Abhydrolase domain containing 12

Overview
NameAbhydrolase domain containing 12
Smed IDSMED30022282
Length (bp)1858
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Abhydrolase domain containing 12 (SMED30022282) t-SNE clustered cells

Violin plots show distribution of expression levels for Abhydrolase domain containing 12 (SMED30022282) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Abhydrolase domain containing 12 (SMED30022282) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Abhydrolase domain containing 12 (SMED30022282) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022282

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022282h1SMcG0004055 Contig3050GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
posterior region of the whole animalSMED30022282h1SMcG0004055 dd_Smed_v4_7803_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022282h1SMcG0004055 SmedASXL_004493SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30022282h1SMcG0004055 dd_Smed_v4_7803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022282h1SMcG0004055 dd_Smed_v6_18185_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Abhydrolase domain containing 12 vs. Ensembl Human
Match: ABHD12 (abhydrolase domain containing 12 [Source:HGNC Symbol;Acc:HGNC:15868])

HSP 1 Score: 159.458 bits (402), Expect = 1.527e-42
Identity = 94/258 (36.43%), Postives = 150/258 (58.14%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            AK I LN   +  F +LKKP           YL+ + + +   +G W  +          KD++  E+ +   ++  PII+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ EN+K ++ P++ILHAEDD ++ F++G+KLYS
Sbjct:   98 AKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVT---IGVWHTVPAVWWKNAQGKDQMWYEDAL---ASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYS 346          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Human
Match: ABHD12 (abhydrolase domain containing 12 [Source:HGNC Symbol;Acc:HGNC:15868])

HSP 1 Score: 159.458 bits (402), Expect = 1.677e-42
Identity = 94/258 (36.43%), Postives = 150/258 (58.14%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            AK I LN   +  F +LKKP           YL+ + + +   +G W  +          KD++  E+ +   ++  PII+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ EN+K ++ P++ILHAEDD ++ F++G+KLYS
Sbjct:   98 AKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVT---IGVWHTVPAVWWKNAQGKDQMWYEDAL---ASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYS 346          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Human
Match: ABHD12B (abhydrolase domain containing 12B [Source:HGNC Symbol;Acc:HGNC:19837])

HSP 1 Score: 152.91 bits (385), Expect = 1.541e-40
Identity = 90/249 (36.14%), Postives = 141/249 (56.63%), Query Frame = 1
Query:  142 FTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEII--CKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
              +LKKP+  K       YLR++       LG W  +  C+ ++   KD    E  ++   +G PII+Y HG   HR +SHR++L  +L + G+H+L+VDY+GFGDS+G    EE L  DA   Y++ K  +  +P+ +WGHSLGTG+++   K L    GC  +D ++LE+PFT++     +      +R +P F      +L   KI F + EN+K ++ P++ILH EDDR +  E G+KLY   ++
Sbjct:   83 LVDLKKPE-LKIPHTVNFYLRVEPGVM---LGIWHTVPSCRGEDAKGKDCCWYEAALR---DGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPT-EEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEE-KGC-PVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARN 321          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Human
Match: ABHD12 (abhydrolase domain containing 12 [Source:HGNC Symbol;Acc:HGNC:15868])

HSP 1 Score: 147.902 bits (372), Expect = 4.790e-40
Identity = 77/186 (41.40%), Postives = 121/186 (65.05%), Query Frame = 1
Query:  313 FSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
             ++  PII+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ EN+K ++ P++ILHAEDD ++ F++G+KLYS
Sbjct:    7 LASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYS 189          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Human
Match: ABHD12B (abhydrolase domain containing 12B [Source:HGNC Symbol;Acc:HGNC:19837])

HSP 1 Score: 147.517 bits (371), Expect = 2.012e-39
Identity = 79/210 (37.62%), Postives = 125/210 (59.52%), Query Frame = 1
Query:  253 CKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
            C+ ++   KD    E  ++   +G PII+Y HG   HR +SHR++L  +L + G+H+L+VDY+GFGDS+G    EE L  DA   Y++ K  +  +P+ +WGHSLGTG+++   K L    GC  +D ++LE+PFT++     +      +R +P F      +L   KI F + EN+K ++ P++ILH EDDR +  E G+KLY   ++
Sbjct:   41 CRGEDAKGKDCCWYEAALR---DGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPT-EEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEE-KGC-PVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARN 244          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Celegans
Match: abhd-12 (ABHydrolase Domain containing homolog [Source:UniProtKB/TrEMBL;Acc:Q965S2])

HSP 1 Score: 127.872 bits (320), Expect = 3.219e-32
Identity = 90/227 (39.65%), Postives = 136/227 (59.91%), Query Frame = 1
Query:  331 IIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETM-DHICFT-WPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXHIIRYPELPNLI-SFHRYFNPP 1002
            II Y HG +  R   HRVE+Y++L +  YH++  DY+G+GDS G+   E+ ++ED    Y++ K+    +P+ VWGHS+GTG+S  L++ LS         GLILESPF ++ + + +H  FT + W      + I  + L    +T  S + +++V+ PIIILHAEDD+IL  ++G+ LY   K   +++  + FSS +G GHK I RYPELP +I  F     PP
Sbjct:  115 IIFYAHGNSFDRTFYHRVEMYNLLSDCNYHVVCFDYRGYGDSEGTPT-EKGIVEDTKTVYEWLKENCGKTPVIVWGHSMGTGVSCKLVQDLSREQQPPC--GLILESPFNNLKDAVTNHPIFTVFSWMNDFMVDHIIIRPLNSVGLTMRSDKRIRLVSCPIIILHAEDDKILPVKLGRALYEAAKDAERDIKIREFSSDYGLGHKFICRYPELPEIIEEFVGSVTPP 338          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Celegans
Match: abhd-12 (ABHydrolase Domain containing homolog [Source:UniProtKB/TrEMBL;Acc:Q965S2])

HSP 1 Score: 127.872 bits (320), Expect = 3.219e-32
Identity = 90/227 (39.65%), Postives = 136/227 (59.91%), Query Frame = 1
Query:  331 IIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETM-DHICFT-WPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXHIIRYPELPNLI-SFHRYFNPP 1002
            II Y HG +  R   HRVE+Y++L +  YH++  DY+G+GDS G+   E+ ++ED    Y++ K+    +P+ VWGHS+GTG+S  L++ LS         GLILESPF ++ + + +H  FT + W      + I  + L    +T  S + +++V+ PIIILHAEDD+IL  ++G+ LY   K   +++  + FSS +G GHK I RYPELP +I  F     PP
Sbjct:  115 IIFYAHGNSFDRTFYHRVEMYNLLSDCNYHVVCFDYRGYGDSEGTPT-EKGIVEDTKTVYEWLKENCGKTPVIVWGHSMGTGVSCKLVQDLSREQQPPC--GLILESPFNNLKDAVTNHPIFTVFSWMNDFMVDHIIIRPLNSVGLTMRSDKRIRLVSCPIIILHAEDDKILPVKLGRALYEAAKDAERDIKIREFSSDYGLGHKFICRYPELPEIIEEFVGSVTPP 338          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Fly
Match: CG15111 (gene:FBgn0034419 transcript:FBtr0086581)

HSP 1 Score: 131.724 bits (330), Expect = 4.671e-33
Identity = 78/228 (34.21%), Postives = 129/228 (56.58%), Query Frame = 1
Query:  184 GNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLY 867
            GN R L+  +   + E   + ++  E+E     +L  E  +++   G  +++Y HG T  RGS HR E+Y +LR   YH+ + DY+G+ DS      EE ++ DA + ++Y      N P+ VWGHSLGTG+++ L  KL+++   A   G+ILESPFT+I + +    F   ++ +P+FN    Q +   ++ F S  ++     PI+I+HAEDD ++ F +G +LY
Sbjct:  126 GNERELKELSPAIRSE---FPVVLPENE-----QLFYERLLRM--PGGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTSN-PIVVWGHSLGTGVATHLCAKLASLRERAP-RGVILESPFTNIRDEIRMHPFAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLY 341          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Fly
Match: CG15111 (gene:FBgn0034419 transcript:FBtr0086580)

HSP 1 Score: 131.339 bits (329), Expect = 9.026e-33
Identity = 78/228 (34.21%), Postives = 129/228 (56.58%), Query Frame = 1
Query:  184 GNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLY 867
            GN R L+  +   + E   + ++  E+E     +L  E  +++   G  +++Y HG T  RGS HR E+Y +LR   YH+ + DY+G+ DS      EE ++ DA + ++Y      N P+ VWGHSLGTG+++ L  KL+++   A   G+ILESPFT+I + +    F   ++ +P+FN    Q +   ++ F S  ++     PI+I+HAEDD ++ F +G +LY
Sbjct:  144 GNERELKELSPAIRSE---FPVVLPENE-----QLFYERLLRM--PGGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTSN-PIVVWGHSLGTGVATHLCAKLASLRERAP-RGVILESPFTNIRDEIRMHPFAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLY 359          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Zebrafish
Match: abhd12 (abhydrolase domain containing 12 [Source:NCBI gene;Acc:767657])

HSP 1 Score: 167.933 bits (424), Expect = 6.380e-46
Identity = 105/298 (35.23%), Postives = 160/298 (53.69%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXH----IIRYPELPNLIS 978
            AK + LN   +  F +LK+P        +  YL+ +       +G W  +      E   KD    E + K F +  P+I+Y HG    RG  HRV+LY +L + GYH++T DY+G+GDS GS + E  +  DA   YQ+ K+     PL++WGHSLGTG+++ L+++L   D     D LILESPFT+I E      F+  +RY+P F+  F  ++    I F+S EN+  ++ P++ILHAEDD ++ F++G+KLY            K     F     +    I + P+LPN++S
Sbjct:   84 AKLVFLNFVRVPYFIDLKRPQDQGMNHTHNFYLQPEEG---INIGVWHTVPAGMWREAQAKDA---EWYEKSFQSSHPVILYLHGNAGTRGGDHRVQLYKVLSSLGYHVVTFDYRGWGDSEGSPS-ERGMTSDALFLYQWIKQRIGPKPLYIWGHSLGTGVATNLVRRL--CDRGTPPDALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDAISANDIRFASDENVNHISCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFSSSLGYRHKFIYKSPQLPNILS 372          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Zebrafish
Match: AL953905.1 (pep chromosome:GRCz11:CHR_ALT_CTG17_1_12:21174970:21187708:-1 gene:ENSDARG00000116702.1 transcript:ENSDART00000193692.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL953905.1)

HSP 1 Score: 140.198 bits (352), Expect = 3.131e-36
Identity = 96/292 (32.88%), Postives = 152/292 (52.05%), Query Frame = 1
Query:  133 ITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYH----MLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXH----IIRYPELPNLIS 978
            +  F +LK+P        +  YL+ +       +G W  +      E   KD    E + K F +  P+I+Y HG    R ++  + L      +L + GYH++T DY+G+GDS GS + E  +  DA   YQ+ K+     PL++WGHSLGTG+++ L+++L   D     D LILESPFT+I E      F+  +RY+P F+  F  ++    I F+S EN+  ++ P++ILHAEDD ++ F++G+KLY            K     F     +    I + P+LPN++S
Sbjct:   65 VPYFIDLKRPQDQGMNHTHNFYLQPEEG---INIGVWHTVPAGMWREAQAKDA---EWYEKSFQSSHPVILYLHGNAGTRYTNTHLILIKPTNTVLSSLGYHVVTFDYRGWGDSEGSPS-ERGMTSDALFLYQWIKQRIGPKPLYIWGHSLGTGVATNLVRRL--CDRGTPPDALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDAISANDIRFASDENVNHISCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFSSSLGYRHKFIYKSPQLPNILS 347          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Zebrafish
Match: si:ch211-117n7.7 (si:ch211-117n7.7 [Source:ZFIN;Acc:ZDB-GENE-060503-569])

HSP 1 Score: 131.339 bits (329), Expect = 3.221e-33
Identity = 77/221 (34.84%), Postives = 117/221 (52.94%), Query Frame = 1
Query:  226 CELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHI---CFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLK 879
              +G W  + +      + K N E + K   +G PI +Y HG T +R + HR+ + ++L   GYH L +DY+GFGDS+G    E  L  DA   Y + KK + NS L VWGHSLG+G+++    KL  ++     DG+ILE  F S     D +    FTW +   PY        + +  + F + +NL+ +  PI+ILH+EDD I+   + Q++Y   K
Sbjct:   87 VRVGVWHTVPEHRWKEAQGK-NVEWYEKALGDGSPIFMYLHGNTGNRSAPHRIGVANILSALGYHALVMDYRGFGDSTGEPT-EPGLTTDALYLYNWIKKRSGNSLLCVWGHSLGSGVTTNTAVKL--LEQGKKFDGIILEGAFLSGRMAADQVFEHPFTWYYWKFPYIQYFLFNPMKNNNLDFPTDKNLEKIRSPIMILHSEDDHIVPMSVAQEIYRIAK 303          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Zebrafish
Match: si:ch211-117n7.6 (si:ch211-117n7.6 [Source:ZFIN;Acc:ZDB-GENE-060503-474])

HSP 1 Score: 125.176 bits (313), Expect = 4.377e-31
Identity = 75/220 (34.09%), Postives = 114/220 (51.82%), Query Frame = 1
Query:  226 CELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRY--MPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLK 879
              +G W  + +      + K N E + K   +G PI IY HG   +R + HR+ + ++L   GYH+L +DY+GFGDS+G    E  L  DA   Y + KK + NS + VWGHS+G+G+++ +  KL  ++     DG+ILE    S           + W Y   PY        L + KI F   ENL+ +  PI+ILH++DD +  F + Q++Y   K
Sbjct:   85 VRVGVWHTVPEHRWKEAQGK-NAEWYEKALGDGSPIFIYLHGNGGNRSALHRIGVANVLSALGYHVLVMDYRGFGDSTGEPT-EPGLTTDALYLYNWIKKRSGNSLVCVWGHSIGSGVTTNVAVKL--LEEGKKFDGIILEGAMLSGRAAAKQYGHPFSWFYWKFPYIQFFLFNPLKNNKIVFPLDENLEKIRTPILILHSKDDHVSPFSVAQEIYRIAK 300          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Zebrafish
Match: si:ch211-117n7.6 (si:ch211-117n7.6 [Source:ZFIN;Acc:ZDB-GENE-060503-474])

HSP 1 Score: 121.709 bits (304), Expect = 9.351e-30
Identity = 73/215 (33.95%), Postives = 112/215 (52.09%), Query Frame = 1
Query:  229 ELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHIC--FTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLY 867
             +G W  +  E         N E + K   +G PI IY HG   +R + HR+ + ++L   GYH+L +DY+GFGDS+G    E  L  DA   Y + KK + NS + VWGHS+G+G+++ +  KL  ++     DG+ILE    S           F+W +   PY        L + KI F   ENL+ +  PI+ILH++DD +  F + Q+++
Sbjct:   86 RVGVWHTV-PEHRWKEAQGKNAEWYEKALGDGSPIFIYLHGNGGNRSALHRIGVANVLSALGYHVLVMDYRGFGDSTGE-PTEPGLTTDALYLYNWIKKRSGNSLVCVWGHSIGSGVTTNVAVKL--LEEGKKFDGIILEGAMLSGRAAAKQYGHPFSWFYWKFPYIQFFLFNPLKNNKIVFPLDENLEKIRTPILILHSKDDHVSPFSVAQEVW 296          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Xenopus
Match: abhd12 (abhydrolase domain containing 12 [Source:NCBI gene;Acc:100216158])

HSP 1 Score: 152.525 bits (384), Expect = 9.232e-40
Identity = 89/258 (34.50%), Postives = 148/258 (57.36%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNK--EEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
             + + LN      F +LK+P+          YL+ + + S   +G W  +     +  KD   K  E + ++ S   P+I+Y HG    RG  HRV+LY +L + GYH+++ DY+G+GDS GS + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ +N+K ++ P++ILHAEDD ++ F +G+KLY+
Sbjct:  140 TQLVFLNLVRFPYFIDLKRPEDQGLNHTCNFYLQPEEDVS---IGVWHTV---PAVLWKDAQGKDLEWYEEVLSTSYPVILYLHGNAGTRGGDHRVQLYKVLSSMGYHVISFDYRGWGDSVGSPS-ESGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDSLILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITASGIKFANDDNVKYISCPLLILHAEDDPVIPFHLGKKLYN 388          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Xenopus
Match: ENSXETT00000040869.1 (loc683510 [Source:Xenbase;Acc:XB-GENE-920177])

HSP 1 Score: 135.191 bits (339), Expect = 2.962e-34
Identity = 87/264 (32.95%), Postives = 143/264 (54.17%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEI--ICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS-TLKSE 885
            AK + LN   +    +L+ P        N+ YL  ++  +   +G W    + + +E  +KD+   EE +   S+  P+IIY HG    R   HRV+L  +L  +G+H+L++DY+G+ DS+G    E  +  D+   Y++ K  +  +P+ +WGHSLG+G+++   +KL  +   A  D +ILESP+T+I E   +  F   +   P F   F  +     I F S EN+K++  PI+ILHAEDD ++   M +KL+   LKS+
Sbjct:   79 AKVVYLNILKVPFSVDLRNPKLILNHTTNF-YLTTEDGVT---VGVWHTLPVSRWEEAKHKDQAWYEEAL---SDVNPVIIYLHGNGGTRAVDHRVQLVKVLSAAGFHVLSLDYRGYADSTGEPT-ENGITTDSVYLYEWVKARSRGTPVCIWGHSLGSGVATNAARKLQEMGSAA--DVVILESPYTNIREAGAYHPFGSIYHNFPGFEYFFLDTFTLNNIVFPSDENVKLLTTPILILHAEDDTVVPSFMAKKLHDIALKSQ 332          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Xenopus
Match: abhd12 (abhydrolase domain containing 12 [Source:NCBI gene;Acc:100216158])

HSP 1 Score: 128.642 bits (322), Expect = 1.665e-32
Identity = 83/258 (32.17%), Postives = 142/258 (55.04%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNK--EEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
             + + LN      F +LK+P+          YL+ + + S   +G W  +     +  KD   K  E + ++ S   P+I+Y HG   + G+          R+ GYH+++ DY+G+GDS GS + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ +N+K ++ P++ILHAEDD ++ F +G+KLY+
Sbjct:   25 TQLVFLNLVRFPYFIDLKRPEDQGLNHTCNFYLQPEEDVS---IGVWHTV---PAVLWKDAQGKDLEWYEEVLSTSYPVILYLHG---NAGT----------RSMGYHVISFDYRGWGDSVGSPS-ESGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDSLILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITASGIKFANDDNVKYISCPLLILHAEDDPVIPFHLGKKLYN 260          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Xenopus
Match: abhd12 (abhydrolase domain containing 12 [Source:NCBI gene;Acc:100216158])

HSP 1 Score: 128.642 bits (322), Expect = 2.743e-32
Identity = 83/258 (32.17%), Postives = 142/258 (55.04%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNK--EEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
             + + LN      F +LK+P+          YL+ + + S   +G W  +     +  KD   K  E + ++ S   P+I+Y HG   + G+          R+ GYH+++ DY+G+GDS GS + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ +N+K ++ P++ILHAEDD ++ F +G+KLY+
Sbjct:   43 TQLVFLNLVRFPYFIDLKRPEDQGLNHTCNFYLQPEEDVS---IGVWHTV---PAVLWKDAQGKDLEWYEEVLSTSYPVILYLHG---NAGT----------RSMGYHVISFDYRGWGDSVGSPS-ESGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDSLILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITASGIKFANDDNVKYISCPLLILHAEDDPVIPFHLGKKLYN 278          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Xenopus
Match: abhd12 (abhydrolase domain containing 12 [Source:NCBI gene;Acc:100216158])

HSP 1 Score: 128.642 bits (322), Expect = 1.030e-31
Identity = 83/257 (32.30%), Postives = 142/257 (55.25%), Query Frame = 1
Query:  106 KCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNK--EEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            + + LN      F +LK+P+          YL+ + + S   +G W  +     +  KD   K  E + ++ S   P+I+Y HG   + G+          R+ GYH+++ DY+G+GDS GS + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ +N+K ++ P++ILHAEDD ++ F +G+KLY+
Sbjct:  126 QLVFLNLVRFPYFIDLKRPEDQGLNHTCNFYLQPEEDVS---IGVWHTV---PAVLWKDAQGKDLEWYEEVLSTSYPVILYLHG---NAGT----------RSMGYHVISFDYRGWGDSVGSPS-ESGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDSLILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITASGIKFANDDNVKYISCPLLILHAEDDPVIPFHLGKKLYN 360          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Mouse
Match: Abhd12 (abhydrolase domain containing 12 [Source:MGI Symbol;Acc:MGI:1923442])

HSP 1 Score: 154.836 bits (390), Expect = 4.776e-41
Identity = 93/258 (36.05%), Postives = 149/258 (57.75%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            AK I LN   +  F +LKKP           YL+ +++ +   +G W  I          KD++  E+ +   ++   II+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ EN+K ++ P++ILHAEDD ++ F +G+KLY+
Sbjct:   98 AKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEDDVT---IGVWHTIPSVWWKNAQGKDQMWYEDAL---ASNHAIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENMKHISCPLLILHAEDDPVVPFHLGRKLYN 346          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Mouse
Match: Abhd12b (abhydrolase domain containing 12B [Source:MGI Symbol;Acc:MGI:2685650])

HSP 1 Score: 130.183 bits (326), Expect = 2.336e-33
Identity = 71/190 (37.37%), Postives = 113/190 (59.47%), Query Frame = 1
Query:  313 FSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
             S+G PIIIY HG  ++R    R++L  +L + G+H+L+VDY+GFGDS+     EE L  D    Y++ K  +  +P+ +WGHSLGTG+ +    ++    GC  +D +ILE+PFT+I     +      +  +P     F  +L ++KI F + EN+K ++ P++ILH EDDR +  E G++LY   +S
Sbjct:   55 LSDGNPIIIYLHGSGINRAFCGRIKLTQVLSDGGFHVLSVDYRGFGDST-GTTTEEGLTTDIICVYEWTKARSGRTPVCLWGHSLGTGV-ATNAARVLEAKGC-PVDAIILEAPFTNIWAATINFPLVKMYWKLPGCLRTFVDALKEEKIVFPNDENVKFLSSPLLILHGEDDRTVPLEFGKQLYEIARS 241          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Mouse
Match: Abhd12b (abhydrolase domain containing 12B [Source:MGI Symbol;Acc:MGI:2685650])

HSP 1 Score: 131.724 bits (330), Expect = 3.623e-33
Identity = 86/259 (33.20%), Postives = 141/259 (54.44%), Query Frame = 1
Query:  112 ILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIIC--KEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
            I LN     +  +LK+P+       N+ +L+ +    K  LG W  +   + +E   K +   E  +   S+G PIIIY HG  ++R    R++L  +L + G+H+L+VDY+GFGDS+     EE L  D    Y++ K  +  +P+ +WGHSLGTG+ +    ++    GC  +D +ILE+PFT+I     +      +  +P     F  +L ++KI F + EN+K ++ P++ILH EDDR +  E G++LY   +S
Sbjct:   70 IYLNCITAPILVDLKRPETKIAHTVNF-FLKPE---PKVLLGIWHTVPSYRGEEAKGKCRCWYEASL---SDGNPIIIYLHGSGINRAFCGRIKLTQVLSDGGFHVLSVDYRGFGDST-GTTTEEGLTTDIICVYEWTKARSGRTPVCLWGHSLGTGV-ATNAARVLEAKGC-PVDAIILEAPFTNIWAATINFPLVKMYWKLPGCLRTFVDALKEEKIVFPNDENVKFLSSPLLILHGEDDRTVPLEFGKQLYEIARS 318          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Mouse
Match: Abhd12 (abhydrolase domain containing 12 [Source:MGI Symbol;Acc:MGI:1923442])

HSP 1 Score: 107.457 bits (267), Expect = 3.025e-25
Identity = 69/192 (35.94%), Postives = 109/192 (56.77%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILE 672
            AK I LN   +  F +LKKP           YL+ +++ +   +G W  I          KD++  E+ +   ++   II+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E
Sbjct:   98 AKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEDDVT---IGVWHTIPSVWWKNAQGKDQMWYEDAL---ASNHAIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIRE 280          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Mouse
Match: Abhd13 (abhydrolase domain containing 13 [Source:MGI Symbol;Acc:MGI:1916154])

HSP 1 Score: 54.6842 bits (130), Expect = 1.539e-7
Identity = 48/182 (26.37%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  328 PIIIYFHGITMHRGSSHRV-ELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLE-DAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLY 867
            P IIYFHG   + G  HR+     ML N   +++ VDY+G+G S G  ++E   L+ +A + Y   +     + +F++G SLG  ++  L       +    I  +++E+ F SI      +   +P RY+P + C         K  F S   +    +P + +    D+++   M ++LY
Sbjct:  115 PTIIYFHGNAGNIG--HRLPNALLMLVNLRVNLVLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKVFLFGRSLGGAVAIHLAS-----ENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLW-C--------YKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLY 280          
BLAST of Abhydrolase domain containing 12 vs. UniProt/SwissProt
Match: sp|Q08C93|ABD12_DANRE (Lysophosphatidylserine lipase ABHD12 OS=Danio rerio OX=7955 GN=abhd12 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.817e-45
Identity = 105/298 (35.23%), Postives = 160/298 (53.69%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXH----IIRYPELPNLIS 978
            AK + LN   +  F +LK+P        +  YL+ +       +G W  +      E   KD    E + K F +  P+I+Y HG    RG  HRV+LY +L + GYH++T DY+G+GDS GS + E  +  DA   YQ+ K+     PL++WGHSLGTG+++ L+++L   D     D LILESPFT+I E      F+  +RY+P F+  F  ++    I F+S EN+  ++ P++ILHAEDD ++ F++G+KLY            K     F     +    I + P+LPN++S
Sbjct:   84 AKLVFLNFVRVPYFIDLKRPQDQGMNHTHNFYLQPEEG---INIGVWHTVPAGMWREAQAKDA---EWYEKSFQSSHPVILYLHGNAGTRGGDHRVQLYKVLSSLGYHVVTFDYRGWGDSEGSPS-ERGMTSDALFLYQWIKQRIGPKPLYIWGHSLGTGVATNLVRRL--CDRGTPPDALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDAISANDIRFASDENVNHISCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFSSSLGYRHKFIYKSPQLPNILS 372          
BLAST of Abhydrolase domain containing 12 vs. UniProt/SwissProt
Match: sp|Q8N2K0|ABD12_HUMAN (Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12 PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 8.053e-42
Identity = 94/258 (36.43%), Postives = 150/258 (58.14%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            AK I LN   +  F +LKKP           YL+ + + +   +G W  +          KD++  E+ +   ++  PII+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ EN+K ++ P++ILHAEDD ++ F++G+KLYS
Sbjct:   98 AKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVT---IGVWHTVPAVWWKNAQGKDQMWYEDAL---ASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYS 346          
BLAST of Abhydrolase domain containing 12 vs. UniProt/SwissProt
Match: sp|Q6AYT7|ABD12_RAT (Lysophosphatidylserine lipase ABHD12 OS=Rattus norvegicus OX=10116 GN=Abhd12 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.390e-41
Identity = 94/258 (36.43%), Postives = 150/258 (58.14%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            AK I LN   +  F +LKKP           YL+ +++ +   +G W  I          KD++  E+ +   ++  PII+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ EN+K ++ P++ILHAEDD ++ F +G+KLY+
Sbjct:   98 AKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEDDVT---IGVWHTIPSVWWKNAQGKDQMWYEDAL---ASNHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENMKHISCPLLILHAEDDPVVPFHLGRKLYN 346          
BLAST of Abhydrolase domain containing 12 vs. UniProt/SwissProt
Match: sp|Q4R766|ABD12_MACFA (Lysophosphatidylserine lipase ABHD12 OS=Macaca fascicularis OX=9541 GN=ABHD12 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.464e-40
Identity = 93/258 (36.05%), Postives = 149/258 (57.75%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            AK I LN   +  F +LKKP           YL+ + + +   +G W  +          KD++  E+ +   ++   II+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ EN+K ++ P++ILHAEDD ++ F++G+KLYS
Sbjct:   98 AKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVT---IGVWHTVPAVWWKNAQGKDQMWYEDAL---ASSHAIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYS 346          
BLAST of Abhydrolase domain containing 12 vs. UniProt/SwissProt
Match: sp|Q99LR1|ABD12_MOUSE (Lysophosphatidylserine lipase ABHD12 OS=Mus musculus OX=10090 GN=Abhd12 PE=1 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 3.341e-40
Identity = 93/258 (36.05%), Postives = 149/258 (57.75%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            AK I LN   +  F +LKKP           YL+ +++ +   +G W  I          KD++  E+ +   ++   II+Y HG    RG  HRVELY +L + GYH++T DY+G+GDS G+ + E  +  DA   + + K  + ++P+++WGHSLGTG+++ L+++L   +     D LILESPFT+I E      F+  +RY P F+  F   +    I F++ EN+K ++ P++ILHAEDD ++ F +G+KLY+
Sbjct:   98 AKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEDDVT---IGVWHTIPSVWWKNAQGKDQMWYEDAL---ASNHAIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPS-ERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE--TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENMKHISCPLLILHAEDDPVVPFHLGRKLYN 346          
BLAST of Abhydrolase domain containing 12 vs. TrEMBL
Match: A0A3N0XW55 (Monoacylglycerol lipase ABHD12 (Fragment) OS=Anabarilius grahami OX=495550 GN=DPX16_15460 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.400e-44
Identity = 109/298 (36.58%), Postives = 161/298 (54.03%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXH----IIRYPELPNLIS 978
            AK + LN   +  F +LK+P        +  YL+ +       +G W  +      E   KD    E + K F +  P+I+Y HG    RG  HRV+LY +L + GYH++T DY+G+GDS GS + E+ +  DA   YQ+ K+     PL +WGHSLGTG+S+ L+++L   D     D LILESPFT+I E      F+  +RY+P F+  F  S+    I FSS EN+K ++ P++ILHAEDD ++ F++G+KLY            K     F     +    I + P+LPN++S
Sbjct:   33 AKLVFLNFVRVPYFIDLKRPQDQGLNHTHNFYLQPEEG---INIGVWHTVPAAMWREAQAKDA---EWYEKSFQSSHPVILYLHGNAGTRGGDHRVQLYKVLSSLGYHVVTFDYRGWGDSEGSPS-EKGMTSDALFLYQWIKQRIGQKPLHIWGHSLGTGVSTNLVRRL--CDRGTPPDSLILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDSITANDIRFSSDENVKHISCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFPSSLGYRHKFIYKSPQLPNILS 321          
BLAST of Abhydrolase domain containing 12 vs. TrEMBL
Match: C3XR79 (Hydrolase_4 domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_210539 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 6.993e-44
Identity = 89/218 (40.83%), Postives = 133/218 (61.01%), Query Frame = 1
Query:  229 ELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHML-RNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLK 879
            +LG W I+   + I   +K ++  F +  S   P+++Y HG +  RG SHRV+LY ++     YH+++ DY+G+GDS+GS   EE + EDA V + + KK   NSP+F+WGHSLGTG++S + +KL     C +  G++LE+PFTS  E      F  PWRY+P F+  F   L    I F S +++  +  P++ILHAEDD I+ F +G+KLY   K
Sbjct:   32 QLGVWHIL-PANLIQKVEKKDEASFNQALSQSNPVVLYLHGNSNTRGGSHRVDLYKVIFAGLNYHVVSFDYRGYGDSTGSPT-EEGICEDALVVHSWVKKHTGNSPVFLWGHSLGTGVTSKITRKLCEEGNCPA--GVVLEAPFTSTREECSGHPFAQPWRYLPGFDWFFTDGLEANNIYFESDKHVAAITCPLLILHAEDDFIVPFRLGKKLYEIAK 245          
BLAST of Abhydrolase domain containing 12 vs. TrEMBL
Match: A0A3Q2YNE8 (Abhydrolase domain containing 12 OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.622e-43
Identity = 96/259 (37.07%), Postives = 147/259 (56.76%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLK 879
            AK + LN   +  F +LK+P           YL+ +    K  +G W  +   D        ++E F    S+  P I+Y HG T  RG  HRVELY +L +SGYH++T DY+G+GDS GS + E  +  DA   YQ+ K+      +++WGHSLGTG+++ L+++L   DG +  D LILESPFT+I E      F   +RY+P F+  F  ++    I F++ +N+  ++ P++ILHAEDD ++ F +G++LY   K
Sbjct:   79 AKLVFLNFVRVPFFLDLKRPSDVGLDHTLNFYLQPQQ---KLRIGVWHTV-PADIWREAGGQSQEWFESTLSSAHPAILYLHGNTGTRGGDHRVELYKVLSSSGYHVVTFDYRGWGDSDGSPS-EGGMTADALFVYQWLKERRGQGRVYIWGHSLGTGVATNLVRRL--CDGGSPPDALILESPFTNIREEARSHPFATVYRYLPGFDWFFLDAITANDIRFANDDNVNHISCPVLILHAEDDHVVPFHLGKQLYEVAK 330          
BLAST of Abhydrolase domain containing 12 vs. TrEMBL
Match: A0A3S1HTN8 (AB hydrolase-1 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_006341 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.645e-43
Identity = 92/247 (37.25%), Postives = 154/247 (62.35%), Query Frame = 1
Query:  142 FTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
            F NL  P  F        +L ++++     +GAW ++ K      +  +  + F K   NG+ + +Y HG +  RGS HRV+LY +L +  +H++T+DY+G+GDSSG+ + EE +++D++  Y++ K+   ++ +F+WGHSLGTG+++ L K L N     +  G++LESPF ++++   H  F+ P+R +P+F+ IF +SL +Q I F S E++  V   I+ILHAEDD I+ F++GQKLY   K+
Sbjct:   82 FVNLSSPADFGLVNARHFFLDVEDD---VRIGAWHVLPKSMH-EERGLVPLDSFEKELKNGKKVFLYLHGNSGTRGSHHRVQLYKLLASLDFHVITIDYRGYGDSSGTPS-EEGVVKDSYFIYKWLKQRIGDTKIFLWGHSLGTGVTTKLAKILCNEGDHPA--GIVLESPFNNMIDAATHHPFSLPFRMLPWFDWIFLKSLGEQGIYFKSDESILSVTPHIMILHAEDDLIVPFDLGQKLYLKAKA 321          
BLAST of Abhydrolase domain containing 12 vs. TrEMBL
Match: A0A3Q3J5K7 (Abhydrolase domain containing 12 OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.632e-42
Identity = 103/296 (34.80%), Postives = 162/296 (54.73%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXH----IIRYPELPNLIS 978
            AK + LN   +  F +LK+P        +  YL+ +  +   ++G W  +  +     + K   + +  +F +  P+I+Y HG    RG  HRV+LY +L + GYH++T DY+G+GDS GS + E  +  DA   Y + KK    +PL++WGHSLGTG+++ L+++L   D  +    LILESPFT+I E      F+  +RY+P F+  F  ++    I F+S EN+  ++ P++ILHAEDD ++ F +GQKLY+           K     F     +    I R PELPN++S
Sbjct:   88 AKLVFLNFVRMPYFIDLKRPLDQGLNHTHNFYLQPEAGF---KIGVWHTVPAQMWREAQGK-QGDWYDSMFLSAHPVILYLHGNAGTRGGDHRVQLYKVLSSLGYHVVTFDYRGWGDSDGSPS-EGAMTSDALFIYDWLKKQLDKTPLYIWGHSLGTGVATNLVRRL--CDRGSPPHALILESPFTNIREEARSHPFSMVYRYLPGFDWFFLDAITANNIRFASDENVNHISCPVLILHAEDDSVVPFHLGQKLYNLASQSKSLSGHKVRFVPFPSSLAYKHKFIYRSPELPNILS 376          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Cavefish
Match: abhd12 (abhydrolase domain containing 12 [Source:NCBI gene;Acc:767657])

HSP 1 Score: 160.614 bits (405), Expect = 1.258e-42
Identity = 93/258 (36.05%), Postives = 145/258 (56.20%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYS 870
            AK + LN   +  F +LK+P           YL+ +       +G W  +      E   KD    E F K   + +P+++Y HG    RG  HRV+LY +L + GYH++T DY+G+GDS GS + E  + +DA   YQ+ K+      L++WGHSLGTG+++ L+++L   D     D +ILESPFT+I E      F+  +RY+P F+  F  ++    I F+S EN+  ++ P++ILHAEDD ++   +G+KLY+
Sbjct:  169 AKLVFLNFVRVPYFIDLKRPQDQGLNHTRNFYLQPEEG---VNIGVWHTVPAVLWKEAQGKDG---EWFEKSLQSTQPVMLYLHGNAGTRGGDHRVQLYKVLSSLGYHVVTFDYRGWGDSEGSPS-ERGMTQDALHLYQWLKQRIGRKSLYIWGHSLGTGVATNLVRRL--CDRGTPPDAVILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDAITANDIRFASDENVNHISCPVLILHAEDDAVVPLHLGKKLYN 417          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Cavefish
Match: ENSAMXT00000041282.1 (monoacylglycerol lipase ABHD12-like [Source:NCBI gene;Acc:103035174])

HSP 1 Score: 143.665 bits (361), Expect = 1.458e-37
Identity = 84/221 (38.01%), Postives = 126/221 (57.01%), Query Frame = 1
Query:  232 LGAWEIIC--KEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSIL--ETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
            LG W  +   K  E   KD    E + K   +G P+ IY HG T +R + HR+ + ++L + GYH + +DY+GFGDS G    E  L  DA   Y + K    +SPL +WGHSLGTG+++ L  KL   +    +DG+ILE  F S+   E   H  FTW +   PY    F+ S+ + K++F S ENLK +  P++ILH++DD ++ + + ++LYS  K+
Sbjct:  101 LGVWHTVPEHKWKEAQGKDL---EWYEKSLGDGSPVFIYLHGNTNNRAAPHRIGVANILSSLGYHAVVMDYRGFGDSIGEPT-EPGLTTDALYLYNWVKARCKDSPLVIWGHSLGTGVATNLAVKLQ--EQGKPVDGVILEGAFNSLRLPEGFPH-AFTWYYWKFPYIQFFFQDSMKNNKLSFPSAENLKKMTTPLLILHSKDDHLVPYWVAEELYSIAKT 314          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Cavefish
Match: ENSAMXT00000031554.1 (monoacylglycerol lipase ABHD12-like [Source:NCBI gene;Acc:103035683])

HSP 1 Score: 126.331 bits (316), Expect = 1.758e-31
Identity = 75/219 (34.25%), Postives = 119/219 (54.34%), Query Frame = 1
Query:  232 LGAWEIIC--KEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
            LG W  +   K  E   KD    E + K   +G P+ IY H    +R + HR+ + ++L + GYH + +DY+GFGDS+G    E  L+ D+   Y + K  + +S + +WGHS+GT +++    KL      A  DG+++E  FT  +       FTW +   P++   F     + K   S+ +NLK +  P++ILH+EDD+++ F M Q+LYST KS
Sbjct:  101 LGVWHTVPEHKWKEAQGKDL---EWYEKSLGDGSPVFIYLHANMHNRAAPHRIGVANLLSSLGYHAVVMDYRGFGDSTGEPT-ENGLITDSLYLYHWVKVRSKDSLVIIWGHSIGTLVATNTAVKLQEQGNPA--DGVMIEGAFTDAINEKYGPPFTWFYLKFPWY--FFSAPPKESKRAESNADNLKKMRTPLLILHSEDDQVVPFTMAQELYSTAKS 311          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Cavefish
Match: ENSAMXT00000021496.2 (monoacylglycerol lipase ABHD12-like [Source:NCBI gene;Acc:103035683])

HSP 1 Score: 126.331 bits (316), Expect = 2.073e-31
Identity = 75/219 (34.25%), Postives = 119/219 (54.34%), Query Frame = 1
Query:  232 LGAWEIIC--KEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
            LG W  +   K  E   KD    E + K   +G P+ IY H    +R + HR+ + ++L + GYH + +DY+GFGDS+G    E  L+ D+   Y + K  + +S + +WGHS+GT +++    KL      A  DG+++E  FT  +       FTW +   P++   F     + K   S+ +NLK +  P++ILH+EDD+++ F M Q+LYST KS
Sbjct:  101 LGVWHTVPEHKWKEAQGKDL---EWYEKSLGDGSPVFIYLHANMHNRAAPHRIGVANLLSSLGYHAVVMDYRGFGDSTGEPT-ENGLITDSLYLYHWVKVRSKDSLVIIWGHSIGTLVATNTAVKLQEQGNPA--DGVMIEGAFTDAINEKYGPPFTWFYLKFPWY--FFSAPPKESKRAESNADNLKKMRTPLLILHSEDDQVVPFTMAQELYSTAKS 311          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Cavefish
Match: abhd13 (abhydrolase domain containing 13 [Source:NCBI gene;Acc:103037823])

HSP 1 Score: 53.5286 bits (127), Expect = 3.073e-7
Identity = 49/183 (26.78%), Postives = 86/183 (46.99%), Query Frame = 1
Query:  328 PIIIYFHGITMHRGSSHRV-ELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQY--AKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLY 867
            P I+YFHG   + G  HRV     ML N   +++ VDY+G+G S G    EE L +DA  T  Y  ++     + + ++G SLG  ++  L     +      +  +++E+ F SI      +   +P RY+P + C         K  F S  ++ +  +P + +    D+++   M ++LY
Sbjct:  115 PTILYFHGNAGNIG--HRVPNALLMLVNLKANVVLVDYRGYGKSDGE-PSEEGLYQDAEATLDYIMSRPDIDKTKMVLFGRSLGGAVAIRLASVNPH-----RVAAIMVENTFLSIPHMAATLFSFFPMRYLPLW-CY--------KNKFLSYRHVALCRMPSLFISGLSDQLIPPVMMKQLY 280          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005892.1 (pep scaffold:Pmarinus_7.0:GL476342:292888:300705:-1 gene:ENSPMAG00000005303.1 transcript:ENSPMAT00000005892.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 1.216e-45
Identity = 95/262 (36.26%), Postives = 143/262 (54.58%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKED--EINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKS 882
            AK + LN   +  F  L  P          +YL  +       LG W  +      E   KD+   + +     NG P+ +YFHG    RG  HRVELY +L  SG+H++T+DY+G+GDS+G+   EE +  DA   Y++A++ A   P+++WGHSLGTG+++ + +KL   +  A    +ILE+PFT+I E  D       ++  P F+  F  S+ D  + F+S EN   +N P++ILHAEDD I+ F +G+KLY    S
Sbjct:   30 AKIVFLNFIRVPFFIELHDPLSLGLNHTTNQYLTPEPG---VRLGVWHTVPASQWKEAEGKDQ---QWYDAALGNGAPVFVYFHGNAGTRGGHHRVELYKVLSASGFHVVTLDYRGWGDSTGTPT-EEGITADAIFVYKWAQQRA-AGPVYIWGHSLGTGVATNVGRKL--CEQGAPPGAVILEAPFTNIREEADSHPLAQIYKIFPAFDWFFLDSITDSGVRFASDENASELNCPLLILHAEDDHIVPFHLGKKLYDIAAS 281          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Nematostella
Match: EDO48697 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF7])

HSP 1 Score: 128.642 bits (322), Expect = 1.433e-34
Identity = 66/184 (35.87%), Postives = 114/184 (61.96%), Query Frame = 1
Query:  313 FSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILET-MDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQK 861
              +G+PI +Y HG   +R   HRV LY +L    +H++T DY+GF DS G  + EE L+ED    +++ K+ +  +P+++WGHSLG+G+++ + ++L+ +   A   GLILE+ F S+ +  +DH     P++++PYF+ +  +S    K  F + + L  VN P+++LH  DD I+ F+ G+K
Sbjct:    1 LGDGQPIFLYLHGNAFNRAEPHRVALYQVLSKLSFHVVTFDYRGFADSEGHPS-EEGLIEDGLTVWKWIKRRSKKAPVYIWGHSLGSGVATGVAERLTQMR--APPKGLILEAAFNSVYDAGLDH-SLAKPFKFLPYFHEVVMESF---KGVFETDKRLGNVNCPVLMLHDHDDDIIPFKYGKK 177          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Medaka
Match: abhd12 (abhydrolase domain containing 12 [Source:NCBI gene;Acc:101170699])

HSP 1 Score: 166.392 bits (420), Expect = 1.476e-45
Identity = 106/299 (35.45%), Postives = 161/299 (53.85%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKE--DEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKK-VAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXH----IIRYPELPNLIS 978
            AK + LN   +  F +LK+P        +  YL  +   S  + G W  +  +   E   KD      ++  FS+  P+I+Y HG    RG  HRV+LY +L + GYH++T DY+G+GDS GS + E  +  DA   Y + K+ +    PL++WGHSLGTG+++ L+++L   D     D LILESPFT+I E      F+  +RY+P F+  F  ++    I F+S EN+  ++ P++ILHAEDD ++ F +G+KLYS           K     F     +    I R PELP+++S
Sbjct:   75 AKLVFLNFVRVPFFIDLKRPQDHGLNHTHNFYLEPE---SGLKAGVWHTVPAQMWREAQGKDG---NWYLSTFSSSNPVILYLHGNAGTRGGDHRVQLYKVLSSLGYHVVTFDYRGWGDSEGSPS-EGGMTSDALFVYDWLKQQIGKTKPLYIWGHSLGTGVATNLVRRL--CDRGNPPDALILESPFTNIREEAKCHPFSMVYRYLPGFDWFFLDAITANNIRFASDENVNHISCPMLILHAEDDTVVPFYLGKKLYSMASRSQSLTGHKVQFVPFPASLGYKHKFIYRSPELPSILS 364          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Medaka
Match: ENSORLT00000035678.1 (abhydrolase domain containing 12B [Source:NCBI gene;Acc:101159055])

HSP 1 Score: 147.132 bits (370), Expect = 4.285e-39
Identity = 74/189 (39.15%), Postives = 117/189 (61.90%), Query Frame = 1
Query:  301 FMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLY 867
            + +   +G+P+IIY HG    R   HRVEL  +L  +G+H+L++DY+GFGDSSG  + E  L  DA    Q+AK  +  SP+ +WGHSLG+G+++    +L   +G A++D LILE+P+T I +   ++  T  + ++P         L   +I F++ +NLK +  P++ILHAEDD ++   MGQ+LY
Sbjct:   88 YQEALGDGQPVIIYLHGNVGTRALRHRVELVTLLSAAGFHVLSLDYRGFGDSSGHPS-EAGLTSDALYLQQWAKTRSGGSPVCLWGHSLGSGVATNAAVRLQ--EGEAAVDALILEAPYTRIGDVAANLLLTKIYTFLPGLKDFLFDLLEKNQIEFANDKNLKTLTCPLLILHAEDDNVVPHRMGQQLY 273          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Medaka
Match: si:ch211-117n7.7 (monoacylglycerol lipase ABHD12 [Source:NCBI gene;Acc:101159289])

HSP 1 Score: 133.65 bits (335), Expect = 3.834e-34
Identity = 91/288 (31.60%), Postives = 142/288 (49.31%), Query Frame = 1
Query:  133 ITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIIC--KEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNC---IFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXH--IIRYPELPNLI 975
            +  F +L +P  F        YL  +   S   LG W  +   +  E   KD    +  ++   +G P+ IYFHG T  R + HRV +  +L   GYH+L  DY+GFGDS+G    E  L  DA   Y + K  + +S + +WGHSLGTG+++    KL  +D     DG+ILE  F S  + + +  FTW +  +P       +F + L    I F S +NLK +  PI+ LH+EDD ++  E+ ++ Y    +   +   +  +     G+ H  + R P+LP +I
Sbjct:   54 VPFFVDLSRPADFSLNHTINMYLTTEEGIS---LGVWHTVPAHRLGEAQGKDLAWYQNSLR---DGSPVFIYFHGNTGTRAAVHRVGVAKLLSALGYHVLVPDYRGFGDSTGE-PTESGLTTDATYLYNWVKARSGDSLVVIWGHSLGTGVTTNTAVKL--LDQGVVFDGVILEGAFNSQRQQIPYDPFTWYYCRLPSLESLCYLFAKPLAKDTIMFPSEQNLKKMKSPILFLHSEDDHLVPIEIARQTYEVAANAQSSNRVRLVTFDGSLGYLHNGLYRDPKLPGII 332          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Medaka
Match: si:ch211-117n7.7 (monoacylglycerol lipase ABHD12 [Source:NCBI gene;Acc:101159289])

HSP 1 Score: 134.035 bits (336), Expect = 4.496e-34
Identity = 91/288 (31.60%), Postives = 142/288 (49.31%), Query Frame = 1
Query:  133 ITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIIC--KEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNC---IFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXH--IIRYPELPNLI 975
            +  F +L +P  F        YL  +   S   LG W  +   +  E   KD    +  ++   +G P+ IYFHG T  R + HRV +  +L   GYH+L  DY+GFGDS+G    E  L  DA   Y + K  + +S + +WGHSLGTG+++    KL  +D     DG+ILE  F S  + + +  FTW +  +P       +F + L    I F S +NLK +  PI+ LH+EDD ++  E+ ++ Y    +   +   +  +     G+ H  + R P+LP +I
Sbjct:   70 VPFFVDLSRPADFSLNHTINMYLTTEEGIS---LGVWHTVPAHRLGEAQGKDLAWYQNSLR---DGSPVFIYFHGNTGTRAAVHRVGVAKLLSALGYHVLVPDYRGFGDSTGEPT-ESGLTTDATYLYNWVKARSGDSLVVIWGHSLGTGVTTNTAVKL--LDQGVVFDGVILEGAFNSQRQQIPYDPFTWYYCRLPSLESLCYLFAKPLAKDTIMFPSEQNLKKMKSPILFLHSEDDHLVPIEIARQTYEVAANAQSSNRVRLVTFDGSLGYLHNGLYRDPKLPGII 348          
BLAST of Abhydrolase domain containing 12 vs. Ensembl Medaka
Match: ENSORLT00000011241.2 (abhydrolase domain containing 12B [Source:NCBI gene;Acc:101159055])

HSP 1 Score: 101.293 bits (251), Expect = 4.145e-23
Identity = 62/190 (32.63%), Postives = 101/190 (53.16%), Query Frame = 1
Query:  301 FMKIFSNGRPIIIYFHGITMHRGSSHRVELY--HMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKL 864
            + +   +G+P+IIY HG    R     V L+   +L  +G+H+L++DY+GFGDSSG  + E  L  DA    Q+AK  +  SP+ +WGHSLG+G+++    +L    G     G        +  E +  I     + ++P         L   +I F++ +NLK +  P++ILHAEDD ++   MGQ++
Sbjct:   92 YQEALGDGQPVIIYLHGNVGTR----SVFLWDPQLLSAAGFHVLSLDYRGFGDSSGHPS-EAGLTSDALYLQQWAKTRSGGSPVCLWGHSLGSGVATNAAVRLQEGGGALLPSGCHGNRKDKTTKEKLFGI-----YTFLPGLKDFLFDLLEKNQIEFANDKNLKTLTCPLLILHAEDDNVVPHRMGQQV 271          
BLAST of Abhydrolase domain containing 12 vs. Planmine SMEST
Match: SMESG000046033.1 (SMESG000046033.1)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 291/291 (100.00%), Postives = 291/291 (100.00%), Query Frame = 1
Query:  103 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXHIIRYPELPNLI 975
            AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGISSLLLKKLSNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEGKNVFFKGFSSKFGYGHKHIIRYPELPNLI
Sbjct:   21 AKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGISSLLLKKLSNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEGKNVFFKGFSSKFGYGHKHIIRYPELPNLI 311          

HSP 2 Score: 49.2914 bits (116), Expect = 4.987e-6
Identity = 21/21 (100.00%), Postives = 21/21 (100.00%), Query Frame = 1
Query: 1468 EFTNGALTQKLSGHSMCLQCN 1530
            EFTNGALTQKLSGHSMCLQCN
Sbjct:  313 EFTNGALTQKLSGHSMCLQCN 333          
BLAST of Abhydrolase domain containing 12 vs. Planmine SMEST
Match: SMESG000015331.1 (SMESG000015331.1)

HSP 1 Score: 285.804 bits (730), Expect = 3.953e-92
Identity = 160/246 (65.04%), Postives = 202/246 (82.11%), Query Frame = 1
Query:  244 EIICKEDEINNKDK--LNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXHIIRYPELPNLI 975
            EI+ K DE N K+   L + EF + FSNG PII+Y HG +MHRGS+HR+ LYH+LR SG+HILT+DY+GF DSSGSI++E+E LEDAFV Y Y K  APNS +F+WGHSLGTGISSLLL+KLS ++ C++I G+ILESPFTSILETMDHI  TWPWR+MPYF+ IFK++L++QK+ F+SIENLK  N  I+ILHAEDD++L F+MG+KLYSTL S GK+V+FKGFSS   YGH +I+  PELP++I
Sbjct:    6 EILSKVDE-NRKESCSLKQIEFAEKFSNGNPIILYLHGNSMHRGSNHRLLLYHVLRESGFHILTIDYRGFADSSGSIHNEDEALEDAFVAYNYLKLTAPNSSIFLWGHSLGTGISSLLLQKLSKMNECSAISGVILESPFTSILETMDHIGLTWPWRFMPYFDRIFKKALLNQKLAFNSIENLKETNNIILILHAEDDKVLSFKMGKKLYSTLLSAGKDVYFKGFSSNLKYGHDYIVNCPELPDII 250          
BLAST of Abhydrolase domain containing 12 vs. Planmine SMEST
Match: SMESG000015331.1 (SMESG000015331.1)

HSP 1 Score: 285.804 bits (730), Expect = 1.147e-91
Identity = 160/246 (65.04%), Postives = 202/246 (82.11%), Query Frame = 1
Query:  244 EIICKEDEINNKDK--LNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXHIIRYPELPNLI 975
            EI+ K DE N K+   L + EF + FSNG PII+Y HG +MHRGS+HR+ LYH+LR SG+HILT+DY+GF DSSGSI++E+E LEDAFV Y Y K  APNS +F+WGHSLGTGISSLLL+KLS ++ C++I G+ILESPFTSILETMDHI  TWPWR+MPYF+ IFK++L++QK+ F+SIENLK  N  I+ILHAEDD++L F+MG+KLYSTL S GK+V+FKGFSS   YGH +I+  PELP++I
Sbjct:   38 EILSKVDE-NRKESCSLKQIEFAEKFSNGNPIILYLHGNSMHRGSNHRLLLYHVLRESGFHILTIDYRGFADSSGSIHNEDEALEDAFVAYNYLKLTAPNSSIFLWGHSLGTGISSLLLQKLSKMNECSAISGVILESPFTSILETMDHIGLTWPWRFMPYFDRIFKKALLNQKLAFNSIENLKETNNIILILHAEDDKVLSFKMGKKLYSTLLSAGKDVYFKGFSSNLKYGHDYIVNCPELPDII 282          
BLAST of Abhydrolase domain containing 12 vs. Planmine SMEST
Match: SMESG000046035.1 (SMESG000046035.1)

HSP 1 Score: 207.223 bits (526), Expect = 4.333e-62
Identity = 104/230 (45.22%), Postives = 151/230 (65.65%), Query Frame = 1
Query:  187 NWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTL 876
            N R  RI+N     ELGAW+IIC +DE      LNK EF  IF+N RPI++                        G+H+LT+DY+G+GDS G++ +E + LED F+T++Y   +APNS +FVWGHSLGTGISS+ + KL+++    ++  L+LE+PFTSI + M++  +   WR M YFN +F+QS I+QK+TF+S +NL     PI+I+HAEDD+++  EMGQ+LYS++
Sbjct:    3 NLRNFRIRNTNYNYELGAWQIICIDDETPGYVPLNKAEFETIFANNRPILL----------------------KIGFHVLTIDYRGYGDSPGTLQNENDALEDTFITFKYLMSIAPNSSVFVWGHSLGTGISSIFVNKLASLGLKYNVMALVLEAPFTSIPDFMNYTPYLGLWRIMFYFNLVFQQSAINQKLTFNSTKNLATFFAPILIMHAEDDQVISVEMGQQLYSSI 210          
BLAST of Abhydrolase domain containing 12 vs. Planmine SMEST
Match: SMESG000018264.1 (SMESG000018264.1)

HSP 1 Score: 205.682 bits (522), Expect = 2.796e-61
Identity = 121/275 (44.00%), Postives = 167/275 (60.73%), Query Frame = 1
Query:  151 LKKPDYFKFTKGNWRYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIYFHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLEDAFVTYQYAKKVAPNSPLFVWGHSLGTGIXXXXXXXXXNIDGCASIDGLILESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKVVNVPIIILHAEDDRILKFEMGQKLYSTLKSEXXXXXXXXXXXXXXXXXXHIIRYPELPNLI 975
            LK P+ F+F   N+R  RIKN     EL AW+IICK+DE      LNK EF +IF+N RPI++YFHG    RG+ +RV+ YH+LR +G+H+L VDY+GFG+S G++  E++ LEDAF+T++Y  K+APNS +FVWGHSLGTGISSL                L ++S    +  T   +                       K+TF++ +NL+    PI+I+HAE+D ++ F MGQ+LYS+L  + K+VFFK FS    +GH  I RY  LP LI
Sbjct:   15 LKYPENFRFNMRNFRNFRIKNAEYNYELSAWQIICKDDETPGYVPLNKTEFERIFANNRPILLYFHGNRGSRGAYYRVDFYHLLRKNGFHVLAVDYRGFGESDGTLETEDDALEDAFLTFRYLTKIAPNSSVFVWGHSLGTGISSL----------LVHKSSLYIDSRCPIVFSTFSVVA--------------------AHKLTFNNTKNLETFFAPILIMHAEEDNVVNFVMGQQLYSSLFDKKKDVFFKRFSYLLNFGHLRITRYYNLPKLI 259          
The following BLAST results are available for this feature:
BLAST of Abhydrolase domain containing 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABHD121.527e-4236.43abhydrolase domain containing 12 [Source:HGNC Symb... [more]
ABHD121.677e-4236.43abhydrolase domain containing 12 [Source:HGNC Symb... [more]
ABHD12B1.541e-4036.14abhydrolase domain containing 12B [Source:HGNC Sym... [more]
ABHD124.790e-4041.40abhydrolase domain containing 12 [Source:HGNC Symb... [more]
ABHD12B2.012e-3937.62abhydrolase domain containing 12B [Source:HGNC Sym... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
abhd-123.219e-3239.65ABHydrolase Domain containing homolog [Source:Uni... [more]
abhd-123.219e-3239.65ABHydrolase Domain containing homolog [Source:Uni... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG151114.671e-3334.21gene:FBgn0034419 transcript:FBtr0086581[more]
CG151119.026e-3334.21gene:FBgn0034419 transcript:FBtr0086580[more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd126.380e-4635.23abhydrolase domain containing 12 [Source:NCBI gene... [more]
AL953905.13.131e-3632.88pep chromosome:GRCz11:CHR_ALT_CTG17_1_12:21174970:... [more]
si:ch211-117n7.73.221e-3334.84si:ch211-117n7.7 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
si:ch211-117n7.64.377e-3134.09si:ch211-117n7.6 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
si:ch211-117n7.69.351e-3033.95si:ch211-117n7.6 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd129.232e-4034.50abhydrolase domain containing 12 [Source:NCBI gene... [more]
ENSXETT00000040869.12.962e-3432.95loc683510 [Source:Xenbase;Acc:XB-GENE-920177][more]
abhd121.665e-3232.17abhydrolase domain containing 12 [Source:NCBI gene... [more]
abhd122.743e-3232.17abhydrolase domain containing 12 [Source:NCBI gene... [more]
abhd121.030e-3132.30abhydrolase domain containing 12 [Source:NCBI gene... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abhd124.776e-4136.05abhydrolase domain containing 12 [Source:MGI Symbo... [more]
Abhd12b2.336e-3337.37abhydrolase domain containing 12B [Source:MGI Symb... [more]
Abhd12b3.623e-3333.20abhydrolase domain containing 12B [Source:MGI Symb... [more]
Abhd123.025e-2535.94abhydrolase domain containing 12 [Source:MGI Symbo... [more]
Abhd131.539e-726.37abhydrolase domain containing 13 [Source:MGI Symbo... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08C93|ABD12_DANRE4.817e-4535.23Lysophosphatidylserine lipase ABHD12 OS=Danio reri... [more]
sp|Q8N2K0|ABD12_HUMAN8.053e-4236.43Lysophosphatidylserine lipase ABHD12 OS=Homo sapie... [more]
sp|Q6AYT7|ABD12_RAT2.390e-4136.43Lysophosphatidylserine lipase ABHD12 OS=Rattus nor... [more]
sp|Q4R766|ABD12_MACFA1.464e-4036.05Lysophosphatidylserine lipase ABHD12 OS=Macaca fas... [more]
sp|Q99LR1|ABD12_MOUSE3.341e-4036.05Lysophosphatidylserine lipase ABHD12 OS=Mus muscul... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3N0XW552.400e-4436.58Monoacylglycerol lipase ABHD12 (Fragment) OS=Anaba... [more]
C3XR796.993e-4440.83Hydrolase_4 domain-containing protein (Fragment) O... [more]
A0A3Q2YNE81.622e-4337.07Abhydrolase domain containing 12 OS=Hippocampus co... [more]
A0A3S1HTN81.645e-4337.25AB hydrolase-1 domain-containing protein OS=Elysia... [more]
A0A3Q3J5K71.632e-4234.80Abhydrolase domain containing 12 OS=Monopterus alb... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd121.258e-4236.05abhydrolase domain containing 12 [Source:NCBI gene... [more]
ENSAMXT00000041282.11.458e-3738.01monoacylglycerol lipase ABHD12-like [Source:NCBI g... [more]
ENSAMXT00000031554.11.758e-3134.25monoacylglycerol lipase ABHD12-like [Source:NCBI g... [more]
ENSAMXT00000021496.22.073e-3134.25monoacylglycerol lipase ABHD12-like [Source:NCBI g... [more]
abhd133.073e-726.78abhydrolase domain containing 13 [Source:NCBI gene... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005892.11.216e-4536.26pep scaffold:Pmarinus_7.0:GL476342:292888:300705:-... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO486971.433e-3435.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd121.476e-4535.45abhydrolase domain containing 12 [Source:NCBI gene... [more]
ENSORLT00000035678.14.285e-3939.15abhydrolase domain containing 12B [Source:NCBI gen... [more]
si:ch211-117n7.73.834e-3431.60monoacylglycerol lipase ABHD12 [Source:NCBI gene;A... [more]
si:ch211-117n7.74.496e-3431.60monoacylglycerol lipase ABHD12 [Source:NCBI gene;A... [more]
ENSORLT00000011241.24.145e-2332.63abhydrolase domain containing 12B [Source:NCBI gen... [more]
back to top
BLAST of Abhydrolase domain containing 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046033.14.987e-6100.00SMESG000046033.1[more]
SMESG000015331.13.953e-9265.04SMESG000015331.1[more]
SMESG000015331.11.147e-9165.04SMESG000015331.1[more]
SMESG000046035.14.333e-6245.22SMESG000046035.1[more]
SMESG000018264.12.796e-6144.00SMESG000018264.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022282 ID=SMED30022282|Name=Abhydrolase domain containing 12|organism=Schmidtea mediterranea sexual|type=transcript|length=1858bp
TTGTTAGTATTGATTTTAATAACTAAAATATTTTAAAGATAAATGTTCAT
AACTATATATATTTTATTTCCATTAATCATCTACCTTTATCCTTGGATTT
TAGCGAAATGTATTTTACTCAATACAGCATTTATAACAGTGTTTACCAAC
TTGAAGAAGCCTGATTATTTTAAGTTTACTAAAGGAAATTGGCGTTATTT
ACGAATTAAGAATAATTATTCTAAATGCGAACTTGGAGCTTGGGAAATAA
TTTGTAAAGAAGATGAAATAAATAATAAAGACAAATTAAATAAGGAAGAA
TTTATGAAAATATTTTCAAATGGACGCCCAATTATAATATACTTTCATGG
TATAACAATGCATCGTGGTTCCAGCCACCGAGTTGAGCTTTATCACATGC
TTCGGAATTCCGGATATCATATTTTAACTGTGGATTACAAAGGATTTGGA
GATTCAAGTGGGTCTATTAATGACGAGGAGGAATTACTCGAAGATGCGTT
TGTTACTTATCAATATGCAAAAAAGGTTGCACCAAACAGTCCCTTATTCG
TATGGGGTCATTCACTTGGAACAGGAATTTCATCCCTTCTGCTAAAGAAA
TTATCAAATATAGATGGTTGTGCATCAATAGATGGTTTAATATTAGAGTC
ACCATTCACATCTATTTTAGAAACAATGGATCACATTTGTTTTACATGGC
CATGGAGATATATGCCATATTTTAATTGCATTTTTAAACAAAGTCTCATC
GATCAGAAAATAACATTTAGTTCAATAGAAAACTTGAAAGTTGTCAATGT
CCCTATTATAATATTACATGCTGAAGATGATCGGATTTTAAAATTTGAAA
TGGGACAAAAATTGTATTCTACTCTAAAATCTGAAGGGAAAAATGTATTT
TTTAAGGGATTTTCATCGAAGTTTGGATATGGTCACAAACATATCATTCG
GTATCCTGAATTGCCTAATTTGATAAGTTTCCATCGTTATTTCAATCCCC
CATGGCAGAGAAAAAACGATTGTCTGATGCATAGTATCGTAAACGACAGG
CTGAAAATTATAAAAACATAACAAAACAAAGATACTCGTTTTTAAGTATA
TATGTACACCGTACAGAGGCGAAGGTAGTATAGATGAGTTAAACAATCAA
GTCGAAGAAGACAAGGAAGCGGATGAATCCGATGAAATGACAGTATCAGA
AGAATTTGAACCACAAAAATGAAATGCACGATGTGCACCAAGAATACAAA
ATCTGAATTACATAAAATCGATAATTCCACTGGTTTATATTTTAACTATT
CTGCTACTTGGACCAAATTTGATGATCATATGCGACAAATTTTGATAGAA
CATGGACCAGAACAAGTCGAGCAGTTTGATTTTCCTAAAGAAAATTCTCG
AAAATGCATTACAATCGCAGGCTTGTCAATGGAGAAAACATTTGCAGAAA
TTGGCTGCAGTACTCTAGAATTTACTAATGGAGCATTGACACAGAAACTT
AGTGGTCATTCAATGTGCTTACAGTGTAATTAATTGGTCGTAAATGAGGA
TTAATTTATATTTCATTTACAATTGATGTTTTCATATATATTATTTTCAA
GATGAGATTTCAATTCCTTCCATTAATTGAGTTTGATGATCATAACTTTC
TTTTCTGATTTACCTTATTTTTATTATGATTATAATAACACAAAATGTCA
ATTATAATTATCGTTATTATTCATTTATTTTTTTGTGTTTTTCAACCAAT
GTTTTATCAGGGAATCTTGCAGATTCGCGAAATGATATCAGTAGTCTAAG
AATTTAGGTTTTTGAGTTTCTACAGGTTCAATTTTAATAATTAGCAAAAA
ACGCCTAC
back to top

protein sequence of SMED30022282-orf-1

>SMED30022282-orf-1 ID=SMED30022282-orf-1|Name=SMED30022282-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MKCTMCTKNTKSELHKIDNSTGLYFNYSATWTKFDDHMRQILIEHGPEQV
EQFDFPKENSRKCITIAGLSMEKTFAEIGCSTLEFTNGALTQKLSGHSMC
LQCN*
back to top

protein sequence of SMED30022282-orf-2

>SMED30022282-orf-2 ID=SMED30022282-orf-2|Name=SMED30022282-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MFITIYILFPLIIYLYPWILAKCILLNTAFITVFTNLKKPDYFKFTKGNW
RYLRIKNNYSKCELGAWEIICKEDEINNKDKLNKEEFMKIFSNGRPIIIY
FHGITMHRGSSHRVELYHMLRNSGYHILTVDYKGFGDSSGSINDEEELLE
DAFVTYQYAKKVAPNSPLFVWGHSLGTGISSLLLKKLSNIDGCASIDGLI
LESPFTSILETMDHICFTWPWRYMPYFNCIFKQSLIDQKITFSSIENLKV
VNVPIIILHAEDDRILKFEMGQKLYSTLKSEGKNVFFKGFSSKFGYGHKH
IIRYPELPNLISFHRYFNPPWQRKNDCLMHSIVNDRLKIIKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004622lysophospholipase activity
GO:0016787hydrolase activity
GO:0047372acylglycerol lipase activity
Vocabulary: biological process
TermDefinition
GO:0010842retina layer formation
GO:0036269swimming behavior
GO:0042552myelination
GO:0043010camera-type eye development
GO:0048899anterior lateral line development
GO:0048919posterior lateral line neuromast development
GO:0046464acylglycerol catabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR022742Hydrolase_4
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 83..290
e-value: 1.2E-28
score: 102.2
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 92..309
IPR022742Serine aminopeptidase, S33PFAMPF12146Hydrolase_4coord: 95..212
e-value: 1.5E-16
score: 60.4
NoneNo IPR availablePANTHERPTHR12277:SF69PROTEIN ABHD12Bcoord: 8..311
NoneNo IPR availablePANTHERPTHR12277UNCHARACTERIZEDcoord: 8..311
NoneNo IPR availableTMHMMTMhelixcoord: 12..34