Dynamin-type G domain-containing protein

Overview
NameDynamin-type G domain-containing protein
Smed IDSMED30022278
Length (bp)2015
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-type G domain-containing protein (SMED30022278) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30022278) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022278

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30022278SMESG000014762.1 SmedASXL_016543SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30022278SMESG000014762.1 SmedASXL_016543SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30022278SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022278SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022278SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022278SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022278SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022278SMESG000014762.1 Contig45482uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022278SMESG000014762.1 Contig45482newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30022278SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022278SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 99.3673 bits (246), Expect = 9.214e-22
Identity = 73/273 (26.74%), Postives = 134/273 (49.08%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKS----SKTAKKRFDEFTRFEYNLKKYIS 1039
            K  +I E ++R  +K+  FG+ S GKS ++NAML D    SG  H T+ F+ V+ ++ D +Y +     ++        +     +  D+K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + ++ + E C  FL ++L ++   E   RI+F+S+ E+   R +    + +S    ++    R  EF  FE   ++ IS
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECIS 329          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 101.293 bits (251), Expect = 1.779e-21
Identity = 71/274 (25.91%), Postives = 136/274 (49.64%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++               +++ +  + + +++  +  +K   A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ ++ + E C+ FL D L ++ + +  +RI+F+S+ E+   RI+    + +      + F     EF  FE   ++ IS
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHE-----AFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 101.293 bits (251), Expect = 1.779e-21
Identity = 71/274 (25.91%), Postives = 136/274 (49.64%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++               +++ +  + + +++  +  +K   A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ ++ + E C+ FL D L ++ + +  +RI+F+S+ E+   RI+    + +      + F     EF  FE   ++ IS
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHE-----AFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 99.3673 bits (246), Expect = 5.889e-21
Identity = 73/273 (26.74%), Postives = 134/273 (49.08%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKS----SKTAKKRFDEFTRFEYNLKKYIS 1039
            K  +I E ++R  +K+  FG+ S GKS ++NAML D    SG  H T+ F+ V+ ++ D +Y +     ++        +     +  D+K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + ++ + E C  FL ++L ++   E   RI+F+S+ E+   R +    + +S    ++    R  EF  FE   ++ IS
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECIS 329          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 99.3673 bits (246), Expect = 5.889e-21
Identity = 73/273 (26.74%), Postives = 134/273 (49.08%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKS----SKTAKKRFDEFTRFEYNLKKYIS 1039
            K  +I E ++R  +K+  FG+ S GKS ++NAML D    SG  H T+ F+ V+ ++ D +Y +     ++        +     +  D+K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + ++ + E C  FL ++L ++   E   RI+F+S+ E+   R +    + +S    ++    R  EF  FE   ++ IS
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECIS 329          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Match: fzo-1 (Transmembrane GTPase fzo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q23424])

HSP 1 Score: 91.2781 bits (225), Expect = 9.419e-19
Identity = 79/319 (24.76%), Postives = 142/319 (44.51%), Query Frame = 2
Query:  224 KLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKG--NKATANETIEVSICMDDETL---------------LKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKS--SKTAKKRFDEFTRFEYNLKKYISAPQ-----DNKTRRYTEEIKKLQTYL 1102
            +++ I    + I +   RD +K+  FG+ S GKS  +NAML +     G  HTT  F+ V+ SE +                 +  +  ++I   + G    A ++E  ++     D  L               L+  + I+D PG     +    I K+  +AD+F+ V N    LT  ++ FF       +KP+VFI+ N+WD S  + E    + K+ +       + +L++  + E+++RI+F+SS E+ + R++    + K+  ++    R  EF  FE + +  IS        +   RR  E I K++  L
Sbjct:   81 EIEAIGDSIKTIMDTFQRDNMKVVFFGRTSNGKSTTINAMLHEKVLPQGMGHTTCCFLQVEGSEGE-------------VGHLQLDDNPQKIDMKMLGKIGHALSDENSDLPAMGQDSLLKVFHPKKSESGECRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVSNAESTLTQAEKNFFLRVAKKLSKPNVFILNNRWDASAAETENIEDVKKQHLTRFRQFLVDELEVCSEREVNDRIFFVSSREVLESRLKARGLVQKAYQAEGHGTRALEFQNFERHFEHCISRSAIHTKFEAHNRRAHEMIGKMRLNL 386          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070910)

HSP 1 Score: 110.923 bits (276), Expect = 6.908e-25
Identity = 91/336 (27.08%), Postives = 165/336 (49.11%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIE----NDDSLIKSSKTAKKRFDEFTRFEYNLKKYIS-APQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKG 1225
            K   I E + RD +K+  FG+ S GKS ++NAML +    SG  HTT+ F  V+ S   ++Y +     ++           I++++  +   K   +  + +    +  +LL+  +  VD PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N+  E  +  K +  E C  FL ++L +  ++E +ER++F+S+ E  Q RIE    N   +   ++  + R+ EF  FE   ++ IS +    K ++++   K +      + K   +NI     Y  I+ +R L +D K+   E +++G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV------NIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEP-ECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECISQSAVKTKFQQHSSRGKSVS----GDMKSMLDNI-----YERITIFRNLKQDQKNLLTE-RIQG 443          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070909)

HSP 1 Score: 110.923 bits (276), Expect = 6.908e-25
Identity = 91/336 (27.08%), Postives = 165/336 (49.11%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIE----NDDSLIKSSKTAKKRFDEFTRFEYNLKKYIS-APQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKG 1225
            K   I E + RD +K+  FG+ S GKS ++NAML +    SG  HTT+ F  V+ S   ++Y +     ++           I++++  +   K   +  + +    +  +LL+  +  VD PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N+  E  +  K +  E C  FL ++L +  ++E +ER++F+S+ E  Q RIE    N   +   ++  + R+ EF  FE   ++ IS +    K ++++   K +      + K   +NI     Y  I+ +R L +D K+   E +++G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV------NIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEP-ECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECISQSAVKTKFQQHSSRGKSVS----GDMKSMLDNI-----YERITIFRNLKQDQKNLLTE-RIQG 443          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0343373)

HSP 1 Score: 110.538 bits (275), Expect = 1.077e-24
Identity = 92/339 (27.14%), Postives = 169/339 (49.85%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSE-DDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDE-ESTQMSKEKIN--EECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIE----NDDSLIKSSKTAKKRFDEFTRFEYNLKKYIS-APQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKG 1225
            K   I E + RD +K+  FG+ S GKS ++NAML +    SG  HTT+ F  V+ S   ++Y +     ++           I++++  +   K   +  + +    +  +LL+  +  VD PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N+ E + ++++K K    E C  FL ++L +  ++E +ER++F+S+ E  Q RIE    N   +   ++  + R+ EF  FE   ++ IS +    K ++++   K +      + K   +NI     Y  I+ +R L +D K+   E +++G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV------NIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECISQSAVKTKFQQHSSRGKSVS----GDMKSMLDNI-----YERITIFRNLKQDQKNLLTE-RIQG 447          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: fzo (gene:FBgn0011596 transcript:FBtr0084399)

HSP 1 Score: 109.768 bits (273), Expect = 1.462e-24
Identity = 73/273 (26.74%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFV-----------HVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMK-KEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFE 1015
            S+ E I + ++RD +K+  FG+ S GKS ++NA+L +    S   HTTS F            HVK  ++D +   +                + +++          +  ++V++  +  ++L   + ++D PG    +Q+ DC+     +AD+FI VLN    ++  +R FFK      ++P++FI+ N+WD++ + + E  Q  K++  E C   L D L +    +E  ERIY +S+ E    R   +  +   S   ++R+ EF RFE
Sbjct:   73 SRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHVKVEQEDEHMELSA---------------LSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR---NGQITNPSGQTQQRYQEFLRFE 327          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 97.8265 bits (242), Expect = 1.128e-21
Identity = 74/275 (26.91%), Postives = 141/275 (51.27%), Query Frame = 2
Query:  224 KLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKK----RFDEFTRFE 1015
            +LD IES   K  +I E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ +++D             +++ K I+ + +++  +  +++  A   ++V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S  + E    + K+   + C  FL ++L ++ + +   RI+F+S+ E+   R++    + ++     +    R  EF  FE
Sbjct:   54 QLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDED-----KAFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQH-TDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFE 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 100.523 bits (249), Expect = 1.561e-21
Identity = 76/283 (26.86%), Postives = 146/283 (51.59%), Query Frame = 2
Query:  224 KLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            +LD IES   K  +I E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ +++D             +++ K I+ + +++  +  +++  A   ++V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S  + E    + K+   + C  FL ++L ++ + +   RI+F+S+ E+   R++    + ++        + R  EF  FE + ++ IS
Sbjct:   54 QLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDK-----AFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQH-TDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFERSFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 100.523 bits (249), Expect = 1.561e-21
Identity = 76/283 (26.86%), Postives = 146/283 (51.59%), Query Frame = 2
Query:  224 KLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            +LD IES   K  +I E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ +++D             +++ K I+ + +++  +  +++  A   ++V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S  + E    + K+   + C  FL ++L ++ + +   RI+F+S+ E+   R++    + ++        + R  EF  FE + ++ IS
Sbjct:   54 QLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDK-----AFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQH-TDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFERSFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 100.138 bits (248), Expect = 2.197e-21
Identity = 73/274 (26.64%), Postives = 134/274 (48.91%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSE-DDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I E ++R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++ ++S+ +     +R        +        D+      A   + V        LL+  + +VD PG    +++   I K   +AD+F+ V N    L   ++ FF    +  + P++FI+ N+WD S N+ E   ++ ++ ++  C+ FL D L ++ +    +RI+F+S+ E+ Q R++    + ++     + F     EF  FE   ++ IS
Sbjct:   83 SKVAGIGEVLSRRHMKVVFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGTDGNESFLLTEGSDERKSVKTVNQLAHALHQDEDLD-----AGSLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASANEPEYMEEVRRQHMD-RCTSFLVDELRVVDRSHAGDRIFFVSAKEVLQARVQKAQGMPEAGGALAEGFQARMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 95.9005 bits (237), Expect = 4.963e-21
Identity = 74/271 (27.31%), Postives = 140/271 (51.66%), Query Frame = 2
Query:  224 KLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIE--NDDSLIKSSKTAKKRFDEFTR 1009
            +LD IES   K  +I E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ +++D             +++ K I+ + +++  +  +++  A   ++V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S  + E    + K+   + C  FL ++L ++ + +   RI+F+S+ E+   R++     +L +  +   K F  F R
Sbjct:   54 QLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDK-----AFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQH-TDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGGALAEGFQDRLKEFQNFER 318          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 101.679 bits (252), Expect = 1.207e-21
Identity = 75/274 (27.37%), Postives = 134/274 (48.91%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKK----RFDEFTRFEYNLKKYIS 1039
            +K   I E + R  +K+  FG+ S GKS ++N+ML D    SG  HTT+ F+ V+ +E D +Y +     ++        +     +  D+      A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K+ + E C  FL D L ++   E  +RI+F+S+ E+   R+     + ++     +    RF EF +FE   ++ IS
Sbjct:   81 TKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLG-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECIS 348          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 101.293 bits (251), Expect = 1.289e-21
Identity = 75/274 (27.37%), Postives = 134/274 (48.91%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKK----RFDEFTRFEYNLKKYIS 1039
            +K   I E + R  +K+  FG+ S GKS ++N+ML D    SG  HTT+ F+ V+ +E D +Y +     ++        +     +  D+      A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K+ + E C  FL D L ++   E  +RI+F+S+ E+   R+     + ++     +    RF EF +FE   ++ IS
Sbjct:   63 TKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLG-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 101.293 bits (251), Expect = 1.472e-21
Identity = 75/274 (27.37%), Postives = 134/274 (48.91%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKK----RFDEFTRFEYNLKKYIS 1039
            +K   I E + R  +K+  FG+ S GKS ++N+ML D    SG  HTT+ F+ V+ +E D +Y +     ++        +     +  D+      A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K+ + E C  FL D L ++   E  +RI+F+S+ E+   R+     + ++     +    RF EF +FE   ++ IS
Sbjct:   63 TKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLG-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 101.293 bits (251), Expect = 1.563e-21
Identity = 75/274 (27.37%), Postives = 134/274 (48.91%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKK----RFDEFTRFEYNLKKYIS 1039
            +K   I E + R  +K+  FG+ S GKS ++N+ML D    SG  HTT+ F+ V+ +E D +Y +     ++        +     +  D+      A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K+ + E C  FL D L ++   E  +RI+F+S+ E+   R+     + ++     +    RF EF +FE   ++ IS
Sbjct:   73 TKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLG-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECIS 340          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 101.293 bits (251), Expect = 1.603e-21
Identity = 75/274 (27.37%), Postives = 134/274 (48.91%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKK----RFDEFTRFEYNLKKYIS 1039
            +K   I E + R  +K+  FG+ S GKS ++N+ML D    SG  HTT+ F+ V+ +E D +Y +     ++        +     +  D+      A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K+ + E C  FL D L ++   E  +RI+F+S+ E+   R+     + ++     +    RF EF +FE   ++ IS
Sbjct:   78 TKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLG-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFEKLFEECIS 345          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn1 (mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664])

HSP 1 Score: 102.064 bits (253), Expect = 6.461e-22
Identity = 74/273 (27.11%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            K  VI E ++R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++ D +Y +     ++        +     +  D+K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + ++ + E C  FL ++L ++   E   RI+F+S+ E+   R      + +         + R  EF  FE   ++ IS
Sbjct:   63 KLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECIS 329          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn1 (mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664])

HSP 1 Score: 102.064 bits (253), Expect = 6.461e-22
Identity = 74/273 (27.11%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            K  VI E ++R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++ D +Y +     ++        +     +  D+K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + ++ + E C  FL ++L ++   E   RI+F+S+ E+   R      + +         + R  EF  FE   ++ IS
Sbjct:   63 KLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECIS 329          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 99.3673 bits (246), Expect = 4.846e-21
Identity = 71/273 (26.01%), Postives = 130/273 (47.62%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V  +  D +               K + ++       +  +  A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ ++ + E C+ FL D L ++ + +  +RI+F+S+ E+   R++    + +      + F     EF  FE   ++ IS
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT--DGHEAFLLTEGSEEKKSVKTVNQLAHALH--QDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 99.3673 bits (246), Expect = 4.846e-21
Identity = 71/273 (26.01%), Postives = 130/273 (47.62%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V  +  D +               K + ++       +  +  A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ ++ + E C+ FL D L ++ + +  +RI+F+S+ E+   R++    + +      + F     EF  FE   ++ IS
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT--DGHEAFLLTEGSEEKKSVKTVNQLAHALH--QDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 99.3673 bits (246), Expect = 4.846e-21
Identity = 71/273 (26.01%), Postives = 130/273 (47.62%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V  +  D +               K + ++       +  +  A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ ++ + E C+ FL D L ++ + +  +RI+F+S+ E+   R++    + +      + F     EF  FE   ++ IS
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT--DGHEAFLLTEGSEEKKSVKTVNQLAHALH--QDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7YU24|MARF_DROME (Transmembrane GTPase Marf OS=Drosophila melanogaster OX=7227 GN=Marf PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 6.924e-24
Identity = 91/336 (27.08%), Postives = 165/336 (49.11%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIE----NDDSLIKSSKTAKKRFDEFTRFEYNLKKYIS-APQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKG 1225
            K   I E + RD +K+  FG+ S GKS ++NAML +    SG  HTT+ F  V+ S   ++Y +     ++           I++++  +   K   +  + +    +  +LL+  +  VD PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N+  E  +  K +  E C  FL ++L +  ++E +ER++F+S+ E  Q RIE    N   +   ++  + R+ EF  FE   ++ IS +    K ++++   K +      + K   +NI     Y  I+ +R L +D K+   E +++G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV------NIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEP-ECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECISQSAVKTKFQQHSSRGKSVS----GDMKSMLDNI-----YERITIFRNLKQDQKNLLTE-RIQG 443          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|O18412|FZO_DROME (Transmembrane GTPase fzo OS=Drosophila melanogaster OX=7227 GN=fzo PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 1.466e-23
Identity = 73/273 (26.74%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFV-----------HVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMK-KEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFE 1015
            S+ E I + ++RD +K+  FG+ S GKS ++NA+L +    S   HTTS F            HVK  ++D +   +                + +++          +  ++V++  +  ++L   + ++D PG    +Q+ DC+     +AD+FI VLN    ++  +R FFK      ++P++FI+ N+WD++ + + E  Q  K++  E C   L D L +    +E  ERIY +S+ E    R   +  +   S   ++R+ EF RFE
Sbjct:   73 SRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHVKVEQEDEHMELSA---------------LSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR---NGQITNPSGQTQQRYQEFLRFE 327          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R4Z9|MFN1_RAT (Mitofusin-1 OS=Rattus norvegicus OX=10116 GN=Mfn1 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.722e-21
Identity = 74/273 (27.11%), Postives = 133/273 (48.72%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            K  VI E ++R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++ D +Y +     ++        +     +  D+K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + ++ + E C  FL ++L ++   E   RI+F+S+ E+   R+     + +         + R  EF  FE   ++ IS
Sbjct:   63 KLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVSPLEARNRIFFVSAKEVLNSRMNKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECIS 329          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R500|MFN2_RAT (Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.745e-21
Identity = 72/273 (26.37%), Postives = 131/273 (47.99%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V  +  D +               K + ++       +  +  A   + V        LLK G+ ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ ++ + E C+ FL D L ++ + +  +RI+F+S+ E+   R++    + +      + F     EF  FE   ++ IS
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT--DGHEAFLLTEGSEEKKSVKTVNQLAHALH--QDEQLHAGSLVSVMWPNSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q811U4|MFN1_MOUSE (Mitofusin-1 OS=Mus musculus OX=10090 GN=Mfn1 PE=1 SV=3)

HSP 1 Score: 102.064 bits (253), Expect = 4.519e-21
Identity = 74/273 (27.11%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  245 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            K  VI E ++R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++ D +Y +     ++        +     +  D+K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + ++ + E C  FL ++L ++   E   RI+F+S+ E+   R      + +         + R  EF  FE   ++ IS
Sbjct:   63 KLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECIS 329          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A5E4MV73 (Dynamin superfamily,Fzo/mitofusin HR2 domain,P-loop containing nucleoside triphosphate hydrolase,Dynamin OS=Cinara cedri OX=506608 GN=CINCED_3A012836 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 9.169e-25
Identity = 99/350 (28.29%), Postives = 171/350 (48.86%), Query Frame = 2
Query:  239 ESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKA-TANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLN-------YALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKK----RFDEFTRFEYNLK----------KYISAPQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLIS-------KYRKLIEDLKD 1198
            ESK   I E + RD +K+  FG+ S GKS ++NAMLGD    +G  HTT+ F+ V+ S+  D+Y           +++ + +E I  ++  +   K     E + V    D   LL+  + +VD PG      + D I  +  +AD+F+ V N       Y +  + + F K     S KP++FI+ N+WD S N+ E   Q+ K+ +       +++L +   +E S RI+F+S+ E+ Q R++    L  +S    +    R+ EF  FE+  +          K+++  Q  K    ++E K L+    K+C+  K+  + E+  SLIS       K  ++++D+KD
Sbjct:   56 ESKVRGICEVLTRDHMKVAFFGRTSNGKSTVVNAMLGDKVLPTGIGHTTNCFLQVEGSQSGDAY------LVIEGSNEKQNVESISHLAHALNHEKQLNEKELVHVYWPKDRCVLLRDDVALVDSPGVDVTPHLDDWIDNHCIDADVFVLVANAESXLYVYQINGEKKFFHKVSSKLS-KPNIFILNNRWDASANEPEFLDQVRKQHMERATDFLMKELKVCTADEASTRIFFISAKEVLQARVQERKGLALNSGALAEGFSTRYMEFKEFEHRFEECISKSAIKTKFLNHSQQGKHLIKSQEQKNLKLDEIKKCQ--KKLNYTEQ--SLISITNDMKMKIGQMVDDVKD 394          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1A9X2I7 (Dynamin-type G domain-containing protein OS=Glossina brevipalpis OX=37001 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 4.511e-24
Identity = 86/292 (29.45%), Postives = 155/292 (53.08%), Query Frame = 2
Query:  257 ITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSE-DDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIE----NDDSLIKSSKTAKKRFDEFTRFEYNLKKYIS-APQDNKTRRYTEEIKKLQTYLC 1105
            I E + RD +K+  FG+ S GKS ++NAML +    +G  HTT+ F  V+  +  ++Y IK    ++         ++I++++  +   K + N  I +    D  +LL+ G+  +D PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N ++E  +  K +  E C  FL ++L +  +EE +ER++F+S+ E+ Q RIE    N  S    ++  + R+ EF  FE   ++ IS +  + K ++++   K L + +C
Sbjct:  111 IREVLARDHMKVAFFGRTSNGKSSVINAMLREKILPNGIGHTTNCFCQVEGCDGSEAYLIKEGSDEKLNV------KDIKQLANALSQEKLSENSLIRIFWPRDRCSLLRDGVVFMDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHKVSQKLSKPNIFILNNRWDASAN-EQEFQESVKSQHTERCVDFLTKELKITNEEEAAERVFFVSAREVVQARIEKAKGNSPSSGAIAEGFQIRYFEFQDFERKFEECISKSAVETKFKKHSFRGKALSSDMC 395          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A0D2X0Q9 (Transmembrane GTPase Marf OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_000950 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.727e-24
Identity = 116/414 (28.02%), Postives = 185/414 (44.69%), Query Frame = 2
Query:  191 KVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANET-------IEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQ-TYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGERKNNNIIIKVENLLNDIMTSPNVTNTEWVTTELGHVHAELDI-MFKEVKDKQYKEFV 1396
            K +K +  FSS++ +I   +E       RD +K+   G+ S GKS ++NAML +    SG  HTT+ FV V  S+ ++                    E + IS  ++   A   E        I V        LL   ++++D PG    + I   I     +AD+F+ V N    L   +R FF    +  +KP+VFI+ N+WD SDN+ ++S +  +E+  E  SKFL D L ++ + +I +R++F+S+ E   +R   + +  K S+  + R+DEF RFE   ++ I      KT+     ++ L   Y   E     E + KE+    IS   K I + K+    I+  GER        V+ L      S      E +   L H+ AE     F+     QYK  +
Sbjct:   94 KEQKEIGVFSSQVSSISKLFE-------RDHMKVVFVGQTSNGKSTVVNAMLYNRILPSGIGHTTNCFVSVSGSDANT-----------PYIIDSLSSEQQPISNVLQLANALHPEGSLNQSGLIRVFWPTTKCRLLGDDVDLIDSPGLDLSNDINQWIDDYCMDADVFVLVANAEATLKVAERAFFFKVNEKLSKPNVFILNNRWDASDNEIDDSPERVREQHLEYASKFLADELKVVSRSKILDRVFFVSARETLLYRTTENWTRFKESQAVRDRYDEFRRFEQAFERTI-CKSAMKTKFEHRIVRGLDIAYSLAEIAGKAETLSKEQ----ISGRIKEINERKENAARIRQLGERSLKCCSALVDRLAATSRASVARAMNEEIDHVLPHIVAEFSYSQFRPQHLLQYKRML 484          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A0R3T4T6 (Dynamin-type G domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2073 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.473e-23
Identity = 110/384 (28.65%), Postives = 175/384 (45.57%), Query Frame = 2
Query:  173 ITEEEWKVKKTVLNFSSKLDNIESKYE---VITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKS-EDDSYXXXXXXXXXXXXXXXXXXEEIERIS---GDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----------------KKRFDEFTRFEYNLKKYISAPQDNKTR----RYTEEIKKLQTYLCKECKDFKENIFKEK----RYSLISKYR--KLIEDLKDFKKEIK 1216
            ++EE  K     L  SS  D +E  +E    I + ++R+ +K   FG+ S GKS ++NAMLG     SG  HTTS FV V+ + ++  Y  +    D      T   + IE +S     +   K  ++  I +        LLK+ +  +D PG      +   I ++  +AD+FI V N    L   ++ FF       +KP++FI+ N+WD S  + E + Q+ KE+  + C  FL D L +  +EE  ER++F+S+ E+   R +  +                         + R  EF+ FE   +K +S   D+ TR     +TE+ K+L  Y  +  +   E   +EK    RY  IS  R  KL E L+    +IK
Sbjct:   58 LSEEAGKRLSPALEKSSSTD-LEPHFEKVRQIQQIISRNQMKCAFFGRTSNGKSTVINAMLGSRILPSGIGHTTSCFVQVQGTNQEQGYLQQESIPDSVNNGTTSEPQPIESVSQLAHSLSSVKLASDAIIYLFWPSSSCNLLKEDVAFLDSPGVNVDPDMDAWIDRHCLDADVFILVANAESTLMQAEKDFFYRVSGRISKPNIFILNNRWDASAGEAELADQV-KEQHMQRCVAFLTDELQVCGREEAMERVFFISAREVLTIRAKALNGGTPPGAAPNIGTPSSGGYPLADGWQARLLEFSTFEGVFEKILS---DSATRTKFASHTEQGKELAAYFRQLMEATYEAALEEKDAGIRYRRISHVRLEKLNEKLRQASVDIK 436          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1W4V389 (transmembrane GTPase fzo isoform X2 OS=Drosophila ficusphila OX=30025 GN=LOC108091614 PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.524e-23
Identity = 94/340 (27.65%), Postives = 159/340 (46.76%), Query Frame = 2
Query:  236 IESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEIS-ERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQ-----DNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGE 1228
            +  K   I + + R  +K+  FG+ S GKS ++NAML +    S   HTTS F  V+ + DD       + +    D +   E     S      +      I  S C    +LL   + ++D PG    +Q+ DC+ +   +AD+FI VLN    ++  +R FFK      ++P++FI+ N+WD + N + E  Q  K++  E C K L +DL +   EE + +RIY +S+ E  Q R   +      +   ++R+ EF RFE +    ++        ++      E + +LQT L K        + KE     + + R L  +++D +KEI+ + E
Sbjct:   46 LADKISSIDKVLARKRMKVAFFGRTSNGKSAVINAMLHERILPSAMGHTTSCFCQVQANGDDEPEHVRIEEEEQQLDLSSLNELASAHSPRALKPRTLLYVNIPKSRC----SLLDYDVVLMDTPGVDVTAQLDDCLDRYCMDADVFILVLNAESTISRVERQFFKDVSSKLSRPNLFILNNRWDVASNQEPEMEQQVKDQHMERCLKLLIEDLRVYSDEEQAKKRIYHISALEALQLR---NGCKTNPNPQTQERYLEFQRFEADFANCLAESALKTKFEHHLISAQEVLTQLQTTLLKPLATKVNQLMKEN----VDRRRDLYVEMRDSRKEIQERTE 374          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 104.76 bits (260), Expect = 7.657e-23
Identity = 79/286 (27.62%), Postives = 144/286 (50.35%), Query Frame = 2
Query:  218 SSKLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKS-EDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            S++L  IES   K  VI E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ + ED +Y       +          + + +++  +  +++  A   ++V        LL+  + +VD PG+   +Q+   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K+   + C  FL ++L ++ +EE    I+F+S+ E+   R++    + ++        + R  EF  FE   ++ IS
Sbjct:   52 STQLQEIESYTEKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEEEKSI------KTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMDDVRKQH-TDRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQSFERTFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 104.375 bits (259), Expect = 8.390e-23
Identity = 79/286 (27.62%), Postives = 144/286 (50.35%), Query Frame = 2
Query:  218 SSKLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKS-EDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            S++L  IES   K  VI E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ + ED +Y       +          + + +++  +  +++  A   ++V        LL+  + +VD PG+   +Q+   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K+   + C  FL ++L ++ +EE    I+F+S+ E+   R++    + ++        + R  EF  FE   ++ IS
Sbjct:   52 STQLQEIESYTEKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEEEKSI------KTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMDDVRKQH-TDRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQSFERTFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 101.293 bits (251), Expect = 9.565e-22
Identity = 72/274 (26.28%), Postives = 140/274 (51.09%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I E ++R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++ +             +++ K ++ + +++  +  ++   A   + V        LL+  + +VD PG    +++   I K   +AD+F+ V N    L   ++ FF    +  + P++FI+ N+WD S ++ E   ++ ++ ++  CS FL D L ++ + + S+RI+F+S+ E+ Q R++    + ++     + F     EF  FE   ++ IS
Sbjct:   83 SKVAGIGEVLSRRHMKVVFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGTDGNE-----AFLLTEGSEERKNVKTVNQLAHALHQDEDLDAGSLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMEEVRRQHMD-RCSSFLVDELGVVDRAQASDRIFFVSAKEVLQARVQKAQGMPEAGGALAEGFQARMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043809.1 (mitofusin-1-like [Source:NCBI gene;Acc:103034819])

HSP 1 Score: 99.3673 bits (246), Expect = 3.012e-21
Identity = 72/280 (25.71%), Postives = 139/280 (49.64%), Query Frame = 2
Query:  224 KLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQD-LDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            ++ +   K E I E + R  +K+  FG+ S GKS ++NAML +    SG  HTT+ F+ V+ ++ D             +++ K I+ + +++  +  ++   +   + V        LL+  + ++D PG+   S++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S+ + E    + K+ ++  C  FL D L ++  ++   RI+F+S+ E    RI     + ++        + R  EF  FE   +++IS
Sbjct:   57 EIQSCSRKLEAIWEVLARRQMKVAFFGRTSNGKSTVINAMLRERVLPSGIGHTTNCFISVEGTDGDQ-----AFLTTENSEERKSIKTVNQLAHALHMDRNLDSGCLVRVFWPKTKCALLRDDLVLMDSPGTDVTSELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVSERISKPNIFILNNRWDASETEPEYLDGVRKQHMD-RCVSFLVDELKVVSPDQAPNRIFFVSAKEALSARIHRAQGMPETGAALADGFQDRLQEFQSFERTFEEFIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Match: EDO42379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L1])

HSP 1 Score: 94.3597 bits (233), Expect = 4.113e-20
Identity = 90/342 (26.32%), Postives = 160/342 (46.78%), Query Frame = 2
Query:   56 SILPETLKQLKNIRKTVSEIENNDKINYGKISEINNK----CDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDND-DEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA-----KKRFDEFTRFEYNLKKYIS 1039
            S L   +K  K I +TVSEI        GK  +  N+    C+I E+    K  +  F+  +     +   ITE + RD +K+  FG+ S GKS ++NAML D     G  HTT+ F+ V  S+  D Y           +D+ + ++ + +I+  +   K   +  ++V        +L + + +VD PG      +   I K+  +AD+F+ V N    L   ++ FF       +KP++FI+ N+WD S  + D E  ++ K++  +    FL ++L  + K++  +R++F+S+ E    R++    + +            R  EF  FE+  ++ IS
Sbjct:   27 SPLHNFVKAKKKINETVSEI--------GKYLDEANRFICGCEIAED---YKSNIKGFACDVAGFLGQVASITEVIARDQMKVAFFGRTSNGKSTVVNAMLQDRILPMGIGHTTNCFLSVNGSDSADPY------ILIPESDERRNVKTLGQIAHALFEEKLDHSSLVQVYWPKSRCKMLSEDVVLVDSPGIDVSPDLDLWIDKHCLDADVFVLVCNAESTLMVTEKNFFHKVNQKLSKPNIFILNNRWDASAGEPDVEMMELVKKQHLQRNVDFLSKELKCVDKKQAEDRVFFVSAKETLMSRMQKHQGMPEEGGAIHVDGFHGRKLEFENFEHKFEECIS 351          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 107.457 bits (267), Expect = 1.044e-23
Identity = 77/282 (27.30%), Postives = 142/282 (50.35%), Query Frame = 2
Query:  221 SKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            S++     K  VI E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++DD SY       +          + + +++  +  +++  A   + V        LL+  + +VD PG+   +Q+   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S N+ E    + K+   + C  FL ++L ++ +E+   RI+F+S+ E+   R++    + ++        ++R  EF  FE   ++ IS
Sbjct:   67 SEIQAYADKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSDEEKSI------KTVNQMAHALHMDESLDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASANEPEYMEDVRKQH-TDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEGFQERLKEFQSFERRFEECIS 341          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 107.071 bits (266), Expect = 1.200e-23
Identity = 77/282 (27.30%), Postives = 142/282 (50.35%), Query Frame = 2
Query:  221 SKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFEYNLKKYIS 1039
            S++     K  VI E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++DD SY       +          + + +++  +  +++  A   + V        LL+  + +VD PG+   +Q+   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S N+ E    + K+   + C  FL ++L ++ +E+   RI+F+S+ E+   R++    + ++        ++R  EF  FE   ++ IS
Sbjct:   67 SEIQAYADKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSDEEKSI------KTVNQMAHALHMDESLDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASANEPEYMEDVRKQH-TDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEGFQERLKEFQSFERRFEECIS 341          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000009003.2 (pep primary_assembly:ASM223467v1:17:11595384:11602171:-1 gene:ENSORLG00000007178.2 transcript:ENSORLT00000009003.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 6.335e-21
Identity = 74/289 (25.61%), Postives = 140/289 (48.44%), Query Frame = 2
Query:  218 SSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSE-DDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICM-------DDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTA----KKRFDEFTRFE--YNLKKY 1033
            S ++ +  +K   I + + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ ++ D++Y                  EE   IS   +   A   +    S C+           LL+  + ++D PG+    ++   I K   +AD+F+ V N    L + +++FF    +  +KP++FI+ N+WD S  + +   ++ K+ ++  C  FL ++L ++   E   RI+F+S+ E+   R++    + ++         +R  EF RFE  + ++K+
Sbjct:   53 SLEMQSCATKLYTIRDVLLRRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDGDEAYLTSEAS------------EERRSISTVNQLAHALHMDPTLDSSCLVKVFWPKSRCALLRNDLVLMDSPGTDVTLELDSWIDKFCLDADVFVLVGNAESTLMNTEKLFFHKVSERISKPNIFILHNRWDASVTEPDYIQEVRKQHLD-RCVGFLAEELGVVGPNEAPGRIFFISAKEVLSSRMQRAQGMPETGGALAEGFHERLTEFQRFERTFEVRKH 328          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn2 (mitofusin 2 [Source:NCBI gene;Acc:101170481])

HSP 1 Score: 98.2117 bits (243), Expect = 8.582e-21
Identity = 73/273 (26.74%), Postives = 131/273 (47.99%), Query Frame = 2
Query:  242 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFL-QDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFD----EFTRFEYNLKKYIS 1039
            SK   I E + R  +K+  FG+ S GKS ++NAML D    SG  HTT+ F+ V+ + D S      +            +    +  D       A   + V        LL+  + +VD PG    +++   I K   +AD+F+ V N    L   ++ FF    +  + P++FI+ N+WD S ++ E   ++ ++ ++  CS FL ++L ++ + + S+RI+F+S+ E+ Q R++    + ++     + F     EF  FE   ++ IS
Sbjct:   83 SKVAGIGEVLARRHMKVVFFGRTSNGKSTVINAMLCDKVLPSGIGHTTNCFLRVEGT-DGSEGFLLTEGSEEKKSIKTVNQLAHALHQD---QDLDAGSLVCVMWPKVKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMDEVRRQHMD-RCSNFLVEELGVVDRAQASDRIFFVSAKEVLQARMQRVQGMPEAGGALAEGFQARMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014762.1 (SMESG000014762.1)

HSP 1 Score: 1103.97 bits (2854), Expect = 0.000e+0
Identity = 594/628 (94.59%), Postives = 608/628 (96.82%), Query Frame = 2
Query:   47 MNISILPETLKQLKNIRKTVSEIENNDKINYGKISEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGERKNNNIIIKVENLLNDIMTSPNVTNTEWVTTELGHVHAELDIMFKEVKDKQYKEFVSFLKNQEGIGKESNFSKEGKPAFKSMWRTSIVKPSDKGLDVETADAVNPAKTGDVLNKTVEILPLLGQLPTKIFALASSALIISGLAMTAASAVYASYANDMKVXXXXXXXXXXXXXLDSKKNIFNSNIKDNVEAITEHFIEKANEINGIFQRKIDMFNEYWSKIEEIFRESHEIIGN 1930
            MN  IL ET  + +NIRK V EI+  D+INYGKISE+N KCDITEEEWKV + +LNFSSKLDNI+SK+EVI EKVNRD+VKIFLFGKVSVGKS LLN MLGDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDK +FI+EIE +SGDIKGNKATANE IEVSI MDDE+LLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGERKNNNIIIKVENLLNDIMTSPNVTNTEWVTTELGHVHAELDIMFKEVKDKQYKEFVSFLKNQEGIGKESNFSKEGKPAFKSMWRTSIVKPSDKGLDVETADAVNPAKTGDVLNKTVEILPLLGQLPTKIFALASSALIISGLAMTAASAVYASYANDMKVKEQEQQKQNIIQQLDSKKNIFNSNIKDNVEAITEHFIEKANEINGIFQRKIDMFNEYWSKIEEIFRESHEIIGN
Sbjct:    1 MNTEILTETENRFENIRKIVKEIKRYDEINYGKISEMNKKCDITEEEWKVDQILLNFSSKLDNIKSKFEVINEKVNRDIVKIFLFGKVSVGKSTLLNTMLGDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDKKEFIKEIEIMSGDIKGNKATANENIEVSIRMDDESLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGERKNNNIIIKVENLLNDIMTSPNVTNTEWVTTELGHVHAELDIMFKEVKDKQYKEFVSFLKNQEGIGKESNFSKEGKPAFKSMWRTSIVKPSDKGLDVETADAVNPAKTGDVLNKTVEILPLLGQLPTKIFALASSALIISGLAMTAASAVYASYANDMKVKEQEQQKQNIIQQLDSKKNIFNSNIKDNVEAITEHFIEKANEINGIFQRKIDMFNEYWSKIEEIFRESHEIIGN 628          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014753.1 (SMESG000014753.1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 401/626 (64.06%), Postives = 484/626 (77.32%), Query Frame = 2
Query:   47 MNISILPETLKQLKNIRKTVSEIENNDKINYGKISEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGERKNNNIIIKVENLLNDIMTSPNVTNTEWVTTELGHVHAELDIMFKEVKDKQYKEFVSFLKNQEGIGKESNFSKEGKPAFKSMWRTSIVKPSDKGLDVETADAVNPAKTGDVLNKTVEILPL--LGQLPTKIFALASSA---LIISGLAMTAASAVYASYANDMKVXXXXXXXXXXXXXLDSKKNIFNSNIKDNVEAITEHFIEKANEINGIFQRKIDMFNEYWSKIEEIFRE 1909
            MNISILPETLKQLKNIRKTVSEIENNDKINYGKISEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDKTKFIEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSK KI EECSKFL+ L++ K++EI +RIYF S+ EM Q RIEN+DSL+ S    KKRF++F RFEYNLKKYI+ PQDNKTRRY +EIK +Q +L  E   F+ +IF EK  SLI KY K ++D++DFK  I  K +   N+++ ++E++ N+I+ SP++ ++EWVT++L H  +E+ +  +E + KQYK+F+ F+K+++ I  ++  S+  +   K MW   IV P+D           N +K   ++ + +E L +  +  +P ++FA   S    L+I  +  + +     S                   QL+S+++  +  I++NV  I E+++EKANEI  +FQ K  +FNEYW ++E I ++
Sbjct:    1 MNISILPETLKQLKNIRKTVSEIENNDKINYGKISEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDKTKFIEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFFSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEIKNIQDFLNTEFMKFQADIFNEKNNSLIPKYEKWMKDMEDFKATILSKNDDVQNSLLKRLEDIHNEIIHSPDLRSSEWVTSQLEHFTSEMKLKLQEAQLKQYKDFIHFIKSKDLINGKTYLSETKELNIKLMWNPIIVNPTD-----------NVSKEACIVKEVMEKLAMIPIPNIPFQMFAQGVSLVGKLVIKRIEDSESEQHRQSIIQ----------------QLNSQRSNMSRIIEENVNEIKEYYMEKANEIIQLFQEKSKLFNEYWRRLEGILKD 599          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014759.1 (SMESG000014759.1)

HSP 1 Score: 211.075 bits (536), Expect = 8.965e-60
Identity = 148/442 (33.48%), Postives = 244/442 (55.20%), Query Frame = 2
Query:  185 EWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGN---KATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLI--KSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISK--YRKLIEDLKDFKKEIKLKGERKNNNIIIKVENLLNDIMTSPNVTNTEWVTTELGHVHAEL--DIM-----FKEVKDKQYKEFVSFLKNQEGIGKESNFSKEGKPAFK 1468
            E K+   + +F  K + IE+K   I  KV +D +KI  FGKVS GKS++LN +LG N F S  A TTS FV V KS+   + ++   ++  F       ++++ ++  +  N   +    +T++V + + +E +LK   EIVDCPGS NK ++T+CIKK S ++DIFIFV+   LTD+++ FF+YQ   S+KPD+F+++N+WD SD D +E+T  S++KI +E    L        +E SERI+F+S+ EMF+ R+EN D  +  K+ +    R  EFT FE +L  YI  P+  KT+R+  E+      +    KDFKE +    +    +K   + L++ LK  K ++     +  + I  +++  + D+  + N  N   + T+L  +  ++  D++       E+ +K  K+F      +  +GK    +KE KP  K
Sbjct:   41 ESKILHLIEDFIKKFEIIETKIGFIEGKVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTAKTVQVFLNIKNE-ILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLSNYIDNPEKKKTKRHFREVTAAIKEIENVRKDFKEELLGTNKLEEFNKNPMKHLLDSLKRIKSDLISHINKNCSYISDQIQYEVEDLKRNINRNNVRDINTKLNSLPTKVSTDLLNLQSDSNEIIEKMKKKF------KRVMGKHKFKNKEEKPTLK 475          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014755.1 (SMESG000014755.1)

HSP 1 Score: 202.601 bits (514), Expect = 1.198e-57
Identity = 138/435 (31.72%), Postives = 231/435 (53.10%), Query Frame = 2
Query:  203 TVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGN---KATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSL--IKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGE-------RKNNNIIIKVENLLNDIMTSPNVTNTEWVTTELGHVHAELDIMFKEVKDKQYKEFVSFLKN-QEGIGKESNFSKEGKPAFK 1468
            T+ NF  K + IE+K   I  KV +D +KI  FG VS GKSK+LN ++G+N F S  A TTS FV V+KS+   + ++ + ++  F   T    +++ ++  +  N   +    +T++V + +++E ++K   EI DCPGS NK ++T+CI + S ++DIFIFV+   LT++++ FF+YQ   S+KPD+F+++N+WD+SD D    T+ S+ KI  E    L        EE S+RI+F+S+ EMF+ RIE  +     ++ +  + R++EF  FE +L +YI  P+ NK  R+  E+++    L    + FK  +FK K    +  Y     D+KD    +    E       R+   I + +    +D+ T     N +   + L  V   +      ++    K+  +  K+ +  +GK     KE KP  K
Sbjct:   47 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENE-IMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKEIFGNQRTRRAIEMRYEEFLSFEESLSRYIDNPEINKLERHDREVRETTRNLESIIESFKTELFKHKDLRELKTY-----DMKDLSGRLDKAYECILKDLLRETKEIHMNLSTNCHDLRTFLTRNNIQGTCSMLNTVTTRVSNDLMNIQSNLNKKLQTMKKDFKRVMGKHKFIKKEEKPTLK 475          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000070111.1 (SMESG000070111.1)

HSP 1 Score: 191.43 bits (485), Expect = 1.937e-53
Identity = 122/351 (34.76%), Postives = 213/351 (60.68%), Query Frame = 2
Query:   41 KKMNISILPETLKQLKNIRKTVSEIENNDKINYGKISEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGDIKGNKATANETIEVSICM-DDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKL 1090
            KKM+ +I  +  ++++  +K ++E+EN     Y    E+   C    +EWKV+K +  F  +   +E++   I E++++  +KIF FG VS GK++L+NA+LG  +F S   HTT  FVH+ KS D  Y+I  K+ +  +  K K IEE+E+IS   K   + + E+++V I + DD  +LK  +E++D PG+G+  ++ +C++ +  +ADI I++L   ++++D  FF  + + +TKPD+FI++N+WD+SD D +     + + +  +C   +      K ++I +RI F+S+ E+F +RI+N +    S++  K R+ +F RFE  +++YI  PQ  KTRRY  EIK L
Sbjct:   13 KKMSQNIDSDARQEMRKAKKLLTELEN-----YIGFEEL---C----KEWKVQKKIKKFKDRFVELENQLNDIQEEISKKNIKIFFFGSVSSGKTRLINAILGGEFFMSTMNHTTKCFVHIMKSPDAKYKIVHKNQEFIYESKNKIIEEVEKISTFNKETSSMSQESVKVFIPIGDDNKILKGNVELIDSPGTGDIEELIECVQNHLSDADICIYLLCNDVSEEDERFFNIRINRTTKPDIFILVNKWDQSDQDQDSRLCETYKNLVGKCFGLVGKFGGPKTKDIDKRIIFISAIEVFGYRIKNKEP---SNRNQKIRYADFERFEDQIEEYIQNPQQLKTRRYKREIKTL 348          
The following BLAST results are available for this feature:
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFN19.214e-2226.74mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN21.779e-2125.91mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN21.779e-2125.91mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN15.889e-2126.74mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN15.889e-2126.74mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fzo-19.419e-1924.76Transmembrane GTPase fzo-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Marf6.908e-2527.08gene:FBgn0029870 transcript:FBtr0070910[more]
Marf6.908e-2527.08gene:FBgn0029870 transcript:FBtr0070909[more]
Marf1.077e-2427.14gene:FBgn0029870 transcript:FBtr0343373[more]
fzo1.462e-2426.74gene:FBgn0011596 transcript:FBtr0084399[more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn1b1.128e-2126.91mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b1.561e-2126.86mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b1.561e-2126.86mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn22.197e-2126.64mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
mfn1b4.963e-2127.31mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn11.207e-2127.37mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn11.289e-2127.37mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn11.472e-2127.37mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn11.563e-2127.37mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn11.603e-2127.37mitofusin 1 [Source:NCBI gene;Acc:548943][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfn16.461e-2227.11mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664][more]
Mfn16.461e-2227.11mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664][more]
Mfn24.846e-2126.01mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn24.846e-2126.01mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn24.846e-2126.01mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7YU24|MARF_DROME6.924e-2427.08Transmembrane GTPase Marf OS=Drosophila melanogast... [more]
sp|O18412|FZO_DROME1.466e-2326.74Transmembrane GTPase fzo OS=Drosophila melanogaste... [more]
sp|Q8R4Z9|MFN1_RAT2.722e-2127.11Mitofusin-1 OS=Rattus norvegicus OX=10116 GN=Mfn1 ... [more]
sp|Q8R500|MFN2_RAT2.745e-2126.37Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 ... [more]
sp|Q811U4|MFN1_MOUSE4.519e-2127.11Mitofusin-1 OS=Mus musculus OX=10090 GN=Mfn1 PE=1 ... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4MV739.169e-2528.29Dynamin superfamily,Fzo/mitofusin HR2 domain,P-loo... [more]
A0A1A9X2I74.511e-2429.45Dynamin-type G domain-containing protein OS=Glossi... [more]
A0A0D2X0Q95.727e-2428.02Transmembrane GTPase Marf OS=Capsaspora owczarzaki... [more]
A0A0R3T4T61.473e-2328.65Dynamin-type G domain-containing protein OS=Rodent... [more]
A0A1W4V3892.524e-2327.65transmembrane GTPase fzo isoform X2 OS=Drosophila ... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn1b7.657e-2327.62mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn1b8.390e-2327.62mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn29.565e-2226.28mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
ENSAMXT00000043809.13.012e-2125.71mitofusin-1-like [Source:NCBI gene;Acc:103034819][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423794.113e-2026.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn1b1.044e-2327.30mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn1b1.200e-2327.30mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
ENSORLT00000009003.26.335e-2125.61pep primary_assembly:ASM223467v1:17:11595384:11602... [more]
mfn28.582e-2126.74mitofusin 2 [Source:NCBI gene;Acc:101170481][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014762.10.000e+094.59SMESG000014762.1[more]
SMESG000014753.10.000e+064.06SMESG000014753.1[more]
SMESG000014759.18.965e-6033.48SMESG000014759.1[more]
SMESG000014755.11.198e-5731.72SMESG000014755.1[more]
SMESG000070111.11.937e-5334.76SMESG000070111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022278 ID=SMED30022278|Name=Dynamin-type G domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2015bp
AATTTATTGTTAGAATTTTTATATCCGCATTTCAGATTTGAAAAAAATGA
ATATTTCAATTTTACCCGAAACATTAAAGCAATTGAAGAATATAAGAAAA
ACTGTCAGCGAAATAGAAAATAACGATAAAATTAATTATGGAAAAATATC
CGAAATAAATAACAAATGTGATATAACAGAAGAAGAGTGGAAAGTAAAAA
AGACCGTATTAAATTTCTCAAGCAAATTAGACAACATCGAAAGTAAATAC
GAAGTCATCACCGAAAAAGTCAACAGAGATGTTGTCAAAATATTTCTTTT
TGGAAAAGTTTCAGTTGGCAAAAGCAAACTCCTGAATGCGATGTTGGGCG
ACAATTACTTTGCCTCGGGCACAGCTCACACAACGAGCAGTTTTGTCCAT
GTCAAGAAATCGGAGGACGACAGCTACAGGATCAAAACTAAGGATACTGA
TCGAACGTTCACTGACAAAACAAAGTTCATTGAAGAAATTGAACGCATTT
CTGGGGACATAAAAGGTAATAAAGCCACGGCTAATGAAACCATTGAAGTG
TCGATATGCATGGATGACGAGACTCTATTGAAAAAAGGCATAGAAATTGT
CGACTGCCCCGGATCCGGAAACAAATCTCAAATTACAGACTGCATTAAGA
AAAATTCTCAAGAAGCGGATATATTCATATTTGTGTTGAATTACGCATTG
ACGGACGATGATAGGGTATTCTTCAAATATCAAGAGGATTCTTCAACTAA
ACCGGACGTTTTCATTGTTATAAATCAGTGGGACGAGTCTGATAATGATG
ATGAGGAGTCAACTCAAATGAGCAAAGAGAAAATCAATGAAGAATGTTCT
AAATTCCTGCAAGATCTGGATTTAATGAAAAAAGAAGAAATCTCTGAAAG
AATTTATTTCCTTTCATCTTCTGAAATGTTTCAATTTCGTATAGAAAATG
ATGACAGTTTAATCAAGTCTAGTAAGACTGCTAAGAAGCGATTTGACGAA
TTTACTCGATTTGAATACAATCTGAAGAAATACATCAGCGCGCCTCAAGA
CAACAAGACCCGTCGATACACTGAAGAAATAAAAAAACTGCAAACTTATT
TATGCAAAGAATGCAAAGATTTCAAAGAAAACATTTTCAAAGAAAAGAGA
TATTCCTTAATAAGCAAATATAGAAAATTAATTGAAGATTTAAAAGACTT
CAAAAAAGAGATAAAACTGAAAGGTGAAAGGAAAAATAACAACATAATTA
TAAAAGTAGAAAATCTGTTAAATGACATTATGACCAGCCCGAATGTGACA
AACACAGAATGGGTCACGACGGAACTGGGACATGTCCATGCGGAACTGGA
TATCATGTTCAAGGAAGTAAAGGATAAACAATACAAGGAATTTGTCAGTT
TCCTAAAAAATCAAGAGGGAATTGGTAAGGAGAGTAATTTTTCAAAGGAG
GGTAAGCCGGCTTTCAAGAGCATGTGGAGAACGTCAATCGTGAAACCTAG
TGACAAGGGACTCGATGTAGAGACTGCAGATGCGGTGAATCCAGCAAAGA
CCGGTGACGTGTTAAATAAGACCGTAGAAATATTGCCATTGCTTGGACAA
CTTCCAACAAAGATATTTGCGTTAGCGTCTTCCGCTTTAATTATTTCTGG
CCTTGCTATGACGGCTGCCTCGGCCGTTTATGCCTCCTACGCAAATGATA
TGAAGGTAAAGGAGCAGGAACAGCAAAAGCAAAATATTATCCAGCAGTTA
GATTCCAAAAAAAATATATTTAATAGCAATATCAAGGATAATGTGGAAGC
TATTACCGAACATTTCATAGAGAAAGCAAATGAAATTAATGGAATTTTCC
AAAGAAAAATAGATATGTTCAATGAATATTGGAGTAAGATAGAAGAGATA
TTTAGAGAAAGTCATGAAATAATTGGAAATTGAATATTTTTGAAACTTGA
AATCTTCAATCTTTTAGTTATGCTATACTTTTAACTATTTGCATCATATG
TGATACATAGGATAG
back to top

protein sequence of SMED30022278-orf-1

>SMED30022278-orf-1 ID=SMED30022278-orf-1|Name=SMED30022278-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=629bp
MNISILPETLKQLKNIRKTVSEIENNDKINYGKISEINNKCDITEEEWKV
KKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAML
GDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDKTKFIEEIER
ISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCI
KKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDN
DDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIE
NDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQT
YLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGERKNNNI
IIKVENLLNDIMTSPNVTNTEWVTTELGHVHAELDIMFKEVKDKQYKEFV
SFLKNQEGIGKESNFSKEGKPAFKSMWRTSIVKPSDKGLDVETADAVNPA
KTGDVLNKTVEILPLLGQLPTKIFALASSALIISGLAMTAASAVYASYAN
DMKVKEQEQQKQNIIQQLDSKKNIFNSNIKDNVEAITEHFIEKANEINGI
FQRKIDMFNEYWSKIEEIFRESHEIIGN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000140anterior region of the whole animal
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027094Mitofusin_fam
IPR027417P-loop_NTPase
IPR022812Dynamin_SF
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
Vocabulary: cellular component
TermDefinition
GO:0005741mitochondrial outer membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0008053mitochondrial fusion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 456..476
NoneNo IPR availableCOILSCoilCoilcoord: 162..182
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 32..316
e-value: 5.5E-11
score: 44.1
NoneNo IPR availableTMHMMTMhelixcoord: 425..447
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 2..145
e-value: 9.6E-11
score: 42.0
IPR027094Mitofusin familyPANTHERPTHR10465TRANSMEMBRANE GTPASE FZO1coord: 1..370
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..153