YLP motif containing 1

Overview
NameYLP motif containing 1
Smed IDSMED30022324
Length (bp)1831
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of YLP motif containing 1 (SMED30022324) t-SNE clustered cells

Violin plots show distribution of expression levels for YLP motif containing 1 (SMED30022324) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of YLP motif containing 1 (SMED30022324) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for YLP motif containing 1 (SMED30022324) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022324

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022324SMESG000072973.1 SmedASXL_012385SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022324SMESG000072973.1 SmedASXL_012385SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of YLP motif containing 1 vs. Ensembl Human
Match: YLPM1 (YLP motif containing 1 [Source:HGNC Symbol;Acc:HGNC:17798])

HSP 1 Score: 171.785 bits (434), Expect = 2.467e-44
Identity = 125/358 (34.92%), Postives = 183/358 (51.12%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDIIN----RSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            L A +L  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMAD WE  P    +LD  S LQD+ IE+VEMED  D        + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D  +R      K V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1089 LPAPSLSHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMEDF-DANIEEQKEEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYDTRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAEKALNRTKYI 1440          
BLAST of YLP motif containing 1 vs. Ensembl Human
Match: YLPM1 (YLP motif containing 1 [Source:HGNC Symbol;Acc:HGNC:17798])

HSP 1 Score: 171.785 bits (434), Expect = 3.744e-44
Identity = 125/358 (34.92%), Postives = 183/358 (51.12%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDIIN----RSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            L A +L  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMAD WE  P    +LD  S LQD+ IE+VEMED  D        + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D  +R      K V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1795 LPAPSLSHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMEDF-DANIEEQKEEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYDTRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAEKALNRTKYI 2146          
BLAST of YLP motif containing 1 vs. Ensembl Human
Match: YLPM1 (YLP motif containing 1 [Source:HGNC Symbol;Acc:HGNC:17798])

HSP 1 Score: 137.502 bits (345), Expect = 3.039e-34
Identity = 82/221 (37.10%), Postives = 116/221 (52.49%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDIIN----RSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMED 1365
            L A +L  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMAD WE  P    +LD  S LQD+ IE+VEMED
Sbjct:  204 LPAPSLSHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMED 424          
BLAST of YLP motif containing 1 vs. Ensembl Human
Match: YLPM1 (YLP motif containing 1 [Source:HGNC Symbol;Acc:HGNC:17798])

HSP 1 Score: 138.272 bits (347), Expect = 2.531e-33
Identity = 82/222 (36.94%), Postives = 116/222 (52.25%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDII----NRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDI 1368
            L A +L  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMAD WE  P    +LD  S LQD+ IE+VEMED 
Sbjct: 1348 LPAPSLSHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMEDF 1569          
BLAST of YLP motif containing 1 vs. Ensembl Fly
Match: ZAP3 (gene:FBgn0052685 transcript:FBtr0071489)

HSP 1 Score: 136.346 bits (342), Expect = 5.725e-33
Identity = 104/336 (30.95%), Postives = 163/336 (48.51%), Query Frame = 1
Query:  874 RHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENKF------------------EYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISD---------EQPVVVLXXXXXXXXXITET------------GFFKSKWDEDF-EDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYFSK 1761
            R  IILRG PG GKS   +  KEKE+    + PRILS+D +F+ EN +                  EY+  +E  Y   L K FK+ + +  +  ++VDC N  +    +FY +AK + F   I+++      C  R+  + S   +  + D+W +TP+ + KLD +S L++     VEMED+ D         +    V   +  E+ ++ ET            GF KSKW+ D  ED   RLDG K     ++    S+ +YL++E       + + K R   V+WAD EE + QK+ + +GFV G TDW ++M  D +    AL + K+  +
Sbjct: 1556 RICIILRGPPGCGKSHVARLIKEKELEMGGANPRILSIDDYFLIENDYDEKCPKTGKKIPKKEILYEYDDTMEETYMQYLIKSFKKTLSDNLYDFVIVDCNNNSLRTLNEFYCHAKDSNFVPYIVDLHCDLETCLGRNSHQRSVNDIRVVLDNWCQTPTHYIKLDVSSLLENV----VEMEDVEDMATDDNACADVGATVGESAALEDAAVEETDDSNSADASNYCGFLKSKWERDTTEDNLARLDGTKRLMQNRR--TTSMADYLQLEDWKPPTTSDNGKKR---VRWADIEEKRSQKKMRAIGFVVGQTDWNRMM--DPNAGSRALNKTKFIER 1880          
BLAST of YLP motif containing 1 vs. Ensembl Fly
Match: ZAP3 (gene:FBgn0052685 transcript:FBtr0308583)

HSP 1 Score: 136.346 bits (342), Expect = 5.778e-33
Identity = 104/336 (30.95%), Postives = 163/336 (48.51%), Query Frame = 1
Query:  874 RHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENKF------------------EYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISD---------EQPVVVLXXXXXXXXXITET------------GFFKSKWDEDF-EDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYFSK 1761
            R  IILRG PG GKS   +  KEKE+    + PRILS+D +F+ EN +                  EY+  +E  Y   L K FK+ + +  +  ++VDC N  +    +FY +AK + F   I+++      C  R+  + S   +  + D+W +TP+ + KLD +S L++     VEMED+ D         +    V   +  E+ ++ ET            GF KSKW+ D  ED   RLDG K     ++    S+ +YL++E       + + K R   V+WAD EE + QK+ + +GFV G TDW ++M  D +    AL + K+  +
Sbjct: 1557 RICIILRGPPGCGKSHVARLIKEKELEMGGANPRILSIDDYFLIENDYDEKCPKTGKKIPKKEILYEYDDTMEETYMQYLIKSFKKTLSDNLYDFVIVDCNNNSLRTLNEFYCHAKDSNFVPYIVDLHCDLETCLGRNSHQRSVNDIRVVLDNWCQTPTHYIKLDVSSLLENV----VEMEDVEDMATDDNACADVGATVGESAALEDAAVEETDDSNSADASNYCGFLKSKWERDTTEDNLARLDGTKRLMQNRR--TTSMADYLQLEDWKPPTTSDNGKKR---VRWADIEEKRSQKKMRAIGFVVGQTDWNRMM--DPNAGSRALNKTKFIER 1881          
BLAST of YLP motif containing 1 vs. Ensembl Zebrafish
Match: ylpm1 (YLP motif containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2196])

HSP 1 Score: 179.104 bits (453), Expect = 7.360e-47
Identity = 115/321 (35.83%), Postives = 177/321 (55.14%), Query Frame = 1
Query:  862 SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENK------------------FEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDI--SDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLS-IKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            S   R V+I+RGLPGSGKS   +  ++KE+    + PR+L LD +F+ E +                  +EYEP++E  YR  + K FK+ +D+GFF  I++D IN+KV+ F QF+  AK   F+V + E+      CAKR+    +   + K++  WE  P    +LD  S LQD+ IEDVEMED   SDE    V +D +      T+ G+  KSKW+ D  + K ++LDG+      ++   LS ++++L++  +   +++   K R   V+WAD EE K   R++ +GFV G TDW K+      +A+ AL + KYF
Sbjct: 1112 SRPDRIVVIMRGLPGSGKSHVAKLIRDKEVECGGAPPRVLGLDDYFMTEVEKIEKDPDSGKRIKTKVLEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDAINDKVKYFDQFWSAAKTKGFEVYLAEITTDQQTCAKRNIHGRTLKDISKLSGGWESAPPHMVRLDIRSLLQDAAIEDVEMEDFNPSDEPKAEVKNDDDE-----TDLGYVPKSKWEMDTSEAKLDKLDGLVGGGKRKRDAGLSGMEDFLQLPDDYATRMSEPGKKR---VRWADLEEQKDVDRKRAIGFVVGQTDWEKITDESGQIAQRALNRTKYF 1424          
BLAST of YLP motif containing 1 vs. Ensembl Zebrafish
Match: ylpm1 (YLP motif containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2196])

HSP 1 Score: 178.718 bits (452), Expect = 8.750e-47
Identity = 115/321 (35.83%), Postives = 177/321 (55.14%), Query Frame = 1
Query:  862 SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENK------------------FEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDI--SDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLS-IKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            S   R V+I+RGLPGSGKS   +  ++KE+    + PR+L LD +F+ E +                  +EYEP++E  YR  + K FK+ +D+GFF  I++D IN+KV+ F QF+  AK   F+V + E+      CAKR+    +   + K++  WE  P    +LD  S LQD+ IEDVEMED   SDE    V +D +      T+ G+  KSKW+ D  + K ++LDG+      ++   LS ++++L++  +   +++   K R   V+WAD EE K   R++ +GFV G TDW K+      +A+ AL + KYF
Sbjct: 1538 SRPDRIVVIMRGLPGSGKSHVAKLIRDKEVECGGAPPRVLGLDDYFMTEVEKIEKDPDSGKRIKTKVLEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDAINDKVKYFDQFWSAAKTKGFEVYLAEITTDQQTCAKRNIHGRTLKDISKLSGGWESAPPHMVRLDIRSLLQDAAIEDVEMEDFNPSDEPKAEVKNDDDE-----TDLGYVPKSKWEMDTSEAKLDKLDGLVGGGKRKRDAGLSGMEDFLQLPDDYATRMSEPGKKR---VRWADLEEQKDVDRKRAIGFVVGQTDWEKITDESGQIAQRALNRTKYF 1850          
BLAST of YLP motif containing 1 vs. Ensembl Xenopus
Match: YLPM1 (YLP motif containing 1 [Source:NCBI gene;Acc:100493668])

HSP 1 Score: 159.844 bits (403), Expect = 2.052e-40
Identity = 109/331 (32.93%), Postives = 168/331 (50.76%), Query Frame = 1
Query:  841 INDIINR----SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLS--IKEYLKIEMENLNKLNVDEKSRGK-HVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            ++D++ +    S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  + K FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+     ICAKR+       ++ K+AD WE  P    +LD  S LQD+ IE+V          +V +                KSKW+ D  + K ++LDG+K +   +    +   +++YL++     +  +  E   GK  V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct:  747 VDDLLKKPGRDSRPDRIVVIMRGLPGSGKTHVAKLIRDKEVECGGPAPRVLSLDDYFITEVEKVEKDPDSGKKVKKKVMEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDSINDRVRHFEQFWSAAKTKGFEVYLAEMSADTQICAKRNVHGRKLKEISKIADHWESAPRHMIRLDVRSLLQDAAIEEVSY--------IVYIP---------------KSKWEMDTSEAKLDKLDGLKGSKRRRDWESVGSRLEDYLQLP----DDYDTRESEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDKSGHLAERALNRTKYI 1050          
BLAST of YLP motif containing 1 vs. Ensembl Xenopus
Match: YLPM1 (YLP motif containing 1 [Source:NCBI gene;Acc:100493668])

HSP 1 Score: 159.458 bits (402), Expect = 2.637e-40
Identity = 109/331 (32.93%), Postives = 168/331 (50.76%), Query Frame = 1
Query:  841 INDIINR----SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLS--IKEYLKIEMENLNKLNVDEKSRGK-HVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            ++D++ +    S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  + K FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+     ICAKR+       ++ K+AD WE  P    +LD  S LQD+ IE+V          +V +                KSKW+ D  + K ++LDG+K +   +    +   +++YL++     +  +  E   GK  V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1087 VDDLLKKPGRDSRPDRIVVIMRGLPGSGKTHVAKLIRDKEVECGGPAPRVLSLDDYFITEVEKVEKDPDSGKKVKKKVMEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDSINDRVRHFEQFWSAAKTKGFEVYLAEMSADTQICAKRNVHGRKLKEISKIADHWESAPRHMIRLDVRSLLQDAAIEEVSY--------IVYIP---------------KSKWEMDTSEAKLDKLDGLKGSKRRRDWESVGSRLEDYLQLP----DDYDTRESEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDKSGHLAERALNRTKYI 1390          
BLAST of YLP motif containing 1 vs. Ensembl Xenopus
Match: YLPM1 (YLP motif containing 1 [Source:NCBI gene;Acc:100493668])

HSP 1 Score: 159.073 bits (401), Expect = 4.668e-40
Identity = 109/329 (33.13%), Postives = 166/329 (50.46%), Query Frame = 1
Query:  841 INDIINR----SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGK-HVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            ++D++ +    S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  + K FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+     ICAKR+       ++ K+AD WE  P    +LD  S LQD+ IE+V          +V +                KSKW+ D  + K ++LDG+K +   +     S+   L+  ++  +  +  E   GK  V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1179 VDDLLKKPGRDSRPDRIVVIMRGLPGSGKTHVAKLIRDKEVECGGPAPRVLSLDDYFITEVEKVEKDPDSGKKVKKKVMEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDSINDRVRHFEQFWSAAKTKGFEVYLAEMSADTQICAKRNVHGRKLKEISKIADHWESAPRHMIRLDVRSLLQDAAIEEVSY--------IVYIP---------------KSKWEMDTSEAKLDKLDGLKGSKRRRD--WESVGSRLEDYLQLPDDYDTRESEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDKSGHLAERALNRTKYI 1482          
BLAST of YLP motif containing 1 vs. Ensembl Xenopus
Match: YLPM1 (YLP motif containing 1 [Source:NCBI gene;Acc:100493668])

HSP 1 Score: 158.303 bits (399), Expect = 4.680e-40
Identity = 109/329 (33.13%), Postives = 166/329 (50.46%), Query Frame = 1
Query:  841 INDIINR----SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGK-HVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            ++D++ +    S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  + K FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+     ICAKR+       ++ K+AD WE  P    +LD  S LQD+ IE+V          +V +                KSKW+ D  + K ++LDG+K +   +     S+   L+  ++  +  +  E   GK  V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct:  664 VDDLLKKPGRDSRPDRIVVIMRGLPGSGKTHVAKLIRDKEVECGGPAPRVLSLDDYFITEVEKVEKDPDSGKKVKKKVMEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDSINDRVRHFEQFWSAAKTKGFEVYLAEMSADTQICAKRNVHGRKLKEISKIADHWESAPRHMIRLDVRSLLQDAAIEEVSY--------IVYIP---------------KSKWEMDTSEAKLDKLDGLKGSKRRRD--WESVGSRLEDYLQLPDDYDTRESEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDKSGHLAERALNRTKYI 967          
BLAST of YLP motif containing 1 vs. Ensembl Xenopus
Match: YLPM1 (YLP motif containing 1 [Source:NCBI gene;Acc:100493668])

HSP 1 Score: 158.688 bits (400), Expect = 4.946e-40
Identity = 109/329 (33.13%), Postives = 166/329 (50.46%), Query Frame = 1
Query:  841 INDIINR----SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGK-HVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            ++D++ +    S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  + K FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+     ICAKR+       ++ K+AD WE  P    +LD  S LQD+ IE+V          +V +                KSKW+ D  + K ++LDG+K +   +     S+   L+  ++  +  +  E   GK  V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1161 VDDLLKKPGRDSRPDRIVVIMRGLPGSGKTHVAKLIRDKEVECGGPAPRVLSLDDYFITEVEKVEKDPDSGKKVKKKVMEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDSINDRVRHFEQFWSAAKTKGFEVYLAEMSADTQICAKRNVHGRKLKEISKIADHWESAPRHMIRLDVRSLLQDAAIEEVSY--------IVYIP---------------KSKWEMDTSEAKLDKLDGLKGSKRRRD--WESVGSRLEDYLQLPDDYDTRESEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDKSGHLAERALNRTKYI 1464          
BLAST of YLP motif containing 1 vs. Ensembl Mouse
Match: Ylpm1 (YLP motif containing 1 [Source:MGI Symbol;Acc:MGI:1926195])

HSP 1 Score: 177.178 bits (448), Expect = 3.061e-46
Identity = 126/362 (34.81%), Postives = 189/362 (52.21%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDIIN----RSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE------------------NKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMED----ISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            L A AL  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E                   ++EYE D+E  YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMA+ WE  P    +LD  S LQD+ IE+VEMED    I D++      + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D ++R      K V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1035 LPAPALGHQPPPVPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFIAEVEKEEKDPDSGKKVKKKVMEYEYEADMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMAEHWEVAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEDQK-----EEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYETRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAERALNRTKYI 1386          
BLAST of YLP motif containing 1 vs. Ensembl Mouse
Match: Ylpm1 (YLP motif containing 1 [Source:MGI Symbol;Acc:MGI:1926195])

HSP 1 Score: 177.178 bits (448), Expect = 3.175e-46
Identity = 126/362 (34.81%), Postives = 189/362 (52.21%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDIIN----RSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE------------------NKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMED----ISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            L A AL  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E                   ++EYE D+E  YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMA+ WE  P    +LD  S LQD+ IE+VEMED    I D++      + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D ++R      K V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1082 LPAPALGHQPPPVPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFIAEVEKEEKDPDSGKKVKKKVMEYEYEADMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMAEHWEVAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEDQK-----EEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYETRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAERALNRTKYI 1433          
BLAST of YLP motif containing 1 vs. Ensembl Mouse
Match: Ylpm1 (YLP motif containing 1 [Source:MGI Symbol;Acc:MGI:1926195])

HSP 1 Score: 177.178 bits (448), Expect = 3.842e-46
Identity = 126/362 (34.81%), Postives = 189/362 (52.21%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDII----NRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE------------------NKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMED----ISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            L A AL  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E                   ++EYE D+E  YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMA+ WE  P    +LD  S LQD+ IE+VEMED    I D++      + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D ++R      K V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1788 LPAPALGHQPPPVPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFIAEVEKEEKDPDSGKKVKKKVMEYEYEADMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMAEHWEVAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEDQK-----EEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYETRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAERALNRTKYI 2139          
BLAST of YLP motif containing 1 vs. Ensembl Mouse
Match: Ylpm1 (YLP motif containing 1 [Source:MGI Symbol;Acc:MGI:1926195])

HSP 1 Score: 144.436 bits (363), Expect = 1.797e-35
Identity = 82/221 (37.10%), Postives = 118/221 (53.39%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDII----NRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE------------------NKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMED 1365
            L A AL  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E                   ++EYE D+E  YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMA+ WE  P    +LD  S LQD+ IE+VEMED
Sbjct: 1330 LPAPALGHQPPPVPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFIAEVEKEEKDPDSGKKVKKKVMEYEYEADMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMAEHWEVAPRHMMRLDIRSLLQDAAIEEVEMED 1550          
BLAST of YLP motif containing 1 vs. UniProt/SwissProt
Match: sp|P0CB49|YLPM1_RAT (YLP motif-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ylpm1 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.132e-45
Identity = 125/362 (34.53%), Postives = 189/362 (52.21%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDIIN----RSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE------------------NKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMED----ISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            L A +L  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E                   ++EYE D+E  YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMA+ WE  P    +LD  S LQD+ IE+VEMED    I D++      + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D ++R      K V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1025 LPAPSLGHQPPPVPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFIAEVEKEEKDPDSGKKVKKKVMEYEYEADMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMAEHWEAAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEDQK-----EEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYETRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAERALNRTKYI 1376          
BLAST of YLP motif containing 1 vs. UniProt/SwissProt
Match: sp|Q9R0I7|YLPM1_MOUSE (YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 2.141e-45
Identity = 126/362 (34.81%), Postives = 189/362 (52.21%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDIIN----RSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE------------------NKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMED----ISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            L A AL  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E                   ++EYE D+E  YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMA+ WE  P    +LD  S LQD+ IE+VEMED    I D++      + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D ++R      K V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1035 LPAPALGHQPPPVPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFIAEVEKEEKDPDSGKKVKKKVMEYEYEADMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMAEHWEVAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEDQK-----EEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYETRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAERALNRTKYI 1386          
BLAST of YLP motif containing 1 vs. UniProt/SwissProt
Match: sp|P49750|YLPM1_HUMAN (YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4)

HSP 1 Score: 171.785 bits (434), Expect = 1.798e-43
Identity = 125/358 (34.92%), Postives = 183/358 (51.12%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRI------IYINDIIN----RSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPDLEPK-----------------YRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            L A +L  QP    R+        ++DI+      S   R V+I+RGLPGSGK+   +  ++KE+     APR+LSLD +F+ E  K E +PD   K                 YR  +FK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMAD WE  P    +LD  S LQD+ IE+VEMED  D        + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D  +R      K V+WAD EE K   R++ +GFV G TDW K+      +AE AL + KY 
Sbjct: 1795 LPAPSLSHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLDDYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMEDF-DANIEEQKEEKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYDTRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAEKALNRTKYI 2146          
BLAST of YLP motif containing 1 vs. TrEMBL
Match: R7V2V1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_173930 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.339e-47
Identity = 117/309 (37.86%), Postives = 178/309 (57.61%), Query Frame = 1
Query:  889 LRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE------------------NKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDF--EDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            +RGLPGSGK+   +  K KE+ N  + PR+LS+D +F+ E                   ++E++P +E  Y   LFK +KRQ+DE +FS I+VD I ++     +F+ Y K   FQV + EV   P +CAKR+    S  ++ K+A+ W+ TP+ +  LD  S LQD+ IEDVEMED S+E+   +  D E EEE     G  KSKW+ D   +D+  +LDGV+  + +   P  ++++YL++  +N N    D     K V+WAD EE K Q + +E+GFV G+T+W K++  D D A+ AL + K+ 
Sbjct:    1 MRGLPGSGKTYASKLLKNKEVKNGGAVPRMLSIDDYFMVEVEKSDKDPETGKRLKRTVMEYEFDPAMEESYLRSLFKSYKRQVDERYFSFIIVDAIFDRRRALEEFWSYGKSKGFQVYVAEVSAEPKVCAKRNVHGRSLREIEKIANSWDVTPANYISLDIRSLLQDAAIEDVEMEDGSEEKGGEMKEDEEEEEEEEAVEGHVKSKWELDTHSQDSLAKLDGVRKRNRKDSGP-QAMEDYLQLP-DNYNDREDDPGK--KRVRWADLEERKSQVKMREMGFVIGHTNWDKMV--DDDYADKALNRTKFI 303          
BLAST of YLP motif containing 1 vs. TrEMBL
Match: A0A4Z2IXZ5 (YLP motif-containing protein 1 OS=Liparis tanakae OX=230148 GN=Ylpm1 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.853e-47
Identity = 116/332 (34.94%), Postives = 188/332 (56.63%), Query Frame = 1
Query:  832 IIYINDII----NRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE---------------NK---FEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            I  I+DI+      S   R VII+RGLPGSGKS   +  ++KE+    + PR+L LD +F+ E               NK   +E+EP++E  YR+ + K FK+ +D+GFF  I++D IN++V+ F QF+  AK   F+V + E+      C+KR+    +   + KM+++WE +P    +LD  S LQD+ IE+VEMED +   P     + + EEE   + G+  KSKW+ D  + K ++LDG+  +   +++ V  + +YL++  +   +++   K R   V+WAD EE K+  R++ +GFV G TDW ++      +A+ AL + KYF
Sbjct:  102 IKNIDDILKLPGRSSRPERIVIIMRGLPGSGKSHVAKLIRDKEVDCGGAPPRVLVLDDYFMTEAEKVQKDPDTGRRVKNKILEYEFEPEMEDTYRNSMLKTFKKTLDDGFFPFIILDTINDRVKHFDQFWSAAKTKGFEVYLAEITGDTQTCSKRNVHGRTLKDILKMSNNWESSPRHMVRLDVRSLLQDAAIEEVEMEDFN---PDDEPKELKREEEEEGDLGYIPKSKWEMDTSEAKLDKLDGLGSSGKRKREDVEHLDDYLQLPDDYATRMSEPGKKR---VRWADLEEQKEADRKRAIGFVVGQTDWERITDESGQLAQRALNRTKYF 427          
BLAST of YLP motif containing 1 vs. TrEMBL
Match: A0A2D4JV19 (Uncharacterized protein (Fragment) OS=Micrurus paraensis OX=1970185 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 7.218e-47
Identity = 126/358 (35.20%), Postives = 185/358 (51.68%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRIIY------INDIINR----SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENK------------------FEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            +SA  +  QP    R+        ++DI+ +    S   R VII+RGLPGSGK+   +  ++KE+    +APR+LSLD +F+ E +                  +EYE D+E  YR  LFK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMAD WE  P    +LD  S LQD+ IE+VEMED           + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D  SR      K V+WAD EE K   R++ +GFV G TDW K+       AE AL + KY 
Sbjct:  155 ISAPTIPRQPPPAPRVERKPESKNVDDILKQPGRESRPERIVIIMRGLPGSGKTHVAKLIRDKEVECGGAAPRVLSLDDYFITEIEKEERDPDTKKRVKKKILEYEYEADMEEVYRASLFKTFKKTLDDGFFPFIILDAINDRVRHFEQFWSAAKTKGFEVYLAEITADNQTCCKRNVHGRKLKEINKMADHWETAPRHMIRLDIRSLLQDAAIEEVEMEDFDANIEDQKDENKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYDSRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHFAEKALNRTKYI 507          
BLAST of YLP motif containing 1 vs. TrEMBL
Match: A0A2H6N3Z7 (Uncharacterized protein (Fragment) OS=Micrurus lemniscatus carvalhoi OX=129465 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.252e-46
Identity = 126/358 (35.20%), Postives = 185/358 (51.68%), Query Frame = 1
Query:  787 LSALALKPQPIDTSRIIY------INDIINR----SVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENK------------------FEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRG-----KHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            +SA  +  QP    R+        ++DI+ +    S   R VII+RGLPGSGK+   +  ++KE+    +APR+LSLD +F+ E +                  +EYE D+E  YR  LFK FK+ +D+GFF  I++D IN++V  F QF+  AK   F+V + E+      C KR+       ++ KMAD WE  P    +LD  S LQD+ IE+VEMED           + +  EE  +E G+  KSKW+ D  + K ++LDG++  +  ++       E +   ME+  +L  D  SR      K V+WAD EE K   R++ +GFV G TDW K+       AE AL + KY 
Sbjct:  175 ISAPTIPRQPPPAPRVERKPESKNVDDILKQPGRESRPERIVIIMRGLPGSGKTHVAKLIRDKEVECGGAAPRVLSLDDYFITEIEKEERDPDTKKRVKKKILEYEYEADMEEVYRASLFKTFKKTLDDGFFPFIILDAINDRVRHFEQFWSAAKTKGFEVYLAEITADNQTCCKRNVHGRKLKEINKMADHWETAPRHMIRLDIRSLLQDAAIEEVEMEDFDANIEDQKDENKKDAEEEESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRD-----WEAIASRMEDYLQLPDDYDSRASEPGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHFAEKALNRTKYI 527          
BLAST of YLP motif containing 1 vs. TrEMBL
Match: K7INX3 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 8.906e-46
Identity = 115/318 (36.16%), Postives = 187/318 (58.81%), Query Frame = 1
Query:  880 VIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFV------------EENKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXX-------------XXXXXXXITETGFFKSKWDE-DFEDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
             IILRG PGSGKS   +  K+KE+A   SAPRILS+D +F+            +E +++YE  +EP+Y + L K FK+ + +GFF+ I++D INEK+  + + + +AK   F+V + E+++   IC KR+  + S  ++ ++ D +E +PS   KLD TS LQ+  IEDVEMED+  E P   + +             S+  +E   +TG   SKW++ + ED  +RLDG+K     + Q   +++++L++     +  NV++ S  KHV+WAD EE K+Q++ + +GFV G+T+W ++M  D     +AL + KY 
Sbjct:   56 AIILRGPPGSGKSFVAKLIKDKEVAQGGSAPRILSIDDYFLVEKDSAPGDDKADEMEYKYEEAMEPEYFNHLVKAFKKNVTDGFFNFIILDSINEKISDYEEMWSFAKTKGFKVYVCEMEMDVQICLKRNIHKRSEDEINRIVDYFEPSPSHHHKLDVTSLLQEQAIEDVEMEDVQ-EAPKEDVKEKEKEKEGEPANDDSQDSQEDTEKTGV--SKWEKMEAEDKLDRLDGLKRKHENKPQ---TMEDFLQVP----DYYNVEDGSGKKHVRWADLEERKQQEKMRAVGFVVGHTNWNRMM--DPTYGGSALTRTKYI 361          
BLAST of YLP motif containing 1 vs. Ensembl Cavefish
Match: ylpm1 (YLP motif containing 1 [Source:NCBI gene;Acc:103040347])

HSP 1 Score: 168.318 bits (425), Expect = 2.191e-43
Identity = 108/314 (34.39%), Postives = 174/314 (55.41%), Query Frame = 1
Query:  874 RHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENK------------------FEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLS-IKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            R VII+RGLPGSGKS   +  ++KE+    + PR+L LD +F+ E +                  +EYEP++E  YR  + K FK+ +D+GFF  I++D IN++V+ F QF+  AK   F+V + E+     +C+KR+        + K+A+ WE  P    +LD  S LQD+ IE+VEMED +  +      + + +EE        KSKW+ D  + K ++LDG+      ++   +S I+++L++  +  ++++   K R   V+WAD EE K   R++ +GFV G TDW K+      +A+ AL + KYF
Sbjct: 1507 RVVIIMRGLPGSGKSHLAKLIRDKEVEYGGAPPRVLGLDDYFMTEVEKEERDPDTGKRVKTKVLEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDAINDRVKYFDQFWSAAKTKGFEVYVAEISADHQVCSKRNIHGRKLKDITKLANGWESAPVHMIRLDIRSLLQDAAIEEVEMEDFNPSELEAQAGEKKEDEEEFDMGYLPKSKWEMDTSEAKLDKLDGLAGGGKRKRDTDVSGIEDFLQLPDDYASRMSEPGKKR---VRWADLEEQKDADRKRAIGFVVGQTDWEKITDETGQLAQRALNRTKYF 1817          
BLAST of YLP motif containing 1 vs. Ensembl Cavefish
Match: ylpm1 (YLP motif containing 1 [Source:NCBI gene;Acc:103040347])

HSP 1 Score: 163.696 bits (413), Expect = 6.882e-42
Identity = 113/337 (33.53%), Postives = 177/337 (52.52%), Query Frame = 1
Query:  874 RHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENK------------------FEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISD---EQPVVVLXXXXXXXXXITETGFF--------------------KSKWDEDFEDTK-ERLDGVKLTSHEQQQPVLS-IKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            R VII+RGLPGSGKS   +  ++KE+    + PR+L LD +F+ E +                  +EYEP++E  YR  + K FK+ +D+GFF  I++D IN++V+ F QF+  AK   F+V + E+     +C+KR+        + K+A+ WE  P    +LD  S LQD+ IE+VEMED +    E       + E E + IT T F                     KSKW+ D  + K ++LDG+      ++   +S I+++L++  +  ++++   K R   V+WAD EE K   R++ +GFV G TDW K+      +A+ AL + KYF
Sbjct: 1507 RVVIIMRGLPGSGKSHLAKLIRDKEVEYGGAPPRVLGLDDYFMTEVEKEERDPDTGKRVKTKVLEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDAINDRVKYFDQFWSAAKTKGFEVYVAEISADHQVCSKRNIHGRKLKDITKLANGWESAPVHMIRLDIRSLLQDAAIEEVEMEDFNPSELEAQAGEKKEDEEEFDMITMTRFLGGGEVTGDLKPTFTQQGYLPKSKWEMDTSEAKLDKLDGLAGGGKRKRDTDVSGIEDFLQLPDDYASRMSEPGKKR---VRWADLEEQKDADRKRAIGFVVGQTDWEKITDETGQLAQRALNRTKYF 1840          
BLAST of YLP motif containing 1 vs. Ensembl Medaka
Match: ylpm1 (YLP motif containing 1 [Source:NCBI gene;Acc:101169007])

HSP 1 Score: 164.851 bits (416), Expect = 3.049e-42
Identity = 112/317 (35.33%), Postives = 179/317 (56.47%), Query Frame = 1
Query:  874 RHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPD-----------------LEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDIS-DEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQP--VLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            R VII+RGLPGSGKS   +  ++KE+ +  + PR+L LD +F+ E  + E +PD                 +E  YR  + K FK+ +D+GFF  I++D IN+KV+ F QF+  AK   F+V + E+      CAKR+    +   + KM+ +WE +P    +LD  S LQD+ IE+VEMED + DE+ +    + + EEE  ++ G+  KSKW+ D  + K ++LDG+      +++   V  + ++L++  +   +++   K R   V+WAD EE K   R++ +GFV G TDW K+      +A+ AL + KYF
Sbjct: 1612 RIVIIMRGLPGSGKSHVAKLIRDKEVESGGAPPRVLVLDDYFMTEVERIEKDPDSGKKVKTKVMEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDTINDKVKHFDQFWSAAKTKGFEVYVAEITADTQTCAKRNLHGRTHKDITKMSGNWEPSPRHMVRLDVRSLLQDAAIEEVEMEDFNPDEESM----EPKREEEEESDLGYIPKSKWEMDTSEAKLDKLDGLVSGGKRKREGDHVSGLVDFLQLPDDYATRMSEPGKKR---VRWADLEEQKDADRKRAIGFVVGQTDWEKITDESGQLAQRALNRTKYF 1921          
BLAST of YLP motif containing 1 vs. Ensembl Medaka
Match: ylpm1 (YLP motif containing 1 [Source:NCBI gene;Acc:101169007])

HSP 1 Score: 164.851 bits (416), Expect = 3.155e-42
Identity = 112/317 (35.33%), Postives = 179/317 (56.47%), Query Frame = 1
Query:  874 RHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEE-NKFEYEPD-----------------LEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDIS-DEQPVVVLXXXXXXXXXITETGFF-KSKWDEDFEDTK-ERLDGVKLTSHEQQQP--VLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYF 1755
            R VII+RGLPGSGKS   +  ++KE+ +  + PR+L LD +F+ E  + E +PD                 +E  YR  + K FK+ +D+GFF  I++D IN+KV+ F QF+  AK   F+V + E+      CAKR+    +   + KM+ +WE +P    +LD  S LQD+ IE+VEMED + DE+ +    + + EEE  ++ G+  KSKW+ D  + K ++LDG+      +++   V  + ++L++  +   +++   K R   V+WAD EE K   R++ +GFV G TDW K+      +A+ AL + KYF
Sbjct: 1599 RIVIIMRGLPGSGKSHVAKLIRDKEVESGGAPPRVLVLDDYFMTEVERIEKDPDSGKKVKTKVMEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDTINDKVKHFDQFWSAAKTKGFEVYVAEITADTQTCAKRNLHGRTHKDITKMSGNWEPSPRHMVRLDVRSLLQDAAIEEVEMEDFNPDEESM----EPKREEEEESDLGYIPKSKWEMDTSEAKLDKLDGLVSGGKRKREGDHVSGLVDFLQLPDDYATRMSEPGKKR---VRWADLEEQKDADRKRAIGFVVGQTDWEKITDESGQLAQRALNRTKYF 1908          
BLAST of YLP motif containing 1 vs. Planmine SMEST
Match: SMESG000072973.1 (SMESG000072973.1)

HSP 1 Score: 1009.21 bits (2608), Expect = 0.000e+0
Identity = 559/562 (99.47%), Postives = 560/562 (99.64%), Query Frame = 1
Query:   85 MYQMSNGSRYSYFSIDESCNSKPIIKKDESENSSKFNTXXXXXXXXXXXLDHLHSSCINDYQRYNMSYNNMSAVXXXXXXXXXXXXXXXXKELNERKRYLIDQMSEQPTRDTREDHSPYKFENNYFYNHSKTCDSIDKNYLSIDSNISKHNSSNFLSWSLDVYQYTISRTLDKKKYVSPGSLLRETRDSYGHYNYTYFNDQDPEQVEIFEYXXXXXXXXXXXXXXISSSSQQHNLSALALKPQPIDTSRIIYINDIINRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDFEDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYFSKDGE 1770
            MYQMSNGSRYSYFSIDESCNSKPIIKKDESENSSKFNTEIKDIEKKEKDLDHLHSSCINDYQRYNMSYNNMSAVNQNSIIDQISSIN QQKELNERKRYLIDQMSEQPTRDTREDHSPYKFENNYFYNHSKTCDSIDKNYLSIDSNISKHNSSNFLSWSLDVYQYTISRTLDKKKYVSPGSLLRETRDSYG YNYTYFNDQDPEQVEIFEYAVPAAAAATKPVPVISSSSQQHNLSA+ALKPQPIDTSRIIYINDIINRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLSDSESEEESITETGFFKSKWDEDFEDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFEELKKQKRRKELGFVAGNTDWTKLMSSDIDVAEAALVQVKYFSKDGE
Sbjct:    1 MYQMSNGSRYSYFSIDESCNSKPIIKKDESENSSKFNTEIKDIEKKEKDLDHLHSSCINDYQRYNMSYNNMSAVNQNSIIDQISSINCQQKELNERKRYLIDQMSEQPTRDTREDHSPYKFENNYFYNHSKTCDSIDKNYLSIDSNISKHNSSNFLSWSLDVYQYTISRTLDKKKYVSPGSLLRETRDSYGRYNYTYFNDQDPEQVEIFEYAVPAAAAATKPVPVISSSSQQHNLSAVALKPQPIDTSRIIYINDIINRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLSDSESEEESITETGFFKSKWDEDFEDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFEELKKQKRRKELGFVAGNTDWTKLMSSDIDVAEAALVQVKYFSKDGE 562          
BLAST of YLP motif containing 1 vs. Planmine SMEST
Match: SMESG000072973.1 (SMESG000072973.1)

HSP 1 Score: 1003.05 bits (2592), Expect = 0.000e+0
Identity = 556/559 (99.46%), Postives = 557/559 (99.64%), Query Frame = 1
Query:   94 MSNGSRYSYFSIDESCNSKPIIKKDESENSSKFNTXXXXXXXXXXXLDHLHSSCINDYQRYNMSYNNMSAVXXXXXXXXXXXXXXXXKELNERKRYLIDQMSEQPTRDTREDHSPYKFENNYFYNHSKTCDSIDKNYLSIDSNISKHNSSNFLSWSLDVYQYTISRTLDKKKYVSPGSLLRETRDSYGHYNYTYFNDQDPEQVEIFEYXXXXXXXXXXXXXXISSSSQQHNLSALALKPQPIDTSRIIYINDIINRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLXXXXXXXXXITETGFFKSKWDEDFEDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFXXXXXXXXXXXXGFVAGNTDWTKLMSSDIDVAEAALVQVKYFSKDGE 1770
            MSNGSRYSYFSIDESCNSKPIIKKDESENSSKFNTEIKDIEKKEKDLDHLHSSCINDYQRYNMSYNNMSAVNQNSIIDQISSIN QQKELNERKRYLIDQMSEQPTRDTREDHSPYKFENNYFYNHSKTCDSIDKNYLSIDSNISKHNSSNFLSWSLDVYQYTISRTLDKKKYVSPGSLLRETRDSYG YNYTYFNDQDPEQVEIFEYAVPAAAAATKPVPVISSSSQQHNLSA+ALKPQPIDTSRIIYINDIINRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLSDSESEEESITETGFFKSKWDEDFEDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFEELKKQKRRKELGFVAGNTDWTKLMSSDIDVAEAALVQVKYFSKDGE
Sbjct:    1 MSNGSRYSYFSIDESCNSKPIIKKDESENSSKFNTEIKDIEKKEKDLDHLHSSCINDYQRYNMSYNNMSAVNQNSIIDQISSINCQQKELNERKRYLIDQMSEQPTRDTREDHSPYKFENNYFYNHSKTCDSIDKNYLSIDSNISKHNSSNFLSWSLDVYQYTISRTLDKKKYVSPGSLLRETRDSYGRYNYTYFNDQDPEQVEIFEYAVPAAAAATKPVPVISSSSQQHNLSAVALKPQPIDTSRIIYINDIINRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILSLDHFFVEENKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKVEQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWEETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLSDSESEEESITETGFFKSKWDEDFEDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLNVDEKSRGKHVKWADFEELKKQKRRKELGFVAGNTDWTKLMSSDIDVAEAALVQVKYFSKDGE 559          
The following BLAST results are available for this feature:
BLAST of YLP motif containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
YLPM12.467e-4434.92YLP motif containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
YLPM13.744e-4434.92YLP motif containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
YLPM13.039e-3437.10YLP motif containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
YLPM12.531e-3336.94YLP motif containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of YLP motif containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YLP motif containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZAP35.725e-3330.95gene:FBgn0052685 transcript:FBtr0071489[more]
ZAP35.778e-3330.95gene:FBgn0052685 transcript:FBtr0308583[more]
back to top
BLAST of YLP motif containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ylpm17.360e-4735.83YLP motif containing 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ylpm18.750e-4735.83YLP motif containing 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of YLP motif containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YLPM12.052e-4032.93YLP motif containing 1 [Source:NCBI gene;Acc:10049... [more]
YLPM12.637e-4032.93YLP motif containing 1 [Source:NCBI gene;Acc:10049... [more]
YLPM14.668e-4033.13YLP motif containing 1 [Source:NCBI gene;Acc:10049... [more]
YLPM14.680e-4033.13YLP motif containing 1 [Source:NCBI gene;Acc:10049... [more]
YLPM14.946e-4033.13YLP motif containing 1 [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of YLP motif containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ylpm13.061e-4634.81YLP motif containing 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ylpm13.175e-4634.81YLP motif containing 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ylpm13.842e-4634.81YLP motif containing 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ylpm11.797e-3537.10YLP motif containing 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of YLP motif containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P0CB49|YLPM1_RAT2.132e-4534.53YLP motif-containing protein 1 OS=Rattus norvegicu... [more]
sp|Q9R0I7|YLPM1_MOUSE2.141e-4534.81YLP motif-containing protein 1 OS=Mus musculus OX=... [more]
sp|P49750|YLPM1_HUMAN1.798e-4334.92YLP motif-containing protein 1 OS=Homo sapiens OX=... [more]
back to top
BLAST of YLP motif containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V2V11.339e-4737.86Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A4Z2IXZ51.853e-4734.94YLP motif-containing protein 1 OS=Liparis tanakae ... [more]
A0A2D4JV197.218e-4735.20Uncharacterized protein (Fragment) OS=Micrurus par... [more]
A0A2H6N3Z71.252e-4635.20Uncharacterized protein (Fragment) OS=Micrurus lem... [more]
K7INX38.906e-4636.16Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
back to top
BLAST of YLP motif containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ylpm12.191e-4334.39YLP motif containing 1 [Source:NCBI gene;Acc:10304... [more]
ylpm16.882e-4233.53YLP motif containing 1 [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of YLP motif containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YLP motif containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YLP motif containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YLP motif containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ylpm13.049e-4235.33YLP motif containing 1 [Source:NCBI gene;Acc:10116... [more]
ylpm13.155e-4235.33YLP motif containing 1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of YLP motif containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072973.10.000e+099.47SMESG000072973.1[more]
SMESG000072973.10.000e+099.46SMESG000072973.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022324 ID=SMED30022324|Name=YLP motif containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1831bp
CTTCCGATCTTAAAATTTATTAAATATTAAATTAATCAAAATTTTTCTTT
CACTTCGCCAATTTTATTCATTGAATCTACTAAAATGTATCAAATGTCAA
ATGGATCTCGGTATTCCTATTTTTCTATAGATGAAAGCTGTAATTCCAAA
CCTATTATTAAAAAGGATGAGTCTGAAAATTCATCTAAATTTAATACTGA
AATTAAAGATATTGAAAAGAAAGAGAAAGATTTAGATCATCTTCATTCTT
CTTGTATAAATGATTATCAGAGATATAATATGTCTTATAATAACATGAGT
GCTGTAAACCAGAATTCTATTATAGATCAAATATCTTCAATAAATTCTCA
ACAAAAAGAATTAAATGAACGAAAACGATATCTAATTGATCAGATGAGTG
AGCAACCAACAAGGGATACTAGAGAAGACCATTCACCATATAAGTTTGAA
AATAATTACTTTTACAATCACTCAAAAACCTGTGATAGCATTGACAAAAA
TTATTTGTCGATTGATTCAAATATATCTAAGCATAATTCCTCAAATTTTC
TTTCCTGGTCTTTGGACGTATACCAATATACAATCTCTCGTACATTAGAC
AAGAAAAAATACGTGTCACCGGGATCTCTGCTCCGTGAAACCCGTGATTC
ATACGGCCATTACAATTACACCTATTTCAATGATCAAGACCCGGAACAAG
TTGAGATATTCGAATATGCAGTTCCAGCAGCGGCCGCCGCTACCAAACCG
GTTCCTGTCATCAGCAGTTCCTCTCAGCAACACAATTTGTCGGCTCTCGC
ATTGAAACCGCAACCGATTGACACCAGCCGGATAATTTATATCAACGACA
TCATCAATCGATCCGTCGACAGCAGACACGTCATCATATTGAGAGGCCTC
CCTGGATCTGGCAAGAGCACATTTTGTCAGGCATTCAAGGAAAAAGAAAT
TGCTAACAACCGAAGCGCGCCTCGCATTTTATCTCTTGATCACTTCTTTG
TCGAGGAGAACAAATTCGAATATGAACCCGATCTGGAACCGAAATATCGC
CACGAATTATTTAAGCTATTTAAACGGCAAATCGATGAAGGATTTTTCAG
TGTGATCCTAGTGGACTGCATCAATGAGAAAGTTGAGCAGTTTGCCCAGT
TCTATCAGTATGCTAAAATGAATCGGTTCCAGGTATCGATTATGGAGGTG
AAGGTGTCACCGATAATCTGTGCCAAACGCTCGGAGGACAGATTCTCACC
GGCACAAGTTTACAAGATGGCGGATGACTGGGAAGAAACTCCAAGCGCCT
TCGACAAGCTTGATGCGACATCATTTCTCCAGGATTCAACTATCGAAGAT
GTGGAGATGGAAGATATTTCTGACGAGCAGCCAGTTGTCGTGTTATCTGA
TTCTGAGTCCGAAGAAGAATCGATTACTGAAACTGGATTTTTCAAAAGCA
AATGGGATGAAGATTTCGAGGATACAAAAGAACGTTTGGACGGTGTGAAA
TTGACAAGCCATGAACAACAGCAGCCCGTGTTAAGCATCAAGGAATATCT
GAAAATTGAAATGGAAAATCTAAATAAACTGAATGTCGATGAGAAATCCA
GAGGGAAACATGTTAAATGGGCAGATTTCGAGGAGTTGAAAAAGCAAAAG
CGGAGAAAAGAATTAGGTTTTGTTGCTGGTAACACAGACTGGACCAAGCT
TATGTCAAGTGATATCGATGTGGCCGAGGCAGCTTTAGTGCAAGTGAAGT
ACTTCTCTAAGGATGGTGAATAAGTACATGGCAACAATCTAGATTTGCTG
GGAAATATATCTTACATACACACATGCATAC
back to top

protein sequence of SMED30022324-orf-1

>SMED30022324-orf-1 ID=SMED30022324-orf-1|Name=SMED30022324-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MYQMSNGSRYSYFSIDESCNSKPIIKKDESENSSKFNTEIKDIEKKEKDL
DHLHSSCINDYQRYNMSYNNMSAVNQNSIIDQISSINSQQKELNERKRYL
IDQMSEQPTRDTREDHSPYKFENNYFYNHSKTCDSIDKNYLSIDSNISKH
NSSNFLSWSLDVYQYTISRTLDKKKYVSPGSLLRETRDSYGHYNYTYFND
QDPEQVEIFEYAVPAAAAATKPVPVISSSSQQHNLSALALKPQPIDTSRI
IYINDIINRSVDSRHVIILRGLPGSGKSTFCQAFKEKEIANNRSAPRILS
LDHFFVEENKFEYEPDLEPKYRHELFKLFKRQIDEGFFSVILVDCINEKV
EQFAQFYQYAKMNRFQVSIMEVKVSPIICAKRSEDRFSPAQVYKMADDWE
ETPSAFDKLDATSFLQDSTIEDVEMEDISDEQPVVVLSDSESEEESITET
GFFKSKWDEDFEDTKERLDGVKLTSHEQQQPVLSIKEYLKIEMENLNKLN
VDEKSRGKHVKWADFEELKKQKRRKELGFVAGNTDWTKLMSSDIDVAEAA
LVQVKYFSKDGE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR026314YLP_motif_con_p1
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016607nuclear speck
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 265..447
e-value: 4.3E-24
score: 87.2
NoneNo IPR availablePFAMPF13671AAA_33coord: 266..389
e-value: 8.6E-7
score: 29.2
IPR026314YLP motif-containing protein 1PANTHERPTHR13413YLP MOTIF CONTAINING PROTEIN NUCLEAR PROTEIN ZAPcoord: 98..557
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 264..398