Translocon-associated protein, gamma subunit

Overview
NameTranslocon-associated protein, gamma subunit
Smed IDSMED30022331
Length (bp)814
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Translocon-associated protein, gamma subunit (SMED30022331) t-SNE clustered cells

Violin plots show distribution of expression levels for Translocon-associated protein, gamma subunit (SMED30022331) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Translocon-associated protein, gamma subunit (SMED30022331) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Translocon-associated protein, gamma subunit (SMED30022331) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022331

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022331SMESG000066628.1 dd_Smed_v4_1265_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022331SMESG000066628.1 dd_Smed_v4_1265_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022331SMESG000066628.1 dd_Smed_v4_1265_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022331SMESG000066628.1 dd_Smed_v4_1265_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022331SMESG000066628.1 dd_Smed_v4_1265_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022331SMESG000066628.1 dd_Smed_v4_1265_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022331SMESG000066628.1 dd_Smed_v4_1265_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022331SMESG000066628.1 Contig39114newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022331SMESG000066628.1 Contig39114uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30022331SMESG000066628.1 dd_Smed_v6_1265_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022331SMESG000066628.1 dd_Smed_v6_1265_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30022331SMESG000066628.1 dd_Smed_v6_1265_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30022331SMESG000066628.1 dd_Smed_v6_1265_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Human
Match: SSR3 (signal sequence receptor subunit 3 [Source:HGNC Symbol;Acc:HGNC:11325])

HSP 1 Score: 187.578 bits (475), Expect = 4.197e-59
Identity = 102/177 (57.63%), Postives = 145/177 (81.92%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Human
Match: SSR3 (signal sequence receptor subunit 3 [Source:HGNC Symbol;Acc:HGNC:11325])

HSP 1 Score: 177.563 bits (449), Expect = 5.263e-55
Identity = 102/190 (53.68%), Postives = 145/190 (76.32%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDR-------------ILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+R             ILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERFDSCLKYGHHKRGILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 197          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Human
Match: SSR3 (signal sequence receptor subunit 3 [Source:HGNC Symbol;Acc:HGNC:11325])

HSP 1 Score: 172.555 bits (436), Expect = 2.343e-53
Identity = 79/128 (61.72%), Postives = 107/128 (83.59%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTT 452
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TT
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATT 135          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Human
Match: SSR3 (signal sequence receptor subunit 3 [Source:HGNC Symbol;Acc:HGNC:11325])

HSP 1 Score: 122.479 bits (306), Expect = 1.873e-34
Identity = 71/132 (53.79%), Postives = 107/132 (81.06%), Query Frame = 3
Query:  210 MDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    1 MDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 132          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Human
Match: SSR3 (signal sequence receptor subunit 3 [Source:HGNC Symbol;Acc:HGNC:11325])

HSP 1 Score: 122.479 bits (306), Expect = 1.873e-34
Identity = 71/132 (53.79%), Postives = 107/132 (81.06%), Query Frame = 3
Query:  210 MDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    1 MDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 132          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Celegans
Match: trap-3 (TRanslocon-Associated Protein [Source:UniProtKB/TrEMBL;Acc:Q95XS1])

HSP 1 Score: 134.42 bits (337), Expect = 7.635e-39
Identity = 79/174 (45.40%), Postives = 121/174 (69.54%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTG 596
            KL+KEEE+LL  +S + STK +  FY NA I+SI P++LF+ +H M+I    V + + ++ +AYL+++A KN K +LKH+I +KR  A+ RE++ ++  DKK+T KEK++R L++KNEVAD EST  S+   NSL++ I+L+S+F +L N A + N  +S   +A LVA  ST 
Sbjct:    3 KLTKEEELLLSSYSATSSTKGNLFFYLNALIISIAPLYLFYGVHQMEIQDSLVVWGLSAVGTAYLLSLACKNQKCLLKHQIVMKRGSAVEREISGQYAADKKMTVKEKEERALFRKNEVADTESTYLSVFYTNSLYLTIMLVSAFFLLANVAPVFNLLISTIGSAGLVAFLSTA 176          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Fly
Match: CG5885 (gene:FBgn0025700 transcript:FBtr0445309)

HSP 1 Score: 202.986 bits (515), Expect = 1.734e-65
Identity = 105/174 (60.34%), Postives = 142/174 (81.61%), Query Frame = 3
Query:   78 LSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
             +KEEE+LLQDFSR+VSTKSSALFYGNAFIVS +PIWLFWRIH+MD+   ++ F++ +  S YL+A AYKN KF LKHKIA +RE+A+ RE+N++ GDDKK+TRKEKD+RILWKKNEVAD+E+TTFSI  NN++++ +++  SF +L+N    +NY  S+G A+  ++LFST +
Sbjct:   14 FTKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHNMDLWPSSILFVLVTAASTYLMATAYKNIKFQLKHKIAGRREEAVTREVNRQVGDDKKVTRKEKDERILWKKNEVADYEATTFSIFYNNAIYLAVIIFISFFILKNSTPFINYIFSVGIASGALSLFSTSA 187          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Fly
Match: CG5885 (gene:FBgn0025700 transcript:FBtr0079900)

HSP 1 Score: 202.986 bits (515), Expect = 1.734e-65
Identity = 105/174 (60.34%), Postives = 142/174 (81.61%), Query Frame = 3
Query:   78 LSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
             +KEEE+LLQDFSR+VSTKSSALFYGNAFIVS +PIWLFWRIH+MD+   ++ F++ +  S YL+A AYKN KF LKHKIA +RE+A+ RE+N++ GDDKK+TRKEKD+RILWKKNEVAD+E+TTFSI  NN++++ +++  SF +L+N    +NY  S+G A+  ++LFST +
Sbjct:   14 FTKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHNMDLWPSSILFVLVTAASTYLMATAYKNIKFQLKHKIAGRREEAVTREVNRQVGDDKKVTRKEKDERILWKKNEVADYEATTFSIFYNNAIYLAVIIFISFFILKNSTPFINYIFSVGIASGALSLFSTSA 187          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Zebrafish
Match: ssr3 (signal sequence receptor, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-9134])

HSP 1 Score: 187.193 bits (474), Expect = 3.041e-59
Identity = 103/177 (58.19%), Postives = 144/177 (81.36%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KS+ALFYGNA IVS +PIWLFWRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+L+V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSTALFYGNALIVSAIPIWLFWRIWHMDLVQSAVLYAVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLLLVIVASFFLLKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Zebrafish
Match: ssr3 (signal sequence receptor, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-9134])

HSP 1 Score: 187.193 bits (474), Expect = 3.041e-59
Identity = 103/177 (58.19%), Postives = 144/177 (81.36%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KS+ALFYGNA IVS +PIWLFWRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+L+V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSTALFYGNALIVSAIPIWLFWRIWHMDLVQSAVLYAVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLLLVIVASFFLLKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Zebrafish
Match: ssr3 (signal sequence receptor, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-9134])

HSP 1 Score: 172.555 bits (436), Expect = 8.482e-54
Identity = 79/128 (61.72%), Postives = 106/128 (82.81%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTT 452
            K   EE++LLQDFSR++S KS+ALFYGNA IVS +PIWLFWRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TT
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSTALFYGNALIVSAIPIWLFWRIWHMDLVQSAVLYAVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATT 135          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Xenopus
Match: ssr3 (signal sequence receptor, gamma (translocon-associated protein gamma) [Source:NCBI gene;Acc:448655])

HSP 1 Score: 192.2 bits (487), Expect = 4.926e-61
Identity = 105/177 (59.32%), Postives = 145/177 (81.92%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KSSALFYGNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA++RE+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +A+ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFYGNAFIVSAIPIWLYWRIWHMDLVQSAVLYTVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSREVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFLLKNFNPTVNYILSISAASGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Xenopus
Match: ssr3 (signal sequence receptor, gamma (translocon-associated protein gamma) [Source:NCBI gene;Acc:448655])

HSP 1 Score: 176.022 bits (445), Expect = 8.295e-55
Identity = 81/128 (63.28%), Postives = 107/128 (83.59%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTT 452
            K   EE++LLQDFSR++S KSSALFYGNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA++RE+ +K    D++K++RKEKD+RILWKKNEVAD+E+TT
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFYGNAFIVSAIPIWLYWRIWHMDLVQSAVLYTVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSREVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATT 135          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Mouse
Match: Ssr3 (signal sequence receptor, gamma [Source:MGI Symbol;Acc:MGI:1914687])

HSP 1 Score: 187.193 bits (474), Expect = 3.699e-59
Identity = 102/177 (57.63%), Postives = 145/177 (81.92%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Mouse
Match: Ssr3 (signal sequence receptor, gamma [Source:MGI Symbol;Acc:MGI:1914687])

HSP 1 Score: 172.17 bits (435), Expect = 2.413e-53
Identity = 79/128 (61.72%), Postives = 107/128 (83.59%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTT 452
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TT
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATT 135          
BLAST of Translocon-associated protein, gamma subunit vs. UniProt/SwissProt
Match: sp|Q5RCD7|SSRG_PONAB (Translocon-associated protein subunit gamma OS=Pongo abelii OX=9601 GN=SSR3 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.694e-58
Identity = 102/179 (56.98%), Postives = 146/179 (81.56%), Query Frame = 3
Query:   69 NMKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            + K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    6 SCKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. UniProt/SwissProt
Match: sp|Q9UNL2|SSRG_HUMAN (Translocon-associated protein subunit gamma OS=Homo sapiens OX=9606 GN=SSR3 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.015e-58
Identity = 102/177 (57.63%), Postives = 145/177 (81.92%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. UniProt/SwissProt
Match: sp|Q08013|SSRG_RAT (Translocon-associated protein subunit gamma OS=Rattus norvegicus OX=10116 GN=Ssr3 PE=1 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 2.587e-58
Identity = 102/177 (57.63%), Postives = 145/177 (81.92%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. UniProt/SwissProt
Match: sp|Q9DCF9|SSRG_MOUSE (Translocon-associated protein subunit gamma OS=Mus musculus OX=10090 GN=Ssr3 PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 2.587e-58
Identity = 102/177 (57.63%), Postives = 145/177 (81.92%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. UniProt/SwissProt
Match: sp|Q3SZ87|SSRG_BOVIN (Translocon-associated protein subunit gamma OS=Bos taurus OX=9913 GN=SSR3 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 3.358e-58
Identity = 102/177 (57.63%), Postives = 145/177 (81.92%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KSSALF+GNAFIVS +PIWL+WRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. TrEMBL
Match: A0A3S1BPZ9 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_003525 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.463e-72
Identity = 120/175 (68.57%), Postives = 154/175 (88.00%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            KLS+EEE+LLQDFSR+VSTKSSALFYGNAFIVS +P+WLFWRIH MD+   AV F+IG++IS YLVA+AYKN KFILKHKIA+KREDA+ REM KK  DDK++T+KEKD+R+LWKKNEVAD+E+TTFSI  NN+L++++++++SF +L+N   + NY+LS+GSAA L+ALFST S
Sbjct:    8 KLSREEELLLQDFSRNVSTKSSALFYGNAFIVSAIPMWLFWRIHQMDLYQSAVFFVIGTLISTYLVALAYKNVKFILKHKIALKREDAVAREMMKKLADDKRMTKKEKDERVLWKKNEVADYEATTFSIFYNNALYLVLLIVASFFILKNFNPVFNYSLSVGSAAGLLALFSTSS 182          
BLAST of Translocon-associated protein, gamma subunit vs. TrEMBL
Match: A0A1W4WVP4 (translocon-associated protein subunit gamma OS=Agrilus planipennis OX=224129 GN=LOC108736603 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 9.616e-70
Identity = 121/174 (69.54%), Postives = 146/174 (83.91%), Query Frame = 3
Query:   78 LSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
             +KEEE+LLQDFSR+VSTKSSALFYGNA IVS +PIWLFWRIH MDIMS  V F++ +IIS YL+AMAY+NTKF LKHKIAVKREDA+ RE+ KK  +DKK+++KEKD+RILWKKNEVADFE+TTFSI  NN+LF+ +V+  SF VLR+  L  NY LS+G+ A L+AL STGS
Sbjct:   10 FTKEEELLLQDFSRNVSTKSSALFYGNAIIVSAVPIWLFWRIHMMDIMSSLVLFVVVTIISTYLMAMAYRNTKFNLKHKIAVKREDAVTRELTKKLAEDKKMSKKEKDERILWKKNEVADFEATTFSIFYNNALFLALVIFVSFYVLRSFTLAFNYTLSVGATAGLLALLSTGS 183          
BLAST of Translocon-associated protein, gamma subunit vs. TrEMBL
Match: K1QJW6 (Translocon-associated protein subunit gamma OS=Crassostrea gigas OX=29159 GN=CGI_10026012 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.594e-69
Identity = 114/174 (65.52%), Postives = 146/174 (83.91%), Query Frame = 3
Query:   78 LSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            L+KEEE+LLQDFSR+VSTKSSALFYGNA IVS +PIWLFWRIH MD+    + F +G+++S YLVA AYKN KF+LKHKIA KREDA+ REM KKF DDKK+TRKE+D+RILWKKNEVAD+E+TTFSI  NN+ +++++++ SF VL+N + + NY +S+G AA L+ALFST +
Sbjct:   12 LTKEEELLLQDFSRNVSTKSSALFYGNALIVSAIPIWLFWRIHQMDLYQSGILFAVGTLVSTYLVAFAYKNVKFVLKHKIAQKREDAVTREMTKKFSDDKKMTRKERDERILWKKNEVADYEATTFSIFYNNAFYLVLLILCSFYVLKNFSPMFNYLMSVGLAAGLLALFSTSN 185          
BLAST of Translocon-associated protein, gamma subunit vs. TrEMBL
Match: A0A210PKY7 (Translocon-associated protein subunit gamma OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21335 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 3.798e-69
Identity = 116/174 (66.67%), Postives = 147/174 (84.48%), Query Frame = 3
Query:   78 LSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            L+KEEE+LLQDFSR+VSTKSSALFYGNA IVS +PIWLFWRIH MD+    + F +G+IIS YLVA+AYKN KF+LKHKIA+KREDA++REM KKF DDK++T+KEKD+RILWKKNEVAD+E+TTFSI  NN+ ++++++I+SF VLR+     NY  S+G AA L+ALFST +
Sbjct:   11 LTKEEELLLQDFSRNVSTKSSALFYGNALIVSAVPIWLFWRIHQMDLYQSGILFAVGTIISTYLVALAYKNVKFVLKHKIALKREDAVSREMTKKFADDKRMTKKEKDERILWKKNEVADYEATTFSIFYNNAFYLVLLVIASFYVLRSINPTFNYLCSVGLAAGLLALFSTST 184          
BLAST of Translocon-associated protein, gamma subunit vs. TrEMBL
Match: A0A293N222 (Translocon-associated protein, gamma subunit (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 4.618e-69
Identity = 117/180 (65.00%), Postives = 152/180 (84.44%), Query Frame = 3
Query:   60 MANNMKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            MA   KL+KEEE+LLQDFSR+VSTKSSALFYGNAFIVS +PIWLFWRIH MD+   A+ F + +++S +L+A+AYKN KF+LKHK+A KREDA+NRE+ KK  DDKK+++KEKD+RILWKKNEVAD+E+TTFSI  NN+LF+ +++++SF +LR  +  LNY LS+G A+ L+ALFSTGS
Sbjct:    1 MAVGKKLTKEEELLLQDFSRNVSTKSSALFYGNAFIVSSIPIWLFWRIHQMDLYQSAIIFAVMTLVSTWLIALAYKNVKFVLKHKVAQKREDAVNREIMKKLSDDKKMSKKEKDERILWKKNEVADYEATTFSIFYNNALFLTLIIVTSFYLLRAFSPSLNYLLSVGCASGLLALFSTGS 180          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Cavefish
Match: ssr3 (signal sequence receptor subunit 3 [Source:NCBI gene;Acc:103046287])

HSP 1 Score: 187.193 bits (474), Expect = 2.751e-59
Identity = 102/177 (57.63%), Postives = 144/177 (81.36%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KS+ALFYGNA IVS +PIWLFWRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+++SF +L+N    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSTALFYGNALIVSAIPIWLFWRIWHMDLVQSAVLYAVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFLLKNFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Sea Lamprey
Match: ssr3 (signal sequence receptor, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-9134])

HSP 1 Score: 193.356 bits (490), Expect = 2.163e-62
Identity = 109/173 (63.01%), Postives = 142/173 (82.08%), Query Frame = 3
Query:   81 SKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFST 593
            + EEE+LLQDFSRSVSTKS+ALFYGNAFIVS +PIWL+WRI  MD+   AV F + +I S +LVAMAYKN KFILKHK+  KREDA+ RE+ +K    D+KK+++KEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++++++SF +L+N    +NY LSMGS+A L+AL ST
Sbjct:   11 ASEEELLLQDFSRSVSTKSAALFYGNAFIVSAIPIWLYWRIWQMDLFQSAVLFGVMTIASTWLVAMAYKNMKFILKHKVVQKREDAVAREVLRKLPEADNKKMSKKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLIIVASFFLLKNFNPTVNYILSMGSSAGLIALLST 183          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Nematostella
Match: EDO39583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J2])

HSP 1 Score: 185.652 bits (470), Expect = 4.804e-59
Identity = 106/180 (58.89%), Postives = 136/180 (75.56%), Query Frame = 3
Query:   60 MANNMKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            MAN  KLSKE+E+LLQ+FSRSVSTKSS LFY NA IVS +P+WLFWRIH MD  S  + F + +++S +LVA AYKN KF LKHKIA +R+ AI +E+N++   +KKLTR+EKD+RILWKKN+VAD E+ TFSI  NN+L++ +VL +SF  LR+     NY LS   A  ++AL STGS
Sbjct:    1 MANGKKLSKEDELLLQNFSRSVSTKSSILFYANALIVSAIPLWLFWRIHQMDPYSSGILFAVMTLVSTWLVAFAYKNVKFQLKHKIAQRRDAAITKEVNQELDPNKKLTRQEKDERILWKKNKVADMEAMTFSIFYNNALYLFLVLFASFYALRSLHPSANYLLSTSVAGGILALLSTGS 180          
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Medaka
Match: ssr3 (signal sequence receptor subunit 3 [Source:NCBI gene;Acc:101174039])

HSP 1 Score: 184.882 bits (468), Expect = 2.249e-58
Identity = 102/177 (57.63%), Postives = 144/177 (81.36%), Query Frame = 3
Query:   75 KLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKF--GDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGS 599
            K   EE++LLQDFSR++S KS+ALFYGNA IVS +PIWLFWRI  MD++  AV + + +++S YLVA AYKN KF+LKHK+A KREDA+++E+ +K    D++K++RKEKD+RILWKKNEVAD+E+TTFSI  NN+LF+++V+I+SF +L++    +NY LS+ +++ L+AL STGS
Sbjct:    8 KQQSEEDLLLQDFSRNLSAKSTALFYGNALIVSAIPIWLFWRIWHMDLVQSAVLYAVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIIASFFLLKSFNPTVNYILSISASSGLIALLSTGS 184          
BLAST of Translocon-associated protein, gamma subunit vs. Planmine SMEST
Match: SMESG000066628.1 (SMESG000066628.1)

HSP 1 Score: 322.013 bits (824), Expect = 1.463e-112
Identity = 184/184 (100.00%), Postives = 184/184 (100.00%), Query Frame = 3
Query:   60 MANNMKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGSVNKQ 611
            MANNMKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTFSILLNNSLFILIVLISSFVVLRNQALLLNYALSMGSAAALVALFSTGSVNKQ
Sbjct:    1 MANNMKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTFSILLNNSLFILIVLISSFVVLRNQALLLNYALSMGSAAALVALFSTGSVNKQ 184          
BLAST of Translocon-associated protein, gamma subunit vs. Planmine SMEST
Match: SMESG000066628.1 (SMESG000066628.1)

HSP 1 Score: 313.923 bits (803), Expect = 2.108e-109
Identity = 180/180 (100.00%), Postives = 180/180 (100.00%), Query Frame = 3
Query:   72 MKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTXXXXXXXXXXXXXXXXXXXXXXRNQALLLNYALSMGSAAALVALFSTGSVNKQ 611
            MKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTFSILLNNSLFILIVLISSFVVLRNQALLLNYALSMGSAAALVALFSTGSVNKQ
Sbjct:    1 MKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHDMDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNKKFGDDKKLTRKEKDDRILWKKNEVADFESTTFSILLNNSLFILIVLISSFVVLRNQALLLNYALSMGSAAALVALFSTGSVNKQ 180          
The following BLAST results are available for this feature:
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SSR34.197e-5957.63signal sequence receptor subunit 3 [Source:HGNC Sy... [more]
SSR35.263e-5553.68signal sequence receptor subunit 3 [Source:HGNC Sy... [more]
SSR32.343e-5361.72signal sequence receptor subunit 3 [Source:HGNC Sy... [more]
SSR31.873e-3453.79signal sequence receptor subunit 3 [Source:HGNC Sy... [more]
SSR31.873e-3453.79signal sequence receptor subunit 3 [Source:HGNC Sy... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trap-37.635e-3945.40TRanslocon-Associated Protein [Source:UniProtKB/T... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG58851.734e-6560.34gene:FBgn0025700 transcript:FBtr0445309[more]
CG58851.734e-6560.34gene:FBgn0025700 transcript:FBtr0079900[more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ssr33.041e-5958.19signal sequence receptor, gamma [Source:ZFIN;Acc:Z... [more]
ssr33.041e-5958.19signal sequence receptor, gamma [Source:ZFIN;Acc:Z... [more]
ssr38.482e-5461.72signal sequence receptor, gamma [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ssr34.926e-6159.32signal sequence receptor, gamma (translocon-associ... [more]
ssr38.295e-5563.28signal sequence receptor, gamma (translocon-associ... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ssr33.699e-5957.63signal sequence receptor, gamma [Source:MGI Symbol... [more]
Ssr32.413e-5361.72signal sequence receptor, gamma [Source:MGI Symbol... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RCD7|SSRG_PONAB1.694e-5856.98Translocon-associated protein subunit gamma OS=Pon... [more]
sp|Q9UNL2|SSRG_HUMAN2.015e-5857.63Translocon-associated protein subunit gamma OS=Hom... [more]
sp|Q08013|SSRG_RAT2.587e-5857.63Translocon-associated protein subunit gamma OS=Rat... [more]
sp|Q9DCF9|SSRG_MOUSE2.587e-5857.63Translocon-associated protein subunit gamma OS=Mus... [more]
sp|Q3SZ87|SSRG_BOVIN3.358e-5857.63Translocon-associated protein subunit gamma OS=Bos... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1BPZ91.463e-7268.57Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1W4WVP49.616e-7069.54translocon-associated protein subunit gamma OS=Agr... [more]
K1QJW62.594e-6965.52Translocon-associated protein subunit gamma OS=Cra... [more]
A0A210PKY73.798e-6966.67Translocon-associated protein subunit gamma OS=Miz... [more]
A0A293N2224.618e-6965.00Translocon-associated protein, gamma subunit (Frag... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ssr32.751e-5957.63signal sequence receptor subunit 3 [Source:NCBI ge... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ssr32.163e-6263.01signal sequence receptor, gamma [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO395834.804e-5958.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ssr32.249e-5857.63signal sequence receptor subunit 3 [Source:NCBI ge... [more]
back to top
BLAST of Translocon-associated protein, gamma subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000066628.11.463e-112100.00SMESG000066628.1[more]
SMESG000066628.12.108e-109100.00SMESG000066628.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022331 ID=SMED30022331|Name=Translocon-associated protein, gamma subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=814bp
AAATTGTTTTATTGAATTAAAATTAACTACGTACAAGTAGTTGTATTCGT
ATTCTCTACATGGCAAATAACATGAAACTGTCGAAAGAAGAAGAAATTTT
ACTACAAGATTTTAGTCGCAGCGTTTCTACCAAATCCAGTGCGTTATTTT
ATGGAAATGCATTCATTGTTTCCATTTTGCCAATTTGGTTATTTTGGCGA
ATTCATGATATGGATATCATGTCACATGCTGTTCCGTTCATTATCGGTAG
TATAATAAGCGCATATTTGGTAGCAATGGCTTATAAGAATACAAAATTCA
TTCTTAAGCATAAAATTGCAGTAAAAAGAGAAGATGCTATTAATAGAGAG
ATGAATAAAAAGTTTGGTGATGATAAGAAACTTACAAGAAAAGAAAAGGA
TGATAGAATTTTATGGAAAAAGAACGAAGTTGCGGATTTTGAGTCGACTA
CATTTTCTATTCTGTTGAATAATTCTCTGTTTATTTTAATTGTATTGATT
TCATCATTTGTTGTCCTGCGAAATCAAGCTCTTTTATTAAATTATGCATT
GTCTATGGGCTCAGCCGCTGCTTTAGTGGCCCTCTTTTCTACCGGATCAG
TAAATAAGCAATAAATATGATAATGTCTTCATTGGTTTATGTATTTTATA
TGAATAAAATTGATTTAGTAACATCGAATAAAGAAATATTTCTGTTAGAT
TTTGTCTCACGTGCATGTTTCGCCCAGGGAGACATTTGTATTAGATAATA
ACTATTTTGCAGAATTGTGTAATAATTAATTTTATTTAAGTGAATGATTT
TTGTTTGAAAAAAA
back to top

protein sequence of SMED30022331-orf-1

>SMED30022331-orf-1 ID=SMED30022331-orf-1|Name=SMED30022331-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=185bp
MANNMKLSKEEEILLQDFSRSVSTKSSALFYGNAFIVSILPIWLFWRIHD
MDIMSHAVPFIIGSIISAYLVAMAYKNTKFILKHKIAVKREDAINREMNK
KFGDDKKLTRKEKDDRILWKKNEVADFESTTFSILLNNSLFILIVLISSF
VVLRNQALLLNYALSMGSAAALVALFSTGSVNKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR009779SSR3
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006614SRP-dependent cotranslational protein targeting to membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009779Translocon-associated protein subunit gammaPFAMPF07074TRAP-gammacoord: 10..179
e-value: 3.1E-78
score: 261.2
IPR009779Translocon-associated protein subunit gammaPANTHERPTHR13399TRANSLOCON-ASSOCIATED PROTEIN TRAP , GAMMA SUBUNITcoord: 1..180
NoneNo IPR availableTMHMMTMhelixcoord: 53..75
NoneNo IPR availableTMHMMTMhelixcoord: 27..46
NoneNo IPR availableTMHMMTMhelixcoord: 158..180
NoneNo IPR availableTMHMMTMhelixcoord: 131..153