Cerebral peptide prohormone like-1

Overview
NameCerebral peptide prohormone like-1
Smed IDSMED30022326
Length (bp)379
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cerebral peptide prohormone like-1 (SMED30022326) t-SNE clustered cells

Violin plots show distribution of expression levels for Cerebral peptide prohormone like-1 (SMED30022326) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cerebral peptide prohormone like-1 (SMED30022326) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cerebral peptide prohormone like-1 (SMED30022326) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022326

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022326SMESG000015527.1 SmedASXL_019610SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30022326SMESG000015527.1 dd_Smed_v6_4046_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30022326SMESG000015527.1 OX_Smed_1.0.22672ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30022326SMESG000015527.1 BK007012smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cephalic gangliaSMED30022326SMESG000015527.1 BK007012smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
oviductSMED30022326SMESG000015527.1 BK007012smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
penis papillaSMED30022326SMESG000015527.1 BK007012smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30022326SMESG000015527.1 Contig34900newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022326SMESG000015527.1 Contig34900uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
nervous systemSMED30022326SMESG000015527.1 DAA33901smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30022326SMESG000015527.1 DAA33901smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30022326SMESG000015527.1 DAA33901smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30022326SMESG000015527.1 DAA33901smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cerebral peptide prohormone like-1 vs. UniProt/SwissProt
Match: sp|Q10998|CP1_APLCA (Cerebral peptide 1 OS=Aplysia californica OX=6500 PE=1 SV=2)

HSP 1 Score: 54.299 bits (129), Expect = 1.022e-8
Identity = 25/53 (47.17%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  167 DLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 325
            D+  D  + +K    +  KR PGWGKR+  W K+ PGWGKR   W K+ PGWG
Sbjct:  113 DVDEDGSEQEKRAPGW-GKRAPGWGKRAPGWGKRAPGWGKRAPGWGKRAPGWG 164          

HSP 2 Score: 46.595 bits (109), Expect = 8.304e-6
Identity = 23/56 (41.07%), Postives = 28/56 (50.00%), Query Frame = 2
Query:  206 SFYKSKRVPGWGKRSYQ----------------WIKKTPGWGKRTYQWSKKTPGWG 325
            S  ++KR PGWGKR  +                W K+ PGWGKR   W K+ PGWG
Sbjct:   95 SSLEAKRAPGWGKRGQEIDVDEDGSEQEKRAPGWGKRAPGWGKRAPGWGKRAPGWG 150          
BLAST of Cerebral peptide prohormone like-1 vs. TrEMBL
Match: E3CTI7 (Cerebral peptide prohormone like-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 4.514e-64
Identity = 96/97 (98.97%), Postives = 97/97 (100.00%), Query Frame = 2
Query:   35 MNFTNKPWTCGTLILILSITFCVGLEGEDDTFVTFQEILRNGKPDLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 325
            MNFTN+PWTCGTLILILSITFCVGLEGEDDTFVTFQEILRNGKPDLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG
Sbjct:    1 MNFTNRPWTCGTLILILSITFCVGLEGEDDTFVTFQEILRNGKPDLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 97          
BLAST of Cerebral peptide prohormone like-1 vs. TrEMBL
Match: V4A3S4 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_57638 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.762e-7
Identity = 28/66 (42.42%), Postives = 37/66 (56.06%), Query Frame = 2
Query:  140 QEILRNGKPDLLSDNQ----DNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 325
            + IL + + D L   +      + + SF   KR PGWGKR+  W K+ PGWGKR   W K+ PGWG
Sbjct:    9 RNILSSSEKDFLESKRAPGWGKRSLKSFAADKRAPGWGKRAPGWGKRAPGWGKRAPGWGKRAPGWG 74          
BLAST of Cerebral peptide prohormone like-1 vs. TrEMBL
Match: A0A267E7H9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025384g1 PE=4 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.339e-6
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  167 DLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 325
            D + D+ D     + Y  KR PGWGKR+  W K+ PGWGKR   W K+ PGWG
Sbjct:   52 DAVEDDSD-----AAYWDKRAPGWGKRAPGWGKRAPGWGKRAPGWGKRAPGWG 99          
BLAST of Cerebral peptide prohormone like-1 vs. TrEMBL
Match: A0A1X9WED0 (Apgwamide OS=Deroceras reticulatum OX=145610 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.601e-6
Identity = 30/72 (41.67%), Postives = 38/72 (52.78%), Query Frame = 2
Query:  122 DTFVTFQEILRNGKP----DLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 325
            D F +F +I   G+     + LSD+        +   KR PGWGKR   W K+ PGWGKR   W K+ PGWG
Sbjct:   80 DDFQSFNDISNTGESYRPMEFLSDDSLLTDNTDYDWGKRAPGWGKRVPGWGKRAPGWGKRAPGWGKRAPGWG 151          
BLAST of Cerebral peptide prohormone like-1 vs. TrEMBL
Match: A0A267H3B3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025308g1 PE=4 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.760e-6
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  167 DLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 325
            D + D+ D     + Y  KR PGWGKR+  W K+ PGWGKR   W K+ PGWG
Sbjct:   52 DAVEDDSD-----AAYWDKRAPGWGKRAPGWGKRAPGWGKRAPGWGKRAPGWG 99          
BLAST of Cerebral peptide prohormone like-1 vs. Planmine SMEST
Match: SMESG000015527.1 (SMESG000015527.1)

HSP 1 Score: 199.134 bits (505), Expect = 1.255e-67
Identity = 96/97 (98.97%), Postives = 97/97 (100.00%), Query Frame = 2
Query:   35 MNFTNKPWTCGTLILILSITFCVGLEGEDDTFVTFQEILRNGKPDLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 325
            MNFTN+PWTCGTLILILSITFCVGLEGEDDTFVTFQEILRNGKPDLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG
Sbjct:    1 MNFTNRPWTCGTLILILSITFCVGLEGEDDTFVTFQEILRNGKPDLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQWSKKTPGWG 97          
The following BLAST results are available for this feature:
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q10998|CP1_APLCA1.022e-847.17Cerebral peptide 1 OS=Aplysia californica OX=6500 ... [more]
back to top
BLAST of Cerebral peptide prohormone like-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3CTI74.514e-6498.97Cerebral peptide prohormone like-1 OS=Schmidtea me... [more]
V4A3S41.762e-742.42Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A267E7H91.339e-649.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1X9WED02.601e-641.67Apgwamide OS=Deroceras reticulatum OX=145610 PE=2 ... [more]
A0A267H3B32.760e-649.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cerebral peptide prohormone like-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000015527.11.255e-6798.97SMESG000015527.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022326 ID=SMED30022326|Name=Cerebral peptide prohormone like-1|organism=Schmidtea mediterranea sexual|type=transcript|length=379bp
AACGCAGAGTACATGGGGAAACAAATATTTTTCTATGAATTTTACGAATA
AACCCTGGACTTGTGGGACATTAATATTGATTCTTAGTATTACATTTTGT
GTCGGTTTAGAAGGTGAAGATGACACATTTGTAACCTTTCAAGAAATATT
GAGGAATGGTAAGCCCGATCTACTTAGCGATAACCAAGATAATCAAAAAG
TCATTTCGTTTTACAAATCGAAACGCGTTCCAGGATGGGGAAAACGATCA
TATCAATGGATTAAGAAAACGCCTGGATGGGGCAAAAGAACATATCAATG
GAGTAAGAAAACACCCGGATGGGGATAAAAACTAATAAGTAATCTAAAAC
TGTTTTCAAAAATAAAAATTTGAATTTGA
back to top

protein sequence of SMED30022326-orf-1

>SMED30022326-orf-1 ID=SMED30022326-orf-1|Name=SMED30022326-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
TQSTWGNKYFSMNFTNKPWTCGTLILILSITFCVGLEGEDDTFVTFQEIL
RNGKPDLLSDNQDNQKVISFYKSKRVPGWGKRSYQWIKKTPGWGKRTYQW
SKKTPGWG*
back to top
Aliases
The feature 'Cerebral peptide prohormone like-1' has the following synonyms
Synonym
cpp-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000205oviduct
PLANA:0000206penis papilla
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..27
score: 0.769