + NW  Y + +           +   +D+   PS       G F+    +   P DT+L+   ++KG V INGFNLGRYW   GPQ TLFVP T L     N V + ELE   A+C   +C + FVD P+L+G VH
Sbjct:    8 RNNASGVNVTGKAGSRLDILVENMGRINYGR-HINDFKGLTDNLTLGLTPIVNWTIYSLDVDGAVASGAVQPLRGRSDAAGGPSGGPTFYTGTFSIPSGLPDLPMDTYLELPGWTKGQVWINGFNLGRYWPAAGPQVTLFVPATALSTTAPNNVSVLELEAAPASCSPVSCAVRFVDRPVLNGTVH 192          
BLAST of Beta-galactosidase vs. Ensembl Nematostella
Match: EDO39870 (Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A7S8R3])

HSP 1 Score: 502.286 bits (1292), Expect = 6.266e-170
Identity = 275/639 (43.04%), Postives = 397/639 (62.13%), Query Frame = 1
Query:  223 LSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN----DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILE---QVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLR-----RTMSDLSLTMKLAE--NLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSA---------PXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKL--GYNTVRLFELEGANCQ--GNCTIEFVDEPILDG 2058
            ++ ++FTIDF NN FLKDG+PFRYISG + Y R+P+++W DRLLKMKAAG+NAIQ Y+PWN HE   G YNF G  DL  FL +A  LDL+ ++R+GPY+C EWDFGGLPAWLLK +   +  S D+ Y+S+V  W  VLLP +K +LY++ GP++MVQVENEYG++YTCD+ Y+  L  T R HLG ++I+++TD      L CG+    +F+T+DFG     +PA+AF   +++QPKGP VNSEYY+GWLD WG +H   +++ V + L  +   +++ +VN+YMF GGT+FGFWNGAN       + P  +SYDYDAPL+EAGD T KY AIR  ++  +   P +P+PP T K +YG + ++   ++ D L  L     +KS YP TME L+QY G+++Y    S+  S F+     +    +            +  I Y+GS+R     RT  + + T+ ++E   L +L+EN GHI +G  M+ D KG++GNVT+++  + NW  YP++L N +      Q+   SA         PT             +  D +L+   +SKGVV INGFNLGRYW   GPQ TL+VP +VL      +++ + EL+ + C     C + FV +P+++G
Sbjct:   20 IAAKSFTIDFDNNRFLKDGQPFRYISGGIHYFRVPQFFWKDRLLKMKAAGMNAIQTYVPWNLHEPTPGKYNFDGGADLLSFLELAHSLDLVAIVRAGPYICAEWDFGGLPAWLLKNSSITLRSSKDQAYMSAVDSWMGVLLPKLKAYLYEHGGPVIMVQVENEYGNYYTCDHEYMNHLEITFRQHLGSNVILFTTDPPIPYNLKCGTL-LSLFTTIDFGP--GIDPAAAFNIQRQFQPKGPFVNSEYYTGWLDHWGEQHQTKTSESVSQYLDKI--LALNASVNLYMFEGGTNFGFWNGANANAGASSFQPVPTSYDYDAPLTEAGDPTEKYFAIRE-VVGKHASLPDIPIPPATPKYSYGTVEMKRGARMIDILSELTPGGPYKSKYPQTMEELDQYSGFVLY---RSQIPSMFTQSTRMLNVEGL----------VRDRAIVYVGSIRQRTLNRTKGESNATIVISEFLELDILVENMGHIGYGSEMV-DPKGLVGNVTIDNVQILNWEMYPLNLDN-AVKNHKMQSLLASALPGTDNAISPTFYTGVIPAAPFGDTGFDCYLRLDGWSKGVVFINGFNLGRYWPVVGPQKTLYVPASVLSADQKQSSLVILELDDSPCDYPETCLVSFVTDPVVNG 637          
BLAST of Beta-galactosidase vs. Ensembl Nematostella
Match: EDO46236 (Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A7RQV8])

HSP 1 Score: 499.204 bits (1284), Expect = 2.057e-168
Identity = 281/635 (44.25%), Postives = 387/635 (60.94%), Query Frame = 1
Query:  205 LLTDKGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSS-DKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSP-------YPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISS---VTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLF--ELEGANCQ--GNCTIEFVDEPILDGPV 2064
            +L  + L  R+F++D TNNVFLKDGKPFRYISGS+ Y R+P  YW DRL KMK AGLNA+Q Y+ WN HE E G Y+F G  DL +F+ IA+ + LLV+LR GPY+CGEW+ GG P WLL KN  ++LRSS D+ Y+ +V KW  VLLP I+P LY N GP++ VQVENEYGS++TCD++Y+  L +  RSHLG D+++++TDG   S L CG+    +F+TVDFG     +P   F  L+++QP GP VNSE+Y GWLD WG +H+ V+   + + L  +   +M+ +VN+YMF GGTSFG+ N A    Y PQ +SYDYDAPLSEAGDIT KY  +   +         LP P N  K AYG + +++    L  LL  V   SP        P+TME L Q  G+++Y T   +   +F+HQ V I    I D A I+      + +  +G+     +  S+ +    +L +L+EN G IN+G  ++ D KGI+GNVT+   +L +W  +P++L N+ +   +  S +  + S             V   P DTFL   +++KG V INGFN+GRYW   GPQ +L+VP +VL  G    +LF  EL+   C     C + F D P+LDGPV
Sbjct:   16 ILFLQSLEARSFSVDLTNNVFLKDGKPFRYISGSIHYFRVPRIYWKDRLQKMKFAGLNAVQTYVAWNLHEPEIGTYDFEGENDLEEFIKIAQSVGLLVILRPGPYICGEWELGGFPPWLL-KNTSIVLRSSKDQVYMDAVDKWMGVLLPKIRPLLYNNGGPVITVQVENEYGSYFTCDHDYMSHLENLFRSHLGKDVVLFTTDGFAKSMLDCGTLP-SLFTTVDFG--AGVDPKVPFSILRKYQPNGPLVNSEFYPGWLDHWGEKHSTVNPAVMTQYLDMI--LAMNASVNLYMFEGGTSFGYMN-AKSSQYQPQPTSYDYDAPLSEAGDITLKYRLLLEVIAGYVGPPSGLP-PKNIPKYAYGKVEMKK----LGRLLDLVQVLSPNPPVMARLPMTMEQLGQSYGFVLYHTQIPD---KFAHQTVTISIPGIRDRAIIYVGKIRQATVIRVGN----KTTASIVIGSFFDLSILVENMGRINYGPHLV-DPKGILGNVTLGGDVLMDWKMFPLNLKNVLNHYPMLSSVRRDNTSNAPTFFTGEIPPSVDGVPRDTFLYMDSWTKGQVFINGFNVGRYWPAAGPQISLYVPSSVLYAGQRASKLFILELDENPCDYPATCYVTFKDTPLLDGPV 630          
BLAST of Beta-galactosidase vs. Ensembl Nematostella
Match: EDO49667 (Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A7RFV4])

HSP 1 Score: 478.404 bits (1230), Expect = 1.127e-160
Identity = 268/636 (42.14%), Postives = 387/636 (60.85%), Query Frame = 1
Query:  235 TFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSD-KDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYST-DGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNAL---LSINPDHPFLPVPPNTTKTAYGPLILEQVP---DYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLR-----RTMSDLSLTMKLAE--NLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANI--------SSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRL--FELEGANCQ--GNCTIEFVDEPILDG 2058
            +F+ID+ NN F+KDGKPFRYISG + Y R+P+YYW DRLLK+KA+G+N +Q Y+PWN HE     YNF GN +L+ FL IA+ LDLLV+LR GPY+C EWDFGGLP WLL K+P +++RSS  K Y+ +V  W SVLLP++KP LY+N GP++MVQVENEYG +  CD+ Y+  L    R HL DDII+++T DG+  + + CG+    +++TVDFG +   +P+  F + ++ Q KGP VNSE+Y+GWLD WG  H   ++  V   L  +   +++ +VN+YMF GGT+FGFW+GA+    Y P  +SYDYDAPL+EAGD+T KY AIR  +   L++    P +P+PP T K  YG + + + P   D L  L  +   K+ YP+TME + QY G+  Y            H  +   FS+      +    +D + I Y+G LR     RT  + + T+ + E  +L +L+EN GH+ +G+ M+ D KGI+GNVT+++  + NW  Y ++L N+         S TD ++  +  +P                 D +L   N+ KGVV +NG N+GRYW   GPQ TL+VP +V+ +  +   L   EL+ A C     C ++    P+L+G
Sbjct:   19 SFSIDYDNNCFMKDGKPFRYISGGMHYFRVPQYYWKDRLLKLKASGMNTVQTYVPWNLHEPIPKQYNFAGNANLTSFLEIAQSLDLLVILRPGPYICAEWDFGGLPGWLL-KDPSIVIRSSQGKAYMEAVDAWMSVLLPLVKPFLYENGGPVIMVQVENEYGDYIHCDHQYMLHLQQLFRYHLTDDIILFTTDDGSNLTAIECGTLP-SLYTTVDFGANT--DPSIPFANQRKLQQKGPLVNSEFYTGWLDYWGTPHQTRTSKVVADALDKI--LALNASVNLYMFEGGTNFGFWSGADFHGQYQPVPTSYDYDAPLTEAGDLTEKYHAIREVIGKYLTL----PDIPIPPATPKYPYGTIEMTKGPEVIDVLTKLSPEGPVKTKYPLTMEQIGQYSGFAWY------------HAQIPPMFSQSERMLNVEGLVRDRA-IIYVGRLRQRTLNRTRGESNATIIIGEFLDLDILVENMGHVGYGENMV-DPKGILGNVTIDNVQILNWDIYRLNLDNVVSNESLFKDSYTDFYKTDNAISPRFFKGVIPGVPFGDIGFDFYLHLDNWGKGVVFVNGRNMGRYWPAVGPQQTLYVPASVMSMNQHPSNLVILELDNAPCDYPETCLVKCSTIPVLNG 630          
BLAST of Beta-galactosidase vs. Ensembl Nematostella
Match: EDO40679 (Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A7S6L9])

HSP 1 Score: 320.087 bits (819), Expect = 4.824e-100
Identity = 218/619 (35.22%), Postives = 323/619 (52.18%), Query Frame = 1
Query:  190 STKISLLTDKGL--SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN--DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGF--------KSPYPITMESL----NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSL-RRTMSDLSLTMKL--AENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSAPXXXX---XXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTV 1980
            S K  ++  KGL  + R FT+D         GKPF  +SG++ Y RIP  YW DR++K+KA GLN ++ Y+ WN HE  +G +NF    D+ +F+  A+K DL V++R GPY+C EWD GGLP+WLL  NP + LRS D  ++ + L+++  L+P +  + Y N GPI+  Q+ENEY S Y   + Y+R L   +    G   +++++DG     +    S   +  TV+F      N  +  + L++ QP  P + +E++SGW D WG   + ++ +      K +    M  ++N YM HGGT+FGF NGAN  +  Y P I+SYDYDAP+SE+GDIT KY  +R  LL           P N+  +      L     +  H L Q GF        +S +P+ ME L    N  QGY       + Y++        IK     D A +   N+     TY  +  +  +  +    K   +  L +L+EN G +NF Q + N  KGI+G+V V+     +W  YP+        + +    SV +  +     +  G+F +  SP DTF+  S ++KGV  +NG NLGRYWN  GPQYTL++P   LK G NTV
Sbjct:   31 SNKRVVVRSKGLVANGRHFTMD---------GKPFTILSGAMHYFRIPPQYWEDRIVKLKAMGLNTVETYVSWNLHEEIQGDFNFKDGLDIVEFIKTAQKHDLYVIMRPGPYICAEWDLGGLPSWLL-HNPNIYLRSLDPIFMKATLRFFDELIPRLIDYQYSNGGPIIAWQIENEYLS-YDNSSAYMRKLQQEMVIR-GVKELLFTSDGIWQMQIEKKYSLPGVLKTVNFQR----NETNILKGLRKLQPNMPLMVTEFWSGWFDHWGEDKHVLTVEKAAERTKNI--LKMESSINYYMLHGGTNFGFMNGANAENGKYKPTITSYDYDAPISESGDITPKYRELREKLLKY--------APKNSRMSFSLLRYLNLPLLHSSHCLLQ-GFCNYALSPIESRHPVAMEFLPINKNGGQGY-----GFTLYEARLPSTAKSIKIESYRDRAQVLVDNR-----TYFSAFGKNKLKSIPFGRKTPNSNKLQILVENMGRVNFKQEINNQRKGILGDVFVDGDRHMSWKIYPLEFKQDFMESLNKAEWSVRSERRRRGPGMHRGSFSIDDSPKDTFVLMSGWTKGVCFVNGRNLGRYWNI-GPQYTLYLPSPWLKQGENTV 611          
BLAST of Beta-galactosidase vs. Ensembl Nematostella
Match: EDO37927 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEC4])

HSP 1 Score: 315.464 bits (807), Expect = 1.217e-98
Identity = 211/600 (35.17%), Postives = 327/600 (54.50%), Query Frame = 1
Query:  322 IPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFY-TCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTD-DVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN------DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDH----PFLPVPPNTTKTAYGPLILEQ-VP-DYLFHLLGQ-VGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYI---FSSNKD-NSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANI----SSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEPIL 2052
            +PEY W DRL K+KA GLN ++ Y+ WN HE  +  + F    D+ KF+ +A++L L V++R GPY+C EWD GGLP+WLL  +P M LRS+   ++ +V K++S L  ++ P  +   GPI+  QVENEY S     DN+Y+ +L+  +  + G   +++++D  GY+        +R    +D G   +FN    F     +QP  P + +EY+SGW D WG +H+ ++T+  ++  +K + +  M  ++N YMFHGGT+FGF NGAN      D  Y P ++SYDYDAPLSEAGDIT KY A+R  +    P      P   +PPN  K AY  + ++  VP   ++  + Q +   +  P+    +N   G    FT    YQ+   H    +   +I D A++   + SN D   EI +  + + +  D+ L         +++EN G +NFG+G+ +  KGI+G V ++    + W  YP+         + +  S+  P+  A    G + G   +   P D+F+    + KGV L+NG NLGRYW   GPQ  L++P + L+ G NT+ LFE++GA   G   +EF D P+L
Sbjct:    1 MPEY-WADRLKKLKAMGLNTVETYVAWNLHEQVKENFKFKDEVDIVKFVNLAQELGLHVIIRPGPYICSEWDLGGLPSWLL-NDPNMRLRSTYGPFMEAVEKYFSKLFALLTPLQFSRGGPIIAWQVENEYASVQEEVDNHYMELLHKLMLKN-GATELLFTSDDVGYT--------KRYPIKLDGGKYMSFN--KWFCLFLHFQPDKPIMVTEYWSGWFDHWGEKHHVLNTERKMINEVKDILD--MGASINFYMFHGGTNFGFMNGANTAGNRIDDGYQPDVTSYDYDAPLSEAGDITPKYKALRKLIQEHVPGEFLPDPLPDIPPNLQKAAYDNIHMKDFVPLQKIYKYIDQAIDIAAVTPMEFLPINNNGGQGYGFTI---YQTTLKHHAKSLTIEKIRDRAHVSFLYKSNADVVDEIVFTVNPKDSDDDVFLE--------IMVENMGRVNFGKGLHSQRKGILGQVLIDGHTQNKWKVYPLDFHKTFTERAFLEVSWSKPTEGASFSPGFYRGILHIQGQPRDSFVHPKGWGKGVCLVNGKNLGRYWKL-GPQEALYLPASWLRSGDNTIILFEVDGAKDDG--ILEFSDSPML 571          
BLAST of Beta-galactosidase vs. Ensembl Medaka
Match: glb1 (galactosidase beta 1 [Source:NCBI gene;Acc:101167424])

HSP 1 Score: 514.998 bits (1325), Expect = 2.241e-174
Identity = 289/628 (46.02%), Postives = 390/628 (62.10%), Query Frame = 1
Query:  235 TFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLI---LEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRR-TMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSA-PXXXXXXXXXXXXXXS----------PDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGN-CTIEFVDEPILDGPVH 2067
            +F++D+  + F KDG+ FR+ISGS+ Y+RIP  YW DRL+KM  AGLNAIQ YIPWNYHE   G+YNF G+ D+  FL +A+ + LLV+LR GPY+C EW+ GGLPAWLL K   ++LRSSD DY+++V  W   LLP++KP+LYQN GPI+ VQVENEYGS++ CD NY+R L    RSHLG+D+++++TDG G +YL CG+  + ++++VDFG     N  +AF   +  +P GP VNSE+Y+GWLD WG RH+ VS D V + L      +M  NVNMYMF GGT+FG+WNGAN  PY  Q +SYDYDAPL+EAGD+T KY AIR  ++ +    P  PVPP+T K AYG +    L+ V D L  L      KS YP T   LNQ  GY++Y T+     SE +   +    + + D AY+      + +    G L R  +  +++T K    L +L+EN G IN+G+G IND KG++ N+T+    L+ W  Y + + +  S     + PS  A P Q    +   F   S          P DT++K  N+ KG + ING NLGRYW  +GPQ TLFVP  +L     N V + ELEGA+C    CT+EF   PIL+  V 
Sbjct:   27 SFSLDYNADCFRKDGQRFRFISGSIHYSRIPRVYWKDRLVKMYMAGLNAIQTYIPWNYHEESPGMYNFSGDRDVEYFLKLAQDIGLLVILRPGPYICAEWEMGGLPAWLLSKK-DIVLRSSDPDYVAAVDTWMGKLLPMMKPYLYQNGGPIITVQVENEYGSYFACDYNYMRHLTKLFRSHLGEDVVLFTTDGAGLNYLKCGAI-QGLYASVDFGPGS--NITAAFEAQRHAEPHGPLVNSEFYTGWLDHWGSRHSVVSPDLVAKSLNQ--QLAMGANVNMYMFIGGTNFGYWNGANS-PYSAQPTSYDYDAPLTEAGDLTEKYFAIRE-VIRMYRRIPEGPVPPSTPKYAYGAVTMKKLQTVADALEILSFSGPVKSTYPQTFIDLNQAYGYVLYRTTLPVTCSEPT--PLSSPLNGVHDRAYV------SVDGVAAGILERNKVISINVTGKAGSQLDMLVENMGRINYGKG-INDFKGLVSNLTLGKDTLTGWTMYGLSIDDAVSQGRLGETPSAWANPPQPASLSTPAFYGGSFIIPDGIPDLPQDTYIKLPNWRKGQIWINGVNLGRYWPARGPQMTLFVPVNLLSTAAPNNVTVLELEGASCNPQPCTVEFSATPILNATVQ 637          
BLAST of Beta-galactosidase vs. Ensembl Medaka
Match: glb1l (beta-galactosidase [Source:NCBI gene;Acc:101172034])

HSP 1 Score: 492.656 bits (1267), Expect = 5.505e-166
Identity = 275/622 (44.21%), Postives = 395/622 (63.50%), Query Frame = 1
Query:  226 SNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAN-DPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDY--LFHLLGQVG-FKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRR-TMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHL--ANISSVTDS-FQNPSVSAPXXXXXXXXXXXXXXSPD----DTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGY-NTVRLFELEGANCQGNCTIEFVDEPIL 2052
            +  TF+ID+ NN FLKDGKPF+YISGS+ Y+RIP+YYW DRL+KM  +GLNA+Q Y+PWN+HE  +G+ NF G+ DL  FL +A +  LLV++R GPY+C EW+ GGLPAWLL+K P + LR++D DY+ +V  W +VLLP ++P LY N G I+ VQVENEYGS+Y CD NY+R L    RS LG+D+++++TDGN    + CG+ +  +++T+DFGT  +   A AF+  ++++P GP +NSE+Y+GWLD WG +H  V    V R L  +   +M  NVNMYMF GGT+FG+WNGA+ D  +   ++SYDYDAPL+EAGD T K LAIR+ +     + P  P+PP T K AYG + L++V +   L  L+  +G  KS YP+T E + QY GYM+Y T+     +E +   +    + + D AY+  +       T+ G L R T   +++T K  + L VL+EN G +NFG   IND KG++ ++ +   IL++W  YP+ +  A +     S +Q    S  T+       ++ T  P+    D+FLK   ++KG V ING NLGRYW  +GPQ TL+VP  +L+    N + + ELEGA    +  + F+D P L
Sbjct:   21 AKNTFSIDYKNNCFLKDGKPFQYISGSIHYSRIPQYYWKDRLMKMYMSGLNAVQVYVPWNFHEAVQGVQNFTGDQDLEYFLHLANQTGLLVIMRPGPYICAEWEMGGLPAWLLQK-PSIRLRTADTDYMQAVSTWLAVLLPKMRPWLYINGGNIITVQVENEYGSYYACDYNYMRHLRTLFRSFLGEDVVLFTTDGNTDKEMICGTLEG-LYATIDFGTDTSV--AEAFKRQRQFEPHGPLINSEFYTGWLDHWGDQHAMVDARKVSRVLGEML--TMGANVNMYMFEGGTNFGYWNGADHDSRFRSVVTSYDYDAPLTEAGDPTEKLLAIRDVVAQFR-EVPSGPIPPATPKFAYGFVTLKKVGNVSSLLDLISPLGPVKSHYPLTFEEMKQYYGYMLYRTALPRDLNEPT--PLISPLNGVHDRAYVSVNG------TFQGLLERDTTLVMNITGKQGDTLDVLVENMGRVNFGS-KINDHKGLLSDLILGKDILTDWQIYPLDIDGAIVRGWPHSVYQKTPPSTHTKTAAGPAFYYGTLPPNGLAWDSFLKLKEWTKGQVWINGVNLGRYWPARGPQRTLYVPGPLLRNSLPNNITVLELEGA--PAHLQVLFMDRPQL 624          
BLAST of Beta-galactosidase vs. Ensembl Medaka
Match: si:dkey-224e22.2 (beta-galactosidase-1-like protein 2 [Source:NCBI gene;Acc:101157386])

HSP 1 Score: 342.043 bits (876), Expect = 4.592e-108
Identity = 217/612 (35.46%), Postives = 329/612 (53.76%), Query Frame = 1
Query:  223 LSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRI-FSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAND-PPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGF-----KSPYPITMESL------NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLF-VLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN--ISSVTDSFQ-NPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGAN 2007
            +S R    D T   F  +GKPFR + GSV Y R+P  YW DRLL+MKA GLN +  Y+PWN HE E G ++F    DL  ++ +A ++ L V+LR GPY+C EWD GGLP+WLL ++  M LR++   ++++V  ++  L+P +KP +++  GPI+ VQVENEYGS Y  D  Y+  + + ++S   +++++ S +  G  Y     + + I F  +  G         A + L   QP+ P +  EY+SGW D WG  H+    +D++  +  L   S  V++N+YMFHGGT+FGF NGA D   Y PQ++SYDYDAPLSEAGD T K   +RN L S     P   VP    + AY P++++Q       L   + F     +S   + ME+L       Q  GY +Y T+ +   +  S  +++       D A +F       E  Y+G L      ++L     E +   L+EN G +N+G+ + +  KGI+G++ +N   L  +  + + +    I+ +T + Q      +    G       V  SP DTF++ + + KGVV +NG NLGRYW   GPQ  L++P   L+ G N + LFE +  N
Sbjct:    1 MSRRGLRADSTQ--FTLEGKPFRILGGSVHYFRVPRPYWRDRLLQMKACGLNTLTTYVPWNLHEPERGTFHFHDQLDLKSYIRLAAEMGLWVILRPGPYICAEWDLGGLPSWLL-QDKDMQLRTTYPGFVNAVNLYFDKLIPTVKPLMFEEGGPIIAVQVENEYGS-YAKDEEYMPFIRNCLQSRGVNELLMTSDNWEGLKYGGVAGALKTINFQRLSVG---------AIQHLADMQPQKPLLVMEYWSGWFDVWGEHHHVFHAEDMLAVVSEL--LSRGVSINLYMFHGGTNFGFMNGALDFGTYKPQVTSYDYDAPLSEAGDCTMKCQLLRN-LFSQYHSEPLPQVPSPQERRAYEPVVMQQ----HLSLWDSLHFTDKPHRSEKALNMENLPVNNNNGQSYGYTLYETTVTSGGALNSMNNIR-------DRALVF------VEREYVGCLDYKTQKVTLPEAKGERMLSFLVENCGRVNYGKALNDQRKGIVGDIVLNHSPLRGFNIFCLDMKPRFINRLTHTAQWKTDFRSLAVPGFLQARLNVDGSPRDTFIQMTGWGKGVVFVNGQNLGRYWFI-GPQRFLYLPGHWLRSGENQIILFEEQRTN 578          
BLAST of Beta-galactosidase vs. Ensembl Medaka
Match: ENSORLT00000018288.2 (galactosidase beta 1 like 2 [Source:NCBI gene;Acc:101157148])

HSP 1 Score: 341.273 bits (874), Expect = 2.515e-107
Identity = 221/609 (36.29%), Postives = 338/609 (55.50%), Query Frame = 1
Query:  265 FLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGA---NDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTT-KTAYGPLILEQVPDYLFHL-LGQVGFKSPYPITMESL------NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSL-TMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN--ISSVTDSFQNPSV-SAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEP 2046
            F  + KPF  + GS+ Y R+P+ YW DRLLK+KA GLN +  Y+PWN HE E G+++F G  DL  +L +A  L + V+LR GPY+C EWD GGLP+WLL ++  M LR++   + ++V  ++  L+  + P+ Y   GPI+ VQVENEYGS Y  D  Y+  + + + S    ++++ S + +G   L  G   +    T++F      +P    + L++ QP+ P++  EY+SGW D WG  H+    ++++  +  +    MS  +N+YMFHGGT+FGF +GA     P   P ++SYDYDAPLSEAGD T+KY  +RN L S +   P LP PP  T ++ Y P+I+ Q       L   +  FKS  P+ ME+L       Q  GY +Y T  S   S  S  +++       D A +F       E  ++G L     +LS+   K    L +L+EN G +N+G+ +    KG++G++ +N  IL ++M + + +    +S +  S Q  S+   P+    F    ++++SP DTFLK   +SKGVV +NG NLGRYW+  GPQ TL+VP   L    N + +FE      + +  ++F   P
Sbjct:   55 FTLERKPFLILGGSIHYFRVPKAYWEDRLLKLKACGLNTLTTYVPWNLHEPERGVFDFEGELDLEAYLGLAASLGIWVILRPGPYICAEWDLGGLPSWLL-RDQNMRLRTTYPGFTAAVDSYFDHLIKKVAPYQYSRGGPIIAVQVENEYGS-YAMDEEYMPFIKEALLSRGITELLVTSDNKDG---LKLGGV-KGALETINFQK---LDP-EEIKYLEKIQPQKPKMVMEYWSGWFDLWGGLHHVFPAEEMMAVVTEILKLDMS--INLYMFHGGTNFGFMSGAFAVGRPSPAPMVTSYDYDAPLSEAGDYTTKYHLLRN-LFSHHHRVP-LPKPPEATERSPYRPVIVRQHLSLWSCLDFTEQPFKSEKPVNMENLPVNNNNGQAYGYTLYETIISSGGSLKSLNNIR-------DRALVF------VEKQFVGVLDYKEQELSIPDGKGKRTLGLLVENCGRVNYGKTLDEQRKGLVGDIQLNANILRDFMIHSLDMKPDFVSRLQSSAQWKSMREKPSFPAFFQTKLYLSSSPKDTFLKLPGWSKGVVFVNGKNLGRYWSV-GPQQTLYVPGAWLNRWDNEIIVFE----ELETDGKVQFSSSP 631          
BLAST of Beta-galactosidase vs. Ensembl Medaka
Match: si:dkey-224e22.2 (beta-galactosidase-1-like protein 2 [Source:NCBI gene;Acc:101157386])

HSP 1 Score: 253.447 bits (646), Expect = 4.200e-75
Identity = 198/615 (32.20%), Postives = 287/615 (46.67%), Query Frame = 1
Query:  223 LSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHL---GDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSW-GLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGAND-PPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGF-----KSPYPITMESL------NQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLF-VLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLAN--ISSVTDSFQ-NPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGAN 2007
            +S R    D T   F  +GKPFR + GSV Y R+P  YW DRLL+MKA GLN +  Y+PWN HE E G ++F    DL  ++ +A ++ L V+LR GPY+C EWD GGLP+WLL           DKD                             +Q+   Y  F    N Y   L  TV+  +   G  II    + N Y                     G++     +    R   +   VN    +   D+W GL++  V+ D +    + L   S  V++N+YMFHGGT+FGF NGA D   Y PQ++SYDYDAPLSEAGD T K   +RN L S     P   VP    + AY P++++Q       L   + F     +S   + ME+L       Q  GY +Y T+ +   +  S  +++       D A +F       E  Y+G L      ++L     E +   L+EN G +N+G+ + +  KGI+G++ +N   L  +  + + +    I+ +T + Q      +    G       V  SP DTF++ + + KGVV +NG NLGRYW   GPQ  L++P   L+ G N + LFE +  N
Sbjct:    1 MSRRGLRADSTQ--FTLEGKPFRILGGSVHYFRVPRPYWRDRLLQMKACGLNTLTTYVPWNLHEPERGTFHFHDQLDLKSYIRLAAEMGLWVILRPGPYICAEWDLGGLPSWLL----------QDKD-----------------------------MQLRTTYPGFVNAVNLYFDKLIPTVKPLMFEEGGPIIAVQVE-NEY---------------------GSYAKDEEYMPFIRNCLQSRGVNELLMTS--DNWEGLKYGGVAGDMLAVVSELL---SRGVSINLYMFHGGTNFGFMNGALDFGTYKPQVTSYDYDAPLSEAGDCTMKCQLLRN-LFSQYHSEPLPQVPSPQERRAYEPVVMQQ----HLSLWDSLHFTDKPHRSEKALNMENLPVNNNNGQSYGYTLYETTVTSGGALNSMNNIR-------DRALVF------VEREYVGCLDYKTQKVTLPEAKGERMLSFLVENCGRVNYGKALNDQRKGIVGDIVLNHSPLRGFNIFCLDMKPRFINRLTHTAQWKTDFRSLAVPGFLQARLNVDGSPRDTFIQMTGWGKGVVFVNGQNLGRYWFI-GPQRFLYLPGHWLRSGENQIILFEEQRTN 528          
BLAST of Beta-galactosidase vs. Planmine SMEST
Match: SMESG000012792.1 (SMESG000012792.1)

HSP 1 Score: 1265.37 bits (3273), Expect = 0.000e+0
Identity = 648/654 (99.08%), Postives = 650/654 (99.39%), Query Frame = 1
Query:  115 MNYXXXXXXXXXXXXXXSTNSEPNFSTKISLLTDKGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEPILDGPVHLAL 2076
            MNYFIHFFAIFLF NGFSTNSEPNFSTKISLLTD GLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAF DLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYS+SVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISS TDSFQNPSVSAPTQGGLFTGTFFVTTSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANC+GNCTIEFVDEPILDGPVHLAL
Sbjct:    1 MNYFIHFFAIFLFLNGFSTNSEPNFSTKISLLTDNGLSNRTFTIDFTNNVFLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFGDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSLSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSFTDSFQNPSVSAPTQGGLFTGTFFVTTSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGANCKGNCTIEFVDEPILDGPVHLAL 654          
BLAST of Beta-galactosidase vs. Planmine SMEST
Match: SMESG000062821.1 (SMESG000062821.1)

HSP 1 Score: 253.832 bits (647), Expect = 1.071e-74
Identity = 194/611 (31.75%), Postives = 308/611 (50.41%), Query Frame = 1
Query:  265 FLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDT-VRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGA----NDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLS---INPDHPFLPVPPNTTKTAYGPL----------ILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEY-QSEFSH--QDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFG----QGMINDVKGIIGNVTVNDKILSNWMHYPIH-----LANISSVTD-SFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGA 2004
            +LKD +PF+ +SGS+ Y R+P   W  +L  +K+AGLN ++ Y PWN HE  +G++NF GN ++  F+ +A  L L V+LR GPY+CGE +FGGLP+WLL  +P M +RS    ++  V  +   LL  I    + N GPI+  Q+ENEYG+F     +Y++ + +  VRS + + + I     N +  +        +F  ++       +  +    +    P+ P   SE ++GW  SW   +  +  ++  + L T        + N+YMFHGGT+FGF NG     N P Y+   +SYDY+APLSE G    K+  +R A+L+    + +     VP   +   YG +          ILE V D +      +      PI  +S  Q  G+++Y T  ++  +  FS   +D  I   +       + ++  NS+     ++   ++    T K    L  LIEN G  N+     +      KG+ G V + +K + NW  YP+      +  IS+ ++    NP V    +  ++   F +   P +T L  S+++KGVV ING+NLGRYWNT GP  +LF+PK+ L+ G N + +FEL  A
Sbjct:    3 YLKD-EPFQILSGSIHYFRVPPDQWKKKLKYLKSAGLNTVETYCPWNLHEERKGLFNFEGNLNIRSFVQMAHDLGLFVILRPGPYICGELEFGGLPSWLL-SDPNMKIRSMYIGFMVPVEDYLRQLLREINDLQHSNGGPIIAFQIENEYGTFGNSP-SYMQAMKEIYVRSGVVESMFI----SNDFEGIGNQKKIDNVFYAINTNKLSQIDKMAQV--ISALDPESPIFISELFTGWFQSWQKSNIDIIQNEEFKLLITSV-LKKGYSFNLYMFHGGTNFGFMNGGSNLTNTPIYVA--TSYDYNAPLSEDGIPNKKFFILRKAILNHLVTDKNFKIADVPELESPVRYGDVDMTHILELDSILELVDDMVVSY--DLKMMEELPINGKS-GQNFGFIVYRTEVTQLSRVVFSGNIRDRAIVLYQYEPLTNYWKTSLINSKDQNWSNILNNITKYK-TSKEINYLDFLIENMGRFNYANFQTETFNEQRKGMKGTVFIGNKTVDNWKIYPLEFKKPFIHKISASSNWKIYNPQV-IEQRPRMYKSIFIINEKPSNTHLLMSSWTKGVVFINGYNLGRYWNT-GPTQSLFLPKSFLRYGENEIIIFELHIA 595          
BLAST of Beta-galactosidase vs. Planmine SMEST
Match: SMESG000062821.1 (SMESG000062821.1)

HSP 1 Score: 253.447 bits (646), Expect = 4.275e-74
Identity = 194/611 (31.75%), Postives = 308/611 (50.41%), Query Frame = 1
Query:  265 FLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHEYEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLLKKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEYGSFYTCDNNYLRVLYDT-VRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFSTVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVSTDDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGA----NDPPYLPQISSYDYDAPLSEAGDITSKYLAIRNALLS---INPDHPFLPVPPNTTKTAYGPL----------ILEQVPDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEY-QSEFSH--QDVKIKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIENSGHINFG----QGMINDVKGIIGNVTVNDKILSNWMHYPIH-----LANISSVTD-SFQNPSVSAPXXXXXXXXXXXXXXSPDDTFLKTSNFSKGVVLINGFNLGRYWNTKGPQYTLFVPKTVLKLGYNTVRLFELEGA 2004
            +LKD +PF+ +SGS+ Y R+P   W  +L  +K+AGLN ++ Y PWN HE  +G++NF GN ++  F+ +A  L L V+LR GPY+CGE +FGGLP+WLL  +P M +RS    ++  V  +   LL  I    + N GPI+  Q+ENEYG+F     +Y++ + +  VRS + + + I     N +  +        +F  ++       +  +    +    P+ P   SE ++GW  SW   +  +  ++  + L T        + N+YMFHGGT+FGF NG     N P Y+   +SYDY+APLSE G    K+  +R A+L+    + +     VP   +   YG +          ILE V D +      +      PI  +S  Q  G+++Y T  ++  +  FS   +D  I   +       + ++  NS+     ++   ++    T K    L  LIEN G  N+     +      KG+ G V + +K + NW  YP+      +  IS+ ++    NP V    +  ++   F +   P +T L  S+++KGVV ING+NLGRYWNT GP  +LF+PK+ L+ G N + +FEL  A
Sbjct:   56 YLKD-EPFQILSGSIHYFRVPPDQWKKKLKYLKSAGLNTVETYCPWNLHEERKGLFNFEGNLNIRSFVQMAHDLGLFVILRPGPYICGELEFGGLPSWLL-SDPNMKIRSMYIGFMVPVEDYLRQLLREINDLQHSNGGPIIAFQIENEYGTFGNSP-SYMQAMKEIYVRSGVVESMFI----SNDFEGIGNQKKIDNVFYAINTNKLSQIDKMAQV--ISALDPESPIFISELFTGWFQSWQKSNIDIIQNEEFKLLITSV-LKKGYSFNLYMFHGGTNFGFMNGGSNLTNTPIYVA--TSYDYNAPLSEDGIPNKKFFILRKAILNHLVTDKNFKIADVPELESPVRYGDVDMTHILELDSILELVDDMVVSY--DLKMMEELPINGKS-GQNFGFIVYRTEVTQLSRVVFSGNIRDRAIVLYQYEPLTNYWKTSLINSKDQNWSNILNNITKYK-TSKEINYLDFLIENMGRFNYANFQTETFNEQRKGMKGTVFIGNKTVDNWKIYPLEFKKPFIHKISASSNWKIYNPQV-IEQRPRMYKSIFIINEKPSNTHLLMSSWTKGVVFINGYNLGRYWNT-GPTQSLFLPKSFLRYGENEIIIFELHIA 648          
The following BLAST results are available for this feature:
BLAST of Beta-galactosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLB18.617e-16943.08galactosidase beta 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
GLB19.589e-16843.13galactosidase beta 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
GLB1L1.222e-14943.06galactosidase beta 1 like [Source:HGNC Symbol;Acc:... [more]
GLB1L1.222e-14943.06galactosidase beta 1 like [Source:HGNC Symbol;Acc:... [more]
GLB1L37.186e-9534.19galactosidase beta 1 like 3 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bgal-11.180e-13639.72Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
bgal-11.180e-13639.72Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
bgal-22.466e-9533.12Beta GALactosidase homolog [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ect35.805e-12938.05gene:FBgn0260746 transcript:FBtr0082487[more]
Gal1.195e-10935.12gene:FBgn0001089 transcript:FBtr0079230[more]
Gal2.163e-10934.90gene:FBgn0001089 transcript:FBtr0332603[more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glb12.532e-16744.60galactosidase, beta 1 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
glb1l1.125e-16644.68galactosidase, beta 1-like [Source:ZFIN;Acc:ZDB-GE... [more]
glb1l5.130e-16142.88galactosidase, beta 1-like [Source:ZFIN;Acc:ZDB-GE... [more]
si:dkey-224e22.21.361e-10636.42si:dkey-224e22.2 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
si:dkey-224e22.21.361e-10636.42si:dkey-224e22.2 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bcar15.027e-18044.25BCAR1, Cas family scaffold protein [Source:Xenbase... [more]
bcar11.086e-17944.25BCAR1, Cas family scaffold protein [Source:Xenbase... [more]
bcar13.665e-17744.48BCAR1, Cas family scaffold protein [Source:Xenbase... [more]
bcar19.815e-17744.66BCAR1, Cas family scaffold protein [Source:Xenbase... [more]
bcar11.174e-17644.18BCAR1, Cas family scaffold protein [Source:Xenbase... [more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glb12.338e-17644.95galactosidase, beta 1 [Source:MGI Symbol;Acc:MGI:8... [more]
Glb1l5.146e-14542.19galactosidase, beta 1-like [Source:MGI Symbol;Acc:... [more]
Glb1l5.146e-14542.19galactosidase, beta 1-like [Source:MGI Symbol;Acc:... [more]
Glb11.487e-10153.33galactosidase, beta 1 [Source:MGI Symbol;Acc:MGI:8... [more]
Glb1l21.656e-8934.18galactosidase, beta 1-like 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Beta-galactosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23780|BGAL_MOUSE1.636e-17544.95Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb... [more]
sp|Q58D55|BGAL_BOVIN2.573e-17545.85Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 P... [more]
sp|O19015|BGAL_FELCA7.622e-17445.30Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 ... [more]
sp|Q9TRY9|BGAL_CANLF1.889e-17244.81Beta-galactosidase OS=Canis lupus familiaris OX=96... [more]
sp|Q5R7P4|BGAL_PONAB1.053e-16943.23Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1... [more]
back to top
BLAST of Beta-galactosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3VDU90.000e+048.08Beta-galactosidase OS=Sarcophilus harrisii OX=9305... [more]
A0A0R3W9I15.000e-17946.45Beta-galactosidase OS=Taenia asiatica OX=60517 GN=... [more]
A0A068Y5S41.235e-17846.50Beta-galactosidase OS=Echinococcus multilocularis ... [more]
A0A068WBF11.533e-17846.34Beta-galactosidase OS=Echinococcus granulosus OX=6... [more]
A0A0X3PRQ24.729e-17845.71Beta-galactosidase OS=Schistocephalus solidus OX=7... [more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glb13.089e-16244.09galactosidase beta 1 [Source:NCBI gene;Acc:1030236... [more]
glb13.202e-15743.87galactosidase beta 1 [Source:NCBI gene;Acc:1030236... [more]
GLB1L1.485e-13743.77galactosidase beta 1 like [Source:HGNC Symbol;Acc:... [more]
ENSAMXT00000045467.19.110e-12638.49pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
b3gat1b3.149e-9034.29beta-galactosidase-1-like protein 2 [Source:NCBI g... [more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
glb1l4.826e-14741.36galactosidase, beta 1-like [Source:ZFIN;Acc:ZDB-GE... [more]
b3gat1b3.098e-8836.07beta-1,3-glucuronyltransferase 1 (glucuronosyltran... [more]
ENSPMAT00000002943.15.162e-2737.63pep scaffold:Pmarinus_7.0:GL488193:410:6860:1 gene... [more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-galactosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398706.266e-17043.04Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A... [more]
EDO462362.057e-16844.25Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A... [more]
EDO496671.127e-16042.14Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A... [more]
EDO406794.824e-10035.22Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A... [more]
EDO379271.217e-9835.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-galactosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glb12.241e-17446.02galactosidase beta 1 [Source:NCBI gene;Acc:1011674... [more]
glb1l5.505e-16644.21beta-galactosidase [Source:NCBI gene;Acc:101172034... [more]
si:dkey-224e22.24.592e-10835.46beta-galactosidase-1-like protein 2 [Source:NCBI g... [more]
ENSORLT00000018288.22.515e-10736.29galactosidase beta 1 like 2 [Source:NCBI gene;Acc:... [more]
si:dkey-224e22.24.200e-7532.20beta-galactosidase-1-like protein 2 [Source:NCBI g... [more]
back to top
BLAST of Beta-galactosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000012792.10.000e+099.08SMESG000012792.1[more]
SMESG000062821.11.071e-7431.75SMESG000062821.1[more]
SMESG000062821.14.275e-7431.75SMESG000062821.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022332 ID=SMED30022332|Name=Beta-galactosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2180bp
TATAAATGCCATTATTTTAAAATATTTTTTTTCAAAATTATTTTGCAAAT
TTAACATTTGTTTACTAAATATTTGAACAAAAAATTTTTTCTTATCTAAA
TAAATATTCTATTTATGAATTATTTTATTCACTTTTTTGCAATATTTCTT
TTTTTTAATGGTTTCTCAACAAATTCTGAGCCAAATTTTTCCACAAAGAT
TTCTCTATTGACAGACAAAGGTCTTTCCAATCGAACCTTTACCATAGATT
TTACAAATAATGTGTTTTTAAAAGATGGAAAGCCGTTTCGATACATTTCT
GGCAGTGTTTTATATACTCGAATTCCGGAATATTATTGGCATGATCGGCT
GCTGAAAATGAAAGCAGCTGGATTGAACGCGATTCAATTTTATATACCGT
GGAACTACCATGAGTACGAGGAAGGTATTTACAATTTCATCGGCAATGGA
GATTTGAGCAAATTTCTTACTATTGCTCGAAAACTGGATTTGTTAGTCTT
ATTGAGAAGTGGGCCTTACATGTGCGGTGAATGGGATTTCGGAGGACTTC
CTGCTTGGCTATTGAAAAAAAATCCAAAAATGATCCTTCGATCTTCAGAT
AAAGATTATCTCTCTTCGGTCTTAAAATGGTATTCTGTGCTATTACCAAT
CATTAAGCCTCATCTTTATCAGAACAATGGACCTATTGTCATGGTTCAGG
TAGAAAATGAATACGGATCATTTTATACATGTGATAATAATTATTTACGT
GTTCTTTATGATACTGTTCGATCACATCTTGGAGACGACATCATTATTTA
TTCAACTGACGGAAACGGTTATTCGTATCTTACTTGCGGTTCTTCTGATA
GACGTATTTTTTCAACTGTTGATTTTGGCACATCAGGTGCATTTAATCCA
GCATCAGCATTCAGGGATTTGAAACGATGGCAACCGAAAGGTCCCCAGGT
AAATTCTGAATATTATTCTGGCTGGTTAGATTCATGGGGTTTAAGACATA
ACAAAGTTAGTACAGATGATGTGGTCCGTGGACTGAAAACTTTGTATAAT
TATTCAATGAGCGTCAATGTCAACATGTATATGTTTCATGGGGGAACTTC
TTTTGGATTTTGGAATGGAGCCAATGATCCGCCATATTTGCCACAAATAA
GTAGCTATGATTACGACGCTCCCTTGTCGGAAGCTGGAGATATCACATCG
AAATATTTAGCTATACGAAATGCTTTACTCTCAATTAATCCAGACCATCC
GTTTCTCCCTGTTCCACCCAATACAACAAAGACTGCATACGGCCCATTGA
TACTTGAGCAGGTCCCTGATTATTTGTTTCACTTGCTTGGTCAAGTTGGA
TTCAAGTCACCTTATCCGATTACTATGGAATCTTTGAATCAGTACCAAGG
CTATATGATATATTTCACATCTACCTCTGAATATCAGTCAGAATTTTCGC
ATCAGGATGTAAAAATTAAATTTTCAAGAATCGGTGATTTTGCTTATATA
TTCTCGAGCAATAAAGATAATTCAGAAATAACTTATATTGGAAGTCTCAG
AAGAACGATGAGCGATTTATCCTTGACGATGAAGTTGGCTGAAAACTTAT
TTGTTTTAATTGAGAATTCCGGTCACATTAATTTTGGCCAGGGCATGATC
AATGACGTGAAAGGAATTATTGGAAATGTGACAGTCAATGATAAAATATT
GTCGAATTGGATGCATTACCCGATTCATTTAGCGAATATCTCTTCAGTTA
CAGATTCATTCCAAAACCCAAGCGTTTCAGCTCCAACTCAAGGCGGATTG
TTTACTGGAACTTTCTTTGTAACAACATCTCCTGATGATACGTTTCTAAA
AACTTCAAATTTCAGTAAAGGAGTCGTTTTAATTAATGGTTTCAATCTCG
GCCGGTATTGGAATACAAAAGGTCCCCAATATACTTTGTTTGTTCCGAAA
ACGGTTTTGAAATTGGGGTATAATACTGTCCGCTTGTTTGAATTAGAGGG
AGCTAATTGTCAGGGAAATTGTACAATAGAATTTGTAGATGAGCCTATTC
TAGATGGACCCGTTCATTTAGCCTTGTGATATTGTTGTCTATTTTTTATT
CTGGATATTTAAAATTGTTTAAACTTTGTGATTTTTCGGCTAATTTTTTA
TAAATAAATTCACTAATTGTGTAAAAAAAA
back to top

protein sequence of SMED30022332-orf-1

>SMED30022332-orf-1 ID=SMED30022332-orf-1|Name=SMED30022332-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=655bp
MNYFIHFFAIFLFFNGFSTNSEPNFSTKISLLTDKGLSNRTFTIDFTNNV
FLKDGKPFRYISGSVLYTRIPEYYWHDRLLKMKAAGLNAIQFYIPWNYHE
YEEGIYNFIGNGDLSKFLTIARKLDLLVLLRSGPYMCGEWDFGGLPAWLL
KKNPKMILRSSDKDYLSSVLKWYSVLLPIIKPHLYQNNGPIVMVQVENEY
GSFYTCDNNYLRVLYDTVRSHLGDDIIIYSTDGNGYSYLTCGSSDRRIFS
TVDFGTSGAFNPASAFRDLKRWQPKGPQVNSEYYSGWLDSWGLRHNKVST
DDVVRGLKTLYNYSMSVNVNMYMFHGGTSFGFWNGANDPPYLPQISSYDY
DAPLSEAGDITSKYLAIRNALLSINPDHPFLPVPPNTTKTAYGPLILEQV
PDYLFHLLGQVGFKSPYPITMESLNQYQGYMIYFTSTSEYQSEFSHQDVK
IKFSRIGDFAYIFSSNKDNSEITYIGSLRRTMSDLSLTMKLAENLFVLIE
NSGHINFGQGMINDVKGIIGNVTVNDKILSNWMHYPIHLANISSVTDSFQ
NPSVSAPTQGGLFTGTFFVTTSPDDTFLKTSNFSKGVVLINGFNLGRYWN
TKGPQYTLFVPKTVLKLGYNTVRLFELEGANCQGNCTIEFVDEPILDGPV
HLAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001944Glycoside_Hdrlase_35
IPR026283B-gal_1-like
IPR013781Glyco_hydro_catalytic_dom
IPR031330Gly_Hdrlase_35_cat
IPR008979Galactose-bd-like_sf
IPR017853Glycoside_hydrolase_SF
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0044262cellular carbohydrate metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0043231intracellular membrane-bounded organelle
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001944Glycoside hydrolase, family 35PRINTSPR00742GLHYDRLASE35coord: 186..201
score: 61.76
coord: 317..332
score: 57.72
coord: 279..294
score: 37.5
coord: 130..149
score: 70.59
coord: 342..358
score: 61.59
coord: 54..71
score: 45.1
coord: 75..93
score: 52.32
coord: 585..601
score: 53.98
IPR001944Glycoside hydrolase, family 35PANTHERPTHR23421BETA-GALACTOSIDASE RELATEDcoord: 32..651
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 35..319
e-value: 9.7E-100
score: 335.7
NoneNo IPR availablePANTHERPTHR23421:SF50BETA-GALACTOSIDASE-1-LIKE PROTEINcoord: 32..651
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.664
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 397..538
e-value: 8.9E-88
score: 296.6
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 322..628
e-value: 8.9E-88
score: 296.6
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 498..636
IPR026283Beta-galactosidase 1-likePIRSFPIRSF006336B-galcoord: 14..647
e-value: 7.0E-206
score: 682.8
IPR031330Glycoside hydrolase 35, catalytic domainPFAMPF01301Glyco_hydro_35coord: 51..370
e-value: 5.9E-105
score: 351.4
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 42..371