Ferritin

Overview
NameFerritin
Smed IDSMED30022321
Length (bp)682
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Ferritin vs. Ensembl Human
Match: FTMT (ferritin mitochondrial [Source:HGNC Symbol;Acc:HGNC:17345])

HSP 1 Score: 59.6918 bits (143), Expect = 3.747e-10
Identity = 42/142 (29.58%), Postives = 69/142 (48.59%), Query Frame = 2
Query:   29 PEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNL 454
            P+ E  +++ +N  L     Y  +      DDV L  F R F    + E    E+L+R Q  RG +I   D+K  E+ D    ++  +  L LEK +++   +L +LA +K D  L  +L T  +  QVK I++  + + NL
Sbjct:   74 PDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNL 215          
BLAST of Ferritin vs. Ensembl Human
Match: FTL (ferritin light chain [Source:HGNC Symbol;Acc:HGNC:3999])

HSP 1 Score: 56.225 bits (134), Expect = 2.482e-9
Identity = 39/143 (27.27%), Postives = 67/143 (46.85%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            +VE  V+ LVN  L     Y  L      DDV L      F  + + +    E L++ Q  RG +  + D+K   + +  K  +  +  + LEK++++    L +L   ++D  L  +L T  +  +VK+I+K  + L NL R
Sbjct:   12 DVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHR 154          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 53.9138 bits (128), Expect = 1.079e-8
Identity = 34/114 (29.82%), Postives = 58/114 (50.88%), Query Frame = 2
Query:  119 DDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            DDV L  F + F      E    E+L++ Q  RG +I   D+K  +  D    +N  +  L LEK +++   +L  LA +K+D  L  ++ T  +  QVK I++  + + NL++
Sbjct:   15 DDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRK 128          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 54.299 bits (129), Expect = 1.339e-8
Identity = 41/145 (28.28%), Postives = 70/145 (48.28%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCM--SDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  +++ +N  L L   Y  L M      DDV L  F + F      E    E+L++ Q  RG +I   D+K  +  D    +N  +  L LEK +++   +L  LA +K+D  L  ++ T  +  QVK I++  + + NL++
Sbjct:   16 DSEAAINRQIN--LELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRK 158          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 54.299 bits (129), Expect = 1.339e-8
Identity = 41/145 (28.28%), Postives = 70/145 (48.28%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCM--SDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  +++ +N  L L   Y  L M      DDV L  F + F      E    E+L++ Q  RG +I   D+K  +  D    +N  +  L LEK +++   +L  LA +K+D  L  ++ T  +  QVK I++  + + NL++
Sbjct:   16 DSEAAINRQIN--LELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRK 158          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 63.1586 bits (152), Expect = 2.252e-12
Identity = 46/153 (30.07%), Postives = 69/153 (45.10%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            MSL R     EVE  V+K +N  L     Y  +      DDV LP   + F+     E     EL+R Q  RG ++   D++  E  +    +  F+  L LEK  ++   KL S A   +D  L  ++  + +  QVK I + +  + NLKR
Sbjct:    1 MSLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVVLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKR 153          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 63.1586 bits (152), Expect = 2.252e-12
Identity = 46/153 (30.07%), Postives = 69/153 (45.10%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            MSL R     EVE  V+K +N  L     Y  +      DDV LP   + F+     E     EL+R Q  RG ++   D++  E  +    +  F+  L LEK  ++   KL S A   +D  L  ++  + +  QVK I + +  + NLKR
Sbjct:    1 MSLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVVLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKR 153          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 60.8474 bits (146), Expect = 2.056e-11
Identity = 41/154 (26.62%), Postives = 72/154 (46.75%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRS 463
            MSL R     EVE  V+K +N  L     Y  +      DD+ L    + F+     E     EL+R Q  RG ++   +++  EK +    +  F+  L LE+  +    KL  +A +++D  L +Y++ + +  QV  I + +  + N+KR+
Sbjct:    1 MSLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRA 154          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 60.8474 bits (146), Expect = 2.056e-11
Identity = 41/154 (26.62%), Postives = 72/154 (46.75%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRS 463
            MSL R     EVE  V+K +N  L     Y  +      DD+ L    + F+     E     EL+R Q  RG ++   +++  EK +    +  F+  L LE+  +    KL  +A +++D  L +Y++ + +  QV  I + +  + N+KR+
Sbjct:    1 MSLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRA 154          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl27 (ferritin, heavy polypeptide-like 27 [Source:ZFIN;Acc:ZDB-GENE-040718-72])

HSP 1 Score: 63.5438 bits (153), Expect = 3.295e-12
Identity = 42/139 (30.22%), Postives = 67/139 (48.20%), Query Frame = 2
Query:   56 LVNSMLNL--CQGYRQLEMKCM--SDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            L+N M+NL    GY    M      DDV LP F + F+   + E    E+ + FQ  RG +I   D+K  E+ +    +   Q  L LEK +++    L  +A +K D  L  +L +  +  QV+ I+K  + + NL +
Sbjct:   16 LINKMINLELYAGYTYTSMAFYFDRDDVALPGFAKFFKKNSEEEREHAEKFMEFQNKRGGRIVLQDIKKPERDEWDNGLTAMQCALQLEKNVNQALLDLHKVASQKGDPHLCDFLESHYLNEQVEAIKKLGDHITNLSK 154          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 55.0694 bits (131), Expect = 3.644e-9
Identity = 39/141 (27.66%), Postives = 65/141 (46.10%), Query Frame = 2
Query:   38 EMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            E  V++ +N  L     Y  +      DD  L  F + F      E    E+L++FQ  RG +I   D+K  EK +    V   +  L LEK ++    +L  LA + +D  +  ++ T  +  QVK I++  + + NL+R
Sbjct:   14 EAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRR 154          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 55.0694 bits (131), Expect = 3.644e-9
Identity = 39/141 (27.66%), Postives = 65/141 (46.10%), Query Frame = 2
Query:   38 EMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            E  V++ +N  L     Y  +      DD  L  F + F      E    E+L++FQ  RG +I   D+K  EK +    V   +  L LEK ++    +L  LA + +D  +  ++ T  +  QVK I++  + + NL+R
Sbjct:   14 EAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRR 154          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: zgc:56095 (zgc:56095 [Source:ZFIN;Acc:ZDB-GENE-040426-1948])

HSP 1 Score: 48.9062 bits (115), Expect = 6.421e-7
Identity = 36/141 (25.53%), Postives = 61/141 (43.26%), Query Frame = 2
Query:   38 EMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            E  ++KL+N  L     Y  L M    DDV LP F + F      E    E+L+ +Q  RG +I    +    + D    ++     L  +K I++   ++  +A E SD  L+ +L  +      + I+   + L +L R
Sbjct:   13 EANINKLINLKLTASYVYLSLGMYFDRDDVALPNFSKFFLERSHKERDHAEDLLEYQNTRGGRILLQTVAKPSRDDWKGGIDALAFSLEHQKSINRSLLEVHRVAGEHSDPHLSDFLEGKFFTDSHETIKTLGDYLGSLSR 153          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: zgc:56095 (zgc:56095 [Source:ZFIN;Acc:ZDB-GENE-040426-1948])

HSP 1 Score: 48.9062 bits (115), Expect = 6.421e-7
Identity = 36/141 (25.53%), Postives = 61/141 (43.26%), Query Frame = 2
Query:   38 EMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            E  ++KL+N  L     Y  L M    DDV LP F + F      E    E+L+ +Q  RG +I    +    + D    ++     L  +K I++   ++  +A E SD  L+ +L  +      + I+   + L +L R
Sbjct:   13 EANINKLINLKLTASYVYLSLGMYFDRDDVALPNFSKFFLERSHKERDHAEDLLEYQNTRGGRILLQTVAKPSRDDWKGGIDALAFSLEHQKSINRSLLEVHRVAGEHSDPHLSDFLEGKFFTDSHETIKTLGDYLGSLSR 153          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC75752 (uncharacterized protein MGC75752 [Source:NCBI gene;Acc:394820])

HSP 1 Score: 61.2326 bits (147), Expect = 3.975e-11
Identity = 42/160 (26.25%), Postives = 75/160 (46.88%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR---SEDDKIPFLTARLT 502
            E E  ++++ N  L     Y  L      DDV L  F + +  + + +    E+L++FQ  RG ++   D+K  +  +        +  L LEK +++    L  +A + +D  +  YL    +  +VK+I+K  + L NLKR   +ED    +L  +LT
Sbjct:   14 ESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDHAEDLLKFQNKRGGRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIATDHADPHMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDKLT 173          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 55.0694 bits (131), Expect = 4.890e-9
Identity = 43/145 (29.66%), Postives = 72/145 (49.66%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCM--SDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  V+++VN  L +   Y  L M      DDV L      F+   + E    E+L++ Q  RG +I   D+K  E+ +    ++  QT L LEK +++    L +LA E+ D  +  +L +  +  QVK ++K  + + NLKR
Sbjct:   12 DCEAAVNRMVN--LEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVLQDIKKPERDEWGSTLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKR 154          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 55.0694 bits (131), Expect = 5.245e-9
Identity = 43/145 (29.66%), Postives = 72/145 (49.66%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCM--SDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  V+++VN  L +   Y  L M      DDV L      F+   + E    E+L++ Q  RG +I   D+K  E+ +    ++  QT L LEK +++    L +LA E+ D  +  +L +  +  QVK ++K  + + NLKR
Sbjct:   12 DCEAAVNRMVN--LEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVLQDIKKPERDEWGSTLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKR 154          
BLAST of Ferritin vs. Ensembl Xenopus
Match: fth1.1 (ferritin, heavy polypeptide 1, gene 1 [Source:NCBI gene;Acc:394604])

HSP 1 Score: 54.6842 bits (130), Expect = 8.000e-9
Identity = 37/143 (25.87%), Postives = 67/143 (46.85%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  ++++VN  L     Y  +      DDV L    + F+     E    E+ +++Q  RG +    D+K  E+ +    +   Q  L LEK +++    L  LA +K+D  L  +L +  +  QVK +++  + + NLKR
Sbjct:   12 DCEAAINRMVNMELYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEEREHAEKFLKYQNKRGGRAVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLASDKTDPHLCDFLESEYLEEQVKAMKELGDYITNLKR 154          
BLAST of Ferritin vs. Ensembl Xenopus
Match: nop53 (NOP53 ribosome biogenesis factor [Source:Xenbase;Acc:XB-GENE-853827])

HSP 1 Score: 49.2914 bits (116), Expect = 7.492e-7
Identity = 36/143 (25.17%), Postives = 67/143 (46.85%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            E E  +++ VN  L     Y  +      DDV L  F + F      E    E+L++ Q  RG +I   D+K  ++ +    +   +  L LEK +++   +L  L+ + +D  L  +L +  +  QVK +++  + + NL+R
Sbjct:   12 ECEAAINRQVNMELYASYVYLSMAYYFDRDDVALKNFSKYFLHQSHEEREHAEKLMKMQNQRGGRIFLQDVKKPDRDEWANGLEALECSLQLEKSVNQSLLELHKLSTDHNDPHLCDFLESHYLDEQVKSMKELGDHITNLRR 154          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1 (ferritin light polypeptide 1 [Source:MGI Symbol;Acc:MGI:95589])

HSP 1 Score: 62.003 bits (149), Expect = 1.598e-11
Identity = 41/143 (28.67%), Postives = 69/143 (48.25%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            EVE  V++LVN  L     Y  L      DDV L   G  F  + + +    E L+ FQ  RG +  + D++   + +  K     +  L +EK +++    L +L   ++D  L  +L +  + ++VK+I+K  N L NL+R
Sbjct:   12 EVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRR 154          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1-ps1 (ferritin light polypeptide 1, pseudogene 1 [Source:MGI Symbol;Acc:MGI:3779109])

HSP 1 Score: 62.003 bits (149), Expect = 1.598e-11
Identity = 41/143 (28.67%), Postives = 69/143 (48.25%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            EVE  V++LVN  L     Y  L      DDV L   G  F  + + +    E L+ FQ  RG +  + D++   + +  K     +  L +EK +++    L +L   ++D  L  +L +  + ++VK+I+K  N L NL+R
Sbjct:   12 EVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRR 154          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 60.4622 bits (145), Expect = 4.812e-11
Identity = 42/145 (28.97%), Postives = 72/145 (49.66%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCM--SDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  +++ +N  L L   Y  L M C    DDV L  F + F      E    E+L++ Q  RG +I   D+K  ++ D    +N  +  L LEK +++   +L  LA +K+D  L  ++ T  +  QVK I++  + + NL++
Sbjct:   16 DAEAAINRQIN--LELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRK 158          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 60.4622 bits (145), Expect = 4.812e-11
Identity = 42/145 (28.97%), Postives = 72/145 (49.66%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCM--SDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  +++ +N  L L   Y  L M C    DDV L  F + F      E    E+L++ Q  RG +I   D+K  ++ D    +N  +  L LEK +++   +L  LA +K+D  L  ++ T  +  QVK I++  + + NL++
Sbjct:   16 DAEAAINRQIN--LELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRK 158          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftmt (ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:1914884])

HSP 1 Score: 56.9954 bits (136), Expect = 1.848e-9
Identity = 44/143 (30.77%), Postives = 70/143 (48.95%), Query Frame = 2
Query:   29 PEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHR-RVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNL 454
            P+ E  +++ +N  L     Y  +      DDV L  F + F L + LE R   E+L++ Q  RG +I   D+K  +K D    +   +  L LEK +++    L +LA EK D  L  +L T  +  QVK I++  + + NL
Sbjct:   70 PDSEAAINRQINLELYASYVYLSMAYYFSRDDVALYNFSKYF-LRQSLEEREHAEKLMKLQNQRGGRICLQDIKKPDKDDWECGLRAMECALLLEKNVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNL 211          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85835|FRIM_TRENE (Ferritin, middle subunit OS=Trematomus newnesi OX=35730 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.940e-11
Identity = 39/143 (27.27%), Postives = 70/143 (48.95%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  V++++N  L     Y  +      DDV LP F   F+   + E    ++L+ FQ  RG +I   D+K  E+ +    ++  Q+ L LEK +++    L  +A + +D  +  +L T  +  QV+ I+K  + + NL R
Sbjct:   12 DCEAAVNRMINMELFASYSYTSMAFYFSRDDVALPGFAHFFKENSEEEREHADKLLTFQNSRGGRIFLQDIKKPERDEWGSGLDALQSSLQLEKNVNQALLDLHKIASDHTDPHMCDFLETHYLNEQVESIKKLGDFITNLSR 154          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85839|FRIMS_PSEBE (Ferritin, spleen middle subunit OS=Pseudotrematomus bernacchii OX=40690 PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.475e-11
Identity = 41/143 (28.67%), Postives = 68/143 (47.55%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  V++++N  L     Y  +      DDV LP F   F+     E    ++L+ FQ  RG +I   D+K  E+ +    V++ Q  L LEK +++    L  +A  K D  +  +L T  +  QV+ I+K  + + NL R
Sbjct:   12 DCEAAVNRMINMELFASYSYTSMAFYFSRDDVALPGFAHFFKENSDEEREHADKLLTFQNSRGGRIFLQDIKKPERDEWGNGVDVMQCALQLEKNVNQALLDLHKIASGKVDPHMCDFLETHYLNEQVESIKKLGDFITNLSR 154          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85836|FRIML_PSEBE (Ferritin, liver middle subunit OS=Pseudotrematomus bernacchii OX=40690 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.568e-11
Identity = 39/143 (27.27%), Postives = 69/143 (48.25%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  V++++N  L     Y  +      DDV LP F   F+     E    ++L+ FQ  RG +I   D+K  E+ +    ++  Q+ L LEK +++    L  +A + +D  +  +L T  +  QV+ I+K  + + NL R
Sbjct:   12 DCEAAVNRMINMELFASYSYTSMAFYFSRDDVALPGFAHFFKENSDEEREHADKLLTFQNSRGGRIFLQDIKKPERDEWGSGLDALQSSLQLEKNVNQALLDLHKIASDHTDPHMCDFLETHYLNEQVESIKKLGDFITNLSR 154          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P42577|FRIS_LYMST (Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 8.241e-11
Identity = 39/144 (27.08%), Postives = 69/144 (47.92%), Query Frame = 2
Query:   29 PEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
             E E  +++ +N  L     Y+ +      DDV LP F + F+   + E    E+L+++Q  RG +I   D+K  ++ +    +   Q  L LEK +++    L  L     D  +  +L +  +  QVK I++ S+ + NLKR
Sbjct:   12 AESEAGINRQINMELYASYSYQSMAYYFDRDDVALPGFHKFFKHQSEEEREHAEKLMKYQNKRGGRIVLQDIKKPDRDEWGTGLEAMQVALQLEKSVNQSLLDLHKLCTSHDDAQMADFLESEFLEEQVKSIKELSDYITNLKR 155          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P29391|FRIL1_MOUSE (Ferritin light chain 1 OS=Mus musculus OX=10090 GN=Ftl1 PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 1.327e-10
Identity = 41/143 (28.67%), Postives = 69/143 (48.25%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            EVE  V++LVN  L     Y  L      DDV L   G  F  + + +    E L+ FQ  RG +  + D++   + +  K     +  L +EK +++    L +L   ++D  L  +L +  + ++VK+I+K  N L NL+R
Sbjct:   12 EVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARTDPHLCDFLESHYLDKEVKLIKKMGNHLTNLRR 154          
BLAST of Ferritin vs. TrEMBL
Match: A0A1S6KMG6 (Ferritin OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.413e-61
Identity = 105/187 (56.15%), Postives = 143/187 (76.47%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKLERELQMERTRRE 562
            MSL R+++  E+E++VS LVN  L+LCQ YRQ++ + ++D++NLP +GR+FELIR+LE   +EE+IRFQ+ RGQKI W DLK +EK++  KP ++   +L LEK+IH+ T +L   A EK D  L ++L  R+ILRQ+KVIRKR+NQLRNL+RSEDD  PFLTA+L  RF VEKLEREL++   RRE
Sbjct:    1 MSLIRMVDNTEIEVEVSNLVNKRLHLCQSYRQVQTEFLTDEINLPVYGRLFELIRELECEEIEEMIRFQISRGQKIIWSDLKHLEKIENRKPSDMITILLDLEKKIHQSTLELFKHACEKFDVGLTTFLSDRIILRQIKVIRKRANQLRNLERSEDDVTPFLTAKLHIRFVVEKLERELKLHFERRE 187          
BLAST of Ferritin vs. TrEMBL
Match: A0A5J4NL02 (Ferritin OS=Paragonimus westermani OX=34504 GN=DEA37_0014666 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.871e-16
Identity = 61/202 (30.20%), Postives = 102/202 (50.50%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCI---KPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKLERELQMERTRREWRIE--NDYERE 592
            M   R+   PE E  ++K++         Y  L   C ++++++P F + F L  Q +HR  E  I FQ  RG K+   +++P+E L  +   K  NL +  L +E++I     +L  +A    D A+  Y+  ++ L Q+ VIR   N +  ++ S +D   +L  R T    V+KL REL    TRRE ++E   DY+++
Sbjct:    1 MHSARINFTPESEHSINKVIELHKQAAHTYDHLAATCATEEISMPGFCKFFRLCSQRQHRLAEHWINFQTMRGGKVHVPEVRPLEDLSGLYRQKLDNLVEMALGVEEKIEHHLRQLHRIAVSADDVAMREYIEKKLSLPQLHVIRMMVNHVNGVRVSGND---YLYDRTTMLPLVKKLRREL----TRRE-KLECFKDYDKQ 194          
BLAST of Ferritin vs. TrEMBL
Match: A0A5J4N587 (Ferritin OS=Paragonimus westermani OX=34504 GN=DEA37_0014149 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.324e-13
Identity = 50/182 (27.47%), Postives = 87/182 (47.80%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILT---LEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKLEREL 538
            M   R+   PE E  ++K++         Y  L   C ++++++P F + F L  Q +HR  E  I FQ  RG K+   ++ P+E         L + +L     EK++     ++  +A  K D A+  Y+  +++L Q+ VI+  +N    L+ S ++   +L  R T    V+KL REL
Sbjct:    1 MHSARINFTPESEHSINKVIELHKQAAHTYDHLAATCATEEISMPGFCKFFRLCSQRQHRLAEHWINFQTMRGGKVHVPEVTPLEHCSEHSRKELEKIVLVGLETEKKVEHYLREMHKIARSKEDVAMGEYIEKKLMLPQLHVIKMMANHTNGLRVSGNE---YLYDRTTMLPLVKKLRREL 179          
BLAST of Ferritin vs. TrEMBL
Match: A0A346CIQ2 (Ferritin OS=Conus ermineus OX=55423 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.046e-11
Identity = 41/144 (28.47%), Postives = 71/144 (49.31%), Query Frame = 2
Query:   29 PEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
             E E  V++ +N  L  C  Y+ +      DDV LP F + F+     E    E+L++FQ  RG +I   D+K  ++ +    ++  Q  L LEK +++    L  +A + +D  +  +L    +  QV+ I+K  + + NLKR
Sbjct:   14 AESEAGVNRQINMELYACYCYQSMSFYFDRDDVALPGFAKYFKEASDEEREHAEKLMKFQNKRGGRIVLQDIKKPDRDEWGTGLDAMQVALGLEKSVNQALLDLHKVAMDHNDAQMTDFLEGEYLQEQVEAIKKIGDHITNLKR 157          
BLAST of Ferritin vs. TrEMBL
Match: A0A5P8I123 (Ferritin OS=Conus magus OX=6492 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.299e-11
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 2
Query:   29 PEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
             E E  V++ +N  L  C  Y+ +      DDV LP F + F+     E    E+L++FQ  RG +I   D+K  ++ +    ++  Q  L LEK +++    L  +A   +D  +  +L    +  QVK I++  + + NLKR
Sbjct:   14 AESEAGVNRQINMELYACYCYQSMSFYFDRDDVALPGFAKYFKEASDEEREHAEKLMKFQNKRGGRIVLQDIKKPDRDEWGTGLDAMQVALGLEKSVNQALLDLHQVAMNHNDAQMTDFLEGEYLQEQVKAIKELGDHITNLKR 157          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000042393.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 62.003 bits (149), Expect = 1.078e-11
Identity = 41/143 (28.67%), Postives = 66/143 (46.15%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  ++++VN  L     Y  +      DDV L  F   F+     E    E+L+ FQ  RG +I   D+K  E+ +    +   Q  L LEK +++    L  +A EK D  L  +L T  +  QV+ I+K  + + NL +
Sbjct:   13 DCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDEWGTGLEAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTK 155          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000048516.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 62.003 bits (149), Expect = 1.115e-11
Identity = 41/143 (28.67%), Postives = 66/143 (46.15%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  ++++VN  L     Y  +      DDV L  F   F+     E    E+L+ FQ  RG +I   D+K  E+ +    +   Q  L LEK +++    L  +A EK D  L  +L T  +  QV+ I+K  + + NL +
Sbjct:   12 DCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDEWGTGLEAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTK 154          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000052792.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029400])

HSP 1 Score: 58.9214 bits (141), Expect = 1.262e-10
Identity = 40/152 (26.32%), Postives = 70/152 (46.05%), Query Frame = 2
Query:    5 SLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            SL R     + E  ++++VN        Y  +      DDV L  F   F+     E    E+ + FQ  RG ++   D+K  E+ +    +   Q  L LEK++++    L ++A EK D  L  +L +  +  QV++I+K  + + NL +
Sbjct:    4 SLVRQNYHRDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALKGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHNIATEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTK 155          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000033391.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029400])

HSP 1 Score: 59.3066 bits (142), Expect = 1.268e-10
Identity = 40/152 (26.32%), Postives = 70/152 (46.05%), Query Frame = 2
Query:    5 SLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            SL R     + E  ++++VN        Y  +      DDV L  F   F+     E    E+ + FQ  RG ++   D+K  E+ +    +   Q  L LEK++++    L ++A EK D  L  +L +  +  QV++I+K  + + NL +
Sbjct:   10 SLVRQNYHRDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALKGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHNIATEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTK 161          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000033875.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029096])

HSP 1 Score: 57.7658 bits (138), Expect = 3.353e-10
Identity = 37/144 (25.69%), Postives = 66/144 (45.83%), Query Frame = 2
Query:   29 PEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
             + E  ++++VN        Y  +      DDV L  F   F+     E    E+ + FQ  RG ++   D+K  E+ +    +   Q  L LEK++++    L  +A EK D  L  +L +  +  QV++I+K  + + NL +
Sbjct:   11 SDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHKIASEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTK 154          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006438.1 (pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-1 gene:ENSPMAG00000005680.1 transcript:ENSPMAT00000006438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 3.928e-13
Identity = 44/143 (30.77%), Postives = 70/143 (48.95%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            EVE  +++ VN  L     Y  L      DDV L  F + F+ +   E    E+L+ +Q  RG +    D+K  E+ +    +   Q  L LEK +++    L +LA EK+D  L  +L +  +  QV+ I+K  + + NLKR
Sbjct:   12 EVEAAINRQVNQELYASYVYLSLASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKKPERDEWGSGLEAMQLALQLEKTVNQALLDLHALASEKTDPQLCDFLESEFLEEQVESIKKLGDHVTNLKR 154          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008696.1 (pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 gene:ENSPMAG00000007869.1 transcript:ENSPMAT00000008696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.208e-11
Identity = 43/144 (29.86%), Postives = 72/144 (50.00%), Query Frame = 2
Query:   29 PEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            P+VE  +++ VN  L+    +  L      DDV L  F + F+ +   E    ++L+ +Q  RG ++   D+K  E+ D    +   QT L L+K I++    L   A EK+D  L  +L+   +  QV+ I+K  + + NLKR
Sbjct:   15 PDVEAAINRQVNMTLHASYVFLSLASYFDRDDVALKNFRKFFKELSDKEREHADKLLAYQNKRGGRVVLRDIKTPERDDWGHILEAMQTALQLQKSINQSLLDLHGQAREKNDPQLCEFLKD-FLEEQVESIKKLGDHITNLKR 157          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006468.1 (pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1 gene:ENSPMAG00000005828.1 transcript:ENSPMAT00000006468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 5.345e-11
Identity = 49/167 (29.34%), Postives = 78/167 (46.71%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLK--PVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKL 526
            EVE  +++ VN  L     Y  +      DDV L  F + F+ +   E    E+L+ +Q  RG +    D+K    E+ +    +   Q  L LEK +++    L +LA EK D  L  +L +  +  QV+ I+K  + + NLKR     +P  T   TG +  +KL
Sbjct:   16 EVEAAINRQVNQELYASYVYLSMASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKEQKPERDEWGSGLEAMQLALQLEKTVNQALLDLHALASEKKDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRL---GVPHST---TGEYLFDKL 176          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009440.1 (pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 gene:ENSPMAG00000008472.1 transcript:ENSPMAT00000009440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.345e-9
Identity = 42/162 (25.93%), Postives = 77/162 (47.53%), Query Frame = 2
Query:   26 VPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR---SEDDKIPFLTARLT 502
              +VE  +++ +N  L+    Y  +      DDV L  F + F+     E    E+L+ +Q  RG ++   D+K  E+ +    +   Q  L LEK +++    L +L  +++D  L  +L +  +  QV+ I+K  + + NLKR   S+     +L  +LT
Sbjct:   10 AQDVEAAINRQINMELSASYVYLSMAYYFDRDDVALNNFFKFFKEQSHEEREHAEKLMAYQNKRGGRVVLKDVKKPERDEWGSGLEAVQLALQLEKNVNQSLLDLHALGSKENDPQLCDFLESHYLEEQVEAIKKLGDFVTNLKRLGASQSGMGEYLFDKLT 171          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009049.1 (pep scaffold:Pmarinus_7.0:GL481010:20946:22909:-1 gene:ENSPMAG00000008182.1 transcript:ENSPMAT00000009049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 2.130e-8
Identity = 35/114 (30.70%), Postives = 57/114 (50.00%), Query Frame = 2
Query:  119 DDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            DDV L  F + F+ + + E    ++L+ +Q  RG ++   D+K  E  +    +   Q  L LEK +++    L  LA EK D  L  +L    +  QV+ I+K  + + NLKR
Sbjct:    8 DDVALKNFHKFFKELSEEEREHADKLLAYQNKRGGRVQLQDVKKPEHDEWGNGLEAMQAALQLEKSVNQSLLDLHVLATEKKDPQLCDFL-DDFLEEQVESIKKLGDHVTNLKR 120          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO39948 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6])

HSP 1 Score: 68.9366 bits (167), Expect = 1.149e-14
Identity = 45/153 (29.41%), Postives = 71/153 (46.41%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            MSL R     E E  ++K +N  L     Y  +      DDV LP F + F      E    E+L++FQ  RG +I   D+K  EK +    ++  Q  L LEK +++    L  +A +  D  +  ++    +  QV+ I++ +  L NLKR
Sbjct:    1 MSLCRQNYHEECEAGINKQINLELYASYAYLSMAFHFDRDDVALPGFHKYFLKASHEEREHAEKLMKFQNERGGRIVLQDIKKPEKDEWGCGMDSIQVALDLEKHVNQALLDLHKIAEKHGDAQMTDFIEGNFLTEQVEAIKELAGHLTNLKR 153          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI7])

HSP 1 Score: 67.3958 bits (163), Expect = 4.230e-14
Identity = 51/175 (29.14%), Postives = 79/175 (45.14%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKL 526
            +S+ R     E E  V+K +N  L     Y  +      DDV LP F + F      E    E+L +FQ+ RG +I   D+K  E+ D     +  Q  L LEK +++    L  +A +  D  +  +L +  +  QV+ I++ +  L NLKR      P L     G F+ +KL
Sbjct:    3 LSVCRQNYHEESEAGVNKQINLELYASYVYMSMAYHFDRDDVALPGFHKYFMKASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHLTNLKRVG----PGL-----GEFQFDKL 168          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO32257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL1])

HSP 1 Score: 66.6254 bits (161), Expect = 7.062e-14
Identity = 44/153 (28.76%), Postives = 71/153 (46.41%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            +S+ R     E E  V+K +N  L     Y  +      DDV LP F + F      E    E+L +FQ+ RG +I   D+K  E+ D     +  Q  L LEK +++    L  +A +  D  +  +L +  +  QV+ I++ +  + NLKR
Sbjct:    3 LSVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFIKASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALHDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLKR 155          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31579 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI8])

HSP 1 Score: 66.2402 bits (160), Expect = 1.119e-13
Identity = 42/143 (29.37%), Postives = 67/143 (46.85%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            E E  V+K +N  L     Y  +      DDV LP F + F      E    E+L +FQ+ RG +I   D+K  E+ D     +  Q  L LEK +++    L  +A +  D  +  +L +  +  QV+ I++ +  + NLKR
Sbjct:   13 ESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFMEASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLKR 155          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO35374 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6])

HSP 1 Score: 65.4698 bits (158), Expect = 1.776e-13
Identity = 46/155 (29.68%), Postives = 76/155 (49.03%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSD--DVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            MSL R     E E  ++K +N  L L   Y    M C  D  DV+LP F + F+     E    E+L++FQ  RG +I   ++K  E+ +    +   QT L LEK +++   +L+  A +  D  ++ ++    +  QV+ IR+ S  +  LK+
Sbjct:    1 MSLCRQNYHEECEAGINKQIN--LELYASYVYTSMACYFDREDVHLPGFHKFFKKQAHEEREHAEKLMKFQNQRGGRIVLQNVKKPERDEWGSGLEAMQTALDLEKHVNQALIELEKTAEKNGDAQMSDFIEDHFLTEQVESIRELSGYIAVLKK 153          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020971.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 59.3066 bits (142), Expect = 1.222e-10
Identity = 39/143 (27.27%), Postives = 66/143 (46.15%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  ++++VN  L     Y  +      DDV LP F   F+     E    ++L+ FQ  RG +I   D+K  E+ +    +   Q  L LEK +++    L  +A +  D  +  +L T  +  QV+ I+K  + + NL R
Sbjct:   12 DCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPERDEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTR 154          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020975.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 57.7658 bits (138), Expect = 3.333e-10
Identity = 38/143 (26.57%), Postives = 66/143 (46.15%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  ++++VN  L     Y  +      DDV LP F   F+     E    ++L+ FQ  RG +I   D+K  ++ +    +   Q  L LEK +++    L  +A +  D  +  +L T  +  QV+ I+K  + + NL R
Sbjct:   12 DCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPDRNEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTR 154          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020972.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 57.7658 bits (138), Expect = 3.333e-10
Identity = 38/143 (26.57%), Postives = 66/143 (46.15%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  ++++VN  L     Y  +      DDV LP F   F+     E    ++L+ FQ  RG +I   D+K  ++ +    +   Q  L LEK +++    L  +A +  D  +  +L T  +  QV+ I+K  + + NL R
Sbjct:   12 DCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPDRNEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTR 154          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020974.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 57.7658 bits (138), Expect = 3.677e-10
Identity = 38/143 (26.57%), Postives = 66/143 (46.15%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  ++++VN  L     Y  +      DDV LP F   F+     E    ++L+ FQ  RG +I   D+K  ++ +    +   Q  L LEK +++    L  +A +  D  +  +L T  +  QV+ I+K  + + NL R
Sbjct:   19 DCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPDRNEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTR 161          
BLAST of Ferritin vs. Ensembl Medaka
Match: fth1b (ferritin, heavy subunit [Source:NCBI gene;Acc:101155346])

HSP 1 Score: 51.9878 bits (123), Expect = 3.899e-8
Identity = 38/145 (26.21%), Postives = 69/145 (47.59%), Query Frame = 2
Query:   32 EVEMQVSKLVNSMLNLCQGYRQLEMKCM--SDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKR 460
            + E  +++ +N  L L   Y  L M      DD +LP F + F    + E    E+L+  Q  RG +I   D+K  ++ +    +   +  L LEK +++    L  LA +  D  +  ++ T  +  QVK I++ ++ + NL+R
Sbjct:   12 DCEAAINRQIN--LELYASYVYLSMAYYFERDDKHLPNFAKFFNSQSKEEREHAEKLMSLQNKRGGRIFLQDIKKPDRDEWGSSLEALECALQLEKSVNQSLLDLQKLATDHGDPHMCDFIETHFLDEQVKSIKQLADWISNLRR 154          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000066331.1 (SMESG000066331.1)

HSP 1 Score: 246.128 bits (627), Expect = 6.975e-83
Identity = 121/208 (58.17%), Postives = 155/208 (74.52%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKLERELQMERTRREWRIENDYEREHLKSIGSTYRF 625
            MSL+++IEVPEVE +VS ++  ML+LCQGYRQ EM+ +SD++NLPTF R+FELIR LE R +EE+IRFQ+ RGQK+TW D+KPVE L+  KPV + Q IL LEK +H+ T  L  L W+  D AL S+L  RVIL+Q+KVIRKR+NQLR+LKRS D+  P LT+RL+ RFEVEKLE  +++E  RREWR      R+    IGS  RF
Sbjct:    1 MSLSKVIEVPEVEREVSNVIGQMLHLCQGYRQSEMRFLSDEINLPTFARLFELIRILETRYIEEIIRFQISRGQKVTWQDIKPVENLEASKPVQMLQIILDLEKSVHQSTINLCKLGWKNLDLALTSFLENRVILKQIKVIRKRANQLRDLKRSGDEICPMLTSRLSVRFEVEKLEERVELEIERREWRSGESRSRKRFPIIGSMNRF 208          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000066328.1 (SMESG000066328.1)

HSP 1 Score: 246.128 bits (627), Expect = 6.975e-83
Identity = 121/208 (58.17%), Postives = 155/208 (74.52%), Query Frame = 2
Query:    2 MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKLERELQMERTRREWRIENDYEREHLKSIGSTYRF 625
            MSL+++IEVPEVE +VS ++  ML+LCQGYRQ EM+ +SD++NLPTF R+FELIR LE R +EE+IRFQ+ RGQK+TW D+KPVE L+  KPV + Q IL LEK +H+ T  L  L W+  D AL S+L  RVIL+Q+KVIRKR+NQLR+LKRS D+  P LT+RL+ RFEVEKLE  +++E  RREWR      R+    IGS  RF
Sbjct:    1 MSLSKVIEVPEVEREVSNVIGQMLHLCQGYRQSEMRFLSDEINLPTFARLFELIRILETRYIEEIIRFQISRGQKVTWQDIKPVENLEASKPVQMLQIILDLEKSVHQSTINLCKLGWKNLDLALTSFLENRVILKQIKVIRKRANQLRDLKRSGDEICPMLTSRLSVRFEVEKLEERVELEIERREWRSGESRSRKRFPIIGSMNRF 208          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000033055.1 (SMESG000033055.1)

HSP 1 Score: 227.254 bits (578), Expect = 1.573e-75
Identity = 122/192 (63.54%), Postives = 155/192 (80.73%), Query Frame = 2
Query:   50 SKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKLERELQMERTRREWRIENDYEREHLKSIGSTYRF 625
            SKLVN ML+LCQGYRQ++M+ ++D++NL +FGR+FELIRQ+E + VEELIRFQV RGQKITW+D+KPV+ ++  KPV + QTILTLEKEIH++TT+L  LA +K D AL ++L  R+ILRQVKVIRKRSNQL++LKRSEDD  P LT+ L  R EV+KLER L++E +RREWR     E E +K IGST RF
Sbjct:   16 SKLVNRMLHLCQGYRQVQMRFLTDELNLISFGRLFELIRQVEAKHVEELIRFQVSRGQKITWYDVKPVDHIEGAKPVEIIQTILTLEKEIHQITTRLCKLAADKLDLALTTFLEDRMILRQVKVIRKRSNQLKDLKRSEDDVTPLLTSILNARREVDKLERRLRLESSRREWRRGESDEGEEIKMIGSTTRF 207          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000033054.1 (SMESG000033054.1)

HSP 1 Score: 224.172 bits (570), Expect = 3.200e-74
Identity = 121/192 (63.02%), Postives = 153/192 (79.69%), Query Frame = 2
Query:   50 SKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKLERELQMERTRREWRIENDYEREHLKSIGSTYRF 625
            SKLVN ML+LCQGYRQ++M+ ++D++NL +FGR+FELIRQ+E + VEELIRFQV RGQKITW+D+KPV+ ++  KPV + QTILTLEKEIH++TT+L  LA +K D AL ++L  RVILRQVKVIRKRSNQLR++ RS DD  P LT+ L  R EV+KLER L++E +RREWR     E E +K IGST RF
Sbjct:   16 SKLVNRMLHLCQGYRQVQMRFLTDELNLISFGRLFELIRQVEAKHVEELIRFQVSRGQKITWYDVKPVDHIEGAKPVEIIQTILTLEKEIHQITTRLCKLAADKLDLALTTFLEDRVILRQVKVIRKRSNQLRDMLRSGDDVTPLLTSILNARREVDKLERRLRLESSRREWRRGESDEGEEIKMIGSTTRF 207          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000033053.1 (SMESG000033053.1)

HSP 1 Score: 222.246 bits (565), Expect = 1.737e-73
Identity = 120/192 (62.50%), Postives = 152/192 (79.17%), Query Frame = 2
Query:   50 SKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRMFELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTILTLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRNLKRSEDDKIPFLTARLTGRFEVEKLERELQMERTRREWRIENDYEREHLKSIGSTYRF 625
            SKLVN ML+LCQGYRQ++M+ ++D++NL +FGR+FELIRQ+E + VEELIRFQV RGQKITW+D KPV+ ++  KPV + QTILTLEKEIH++TT+L  LA +K D AL ++L  R+ILRQVKVIRKRSNQLR++ RS DD  P LT+ L  R EV+KLER L++E +RREWR     E E +K IGST RF
Sbjct:   16 SKLVNRMLHLCQGYRQVQMRFLTDELNLISFGRLFELIRQVEAKHVEELIRFQVSRGQKITWYDFKPVDHIEGAKPVEIIQTILTLEKEIHQITTRLCKLAADKLDLALTTFLEDRMILRQVKVIRKRSNQLRDMLRSGDDVTPLLTSILNARREVDKLERRLRLESSRREWRRGESDEGEEIKMIGSTTRF 207          
The following BLAST results are available for this feature:
BLAST of Ferritin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FTMT3.747e-1029.58ferritin mitochondrial [Source:HGNC Symbol;Acc:HGN... [more]
FTL2.482e-927.27ferritin light chain [Source:HGNC Symbol;Acc:HGNC:... [more]
FTH11.079e-829.82ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTH11.339e-828.28ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTH11.339e-828.28ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Ferritin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ftn-22.252e-1230.07Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-22.252e-1230.07Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-12.056e-1126.62Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
ftn-12.056e-1126.62Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
back to top
BLAST of Ferritin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ferritin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fthl273.295e-1230.22ferritin, heavy polypeptide-like 27 [Source:ZFIN;A... [more]
fth1a3.644e-927.66ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fth1a3.644e-927.66ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
zgc:560956.421e-725.53zgc:56095 [Source:ZFIN;Acc:ZDB-GENE-040426-1948][more]
zgc:560956.421e-725.53zgc:56095 [Source:ZFIN;Acc:ZDB-GENE-040426-1948][more]
back to top
BLAST of Ferritin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MGC757523.975e-1126.25uncharacterized protein MGC75752 [Source:NCBI gene... [more]
MGC797254.890e-929.66MGC79725 protein [Source:NCBI gene;Acc:448524][more]
MGC797255.245e-929.66MGC79725 protein [Source:NCBI gene;Acc:448524][more]
fth1.18.000e-925.87ferritin, heavy polypeptide 1, gene 1 [Source:NCBI... [more]
nop537.492e-725.17NOP53 ribosome biogenesis factor [Source:Xenbase;A... [more]
back to top
BLAST of Ferritin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ftl11.598e-1128.67ferritin light polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftl1-ps11.598e-1128.67ferritin light polypeptide 1, pseudogene 1 [Source... [more]
Fth14.812e-1128.97ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Fth14.812e-1128.97ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftmt1.848e-930.77ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ferritin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P85835|FRIM_TRENE1.940e-1127.27Ferritin, middle subunit OS=Trematomus newnesi OX=... [more]
sp|P85839|FRIMS_PSEBE2.475e-1128.67Ferritin, spleen middle subunit OS=Pseudotrematomu... [more]
sp|P85836|FRIML_PSEBE3.568e-1127.27Ferritin, liver middle subunit OS=Pseudotrematomus... [more]
sp|P42577|FRIS_LYMST8.241e-1127.08Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV... [more]
sp|P29391|FRIL1_MOUSE1.327e-1028.67Ferritin light chain 1 OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of Ferritin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMG61.413e-6156.15Ferritin OS=Schmidtea mediterranea OX=79327 PE=2 S... [more]
A0A5J4NL022.871e-1630.20Ferritin OS=Paragonimus westermani OX=34504 GN=DEA... [more]
A0A5J4N5873.324e-1327.47Ferritin OS=Paragonimus westermani OX=34504 GN=DEA... [more]
A0A346CIQ21.046e-1128.47Ferritin OS=Conus ermineus OX=55423 PE=2 SV=1[more]
A0A5P8I1231.299e-1128.47Ferritin OS=Conus magus OX=6492 PE=2 SV=1[more]
back to top
BLAST of Ferritin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042393.11.078e-1128.67ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000048516.11.115e-1128.67ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000052792.11.262e-1026.32ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000033391.11.268e-1026.32ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000033875.13.353e-1025.69ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Ferritin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006438.13.928e-1330.77pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-... [more]
ENSPMAT00000008696.11.208e-1129.86pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 g... [more]
ENSPMAT00000006468.15.345e-1129.34pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1... [more]
ENSPMAT00000009440.11.345e-925.93pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 ... [more]
ENSPMAT00000009049.12.130e-830.70pep scaffold:Pmarinus_7.0:GL481010:20946:22909:-1 ... [more]
back to top
BLAST of Ferritin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ferritin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399481.149e-1429.41Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6][more]
EDO315784.230e-1429.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322577.062e-1428.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315791.119e-1329.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353741.776e-1329.68Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6][more]
back to top
BLAST of Ferritin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020971.21.222e-1027.27ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020975.23.333e-1026.57ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020972.23.333e-1026.57ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020974.23.677e-1026.57ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
fth1b3.899e-826.21ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Ferritin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066331.16.975e-8358.17SMESG000066331.1[more]
SMESG000066328.16.975e-8358.17SMESG000066328.1[more]
SMESG000033055.11.573e-7563.54SMESG000033055.1[more]
SMESG000033054.13.200e-7463.02SMESG000033054.1[more]
SMESG000033053.11.737e-7362.50SMESG000033053.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022321 ID=SMED30022321|Name=Ferritin|organism=Schmidtea mediterranea sexual|type=transcript|length=682bp
AATGTCTCTCACAAGATTAATAGAAGTTCCTGAAGTAGAAATGCAAGTTA
GCAAACTTGTCAATAGTATGCTTAACTTATGCCAAGGATATCGTCAACTT
GAAATGAAATGTATGTCTGATGATGTTAATCTTCCAACTTTCGGAAGAAT
GTTTGAATTAATTCGCCAACTTGAACATAGACGCGTTGAAGAGCTAATTC
GATTTCAAGTTTGCCGAGGCCAGAAGATTACCTGGTTTGATTTGAAACCG
GTAGAGAAGCTTGATTGCATTAAGCCTGTCAATTTATTTCAAACTATATT
GACTTTGGAAAAAGAAATACATAAATTGACAACCAAGTTGGATAGTTTGG
CATGGGAAAAATCGGATTTTGCATTAAATTCATATTTGCGAACGAGAGTG
ATATTACGCCAAGTGAAAGTTATTCGCAAACGAAGTAATCAATTAAGAAA
TTTAAAACGAAGTGAAGACGATAAAATTCCATTTCTGACTGCTCGTCTAA
CTGGACGCTTTGAAGTTGAAAAACTTGAAAGAGAACTTCAAATGGAACGA
ACTCGAAGAGAATGGAGAATTGAAAATGATTATGAAAGAGAACATTTGAA
ATCAATTGGATCTACTTATCGATTCTAATTAATTCACGGAATGAACATAA
CATTTCTAAATTAGCTTAATTAAAACAGATCG
back to top

protein sequence of SMED30022321-orf-1

>SMED30022321-orf-1 ID=SMED30022321-orf-1|Name=SMED30022321-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=209bp
MSLTRLIEVPEVEMQVSKLVNSMLNLCQGYRQLEMKCMSDDVNLPTFGRM
FELIRQLEHRRVEELIRFQVCRGQKITWFDLKPVEKLDCIKPVNLFQTIL
TLEKEIHKLTTKLDSLAWEKSDFALNSYLRTRVILRQVKVIRKRSNQLRN
LKRSEDDKIPFLTARLTGRFEVEKLERELQMERTRREWRIENDYEREHLK
SIGSTYRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001519Ferritin
IPR012347Ferritin-like
IPR008331Ferritin_DPS_dom
IPR009078Ferritin-like_SF
Vocabulary: molecular function
TermDefinition
GO:0008199ferric iron binding
GO:0004322ferroxidase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006879cellular iron ion homeostasis
GO:0006826iron ion transport
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 99..119
IPR012347Ferritin-likeGENE3DG3DSA:1.20.1260.10coord: 2..163
e-value: 9.9E-22
score: 79.4
IPR008331Ferritin/DPS protein domainPFAMPF00210Ferritincoord: 33..153
e-value: 1.9E-9
score: 37.6
IPR001519FerritinPANTHERPTHR11431FERRITINcoord: 10..155
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 10..157