noggin-like protein 6

Overview
Namenoggin-like protein 6 (ACO06231.1)
Smed IDSMED30022274
Length (bp)2926
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of noggin-like protein 6 vs. Ensembl Human
Match: NOG (noggin [Source:HGNC Symbol;Acc:HGNC:7866])

HSP 1 Score: 67.0106 bits (162), Expect = 1.280e-11
Identity = 52/168 (30.95%), Postives = 68/168 (40.48%), Query Frame = -2
Query:  736 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLR-NGKISEEMETL---------------------LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1173
            L E  DPI      PK   LNE  L  +LG  +DP + + S P              E   +   L   R +G +  E++ L                     L+ WL  ++ C V Y W DLG+ FWPR+ K  SC   S +SCS P GM C       +  LRW C
Sbjct:   46 LIEHPDPIFD----PKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCF--SKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 6 vs. Ensembl Zebrafish
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 73.9442 bits (180), Expect = 2.886e-14
Identity = 47/137 (34.31%), Postives = 66/137 (48.18%), Query Frame = -2
Query:  736 PKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFID--KVNLTNLRNG---KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1131
            P+   L+E+ L+K LG  FD  + SI  P     +     PRL    +  K++LT    G   K+ ++       WL   + C V Y W+DLG  FWPR+ K  +C   S +SCS+P GM C         +LRW C
Sbjct:   52 PREQDLSEKTLLKKLGSNFDANFMSIHLPAQLNASAPPELPRLPMPAELKKLDLTETPYGRRVKVGKKARRKFLQWLWMYTHCPVLYTWKDLGLRFWPRYIKEGNCF--SERSCSFPEGMSCKPVKAVTKTFLRWYC 186          
BLAST of noggin-like protein 6 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 72.7886 bits (177), Expect = 7.123e-14
Identity = 51/160 (31.87%), Postives = 79/160 (49.38%), Query Frame = -2
Query:  730 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKY--NKLSYDPRLEQFIDKV----------NLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYE 1173
            L E  DP+L     PK   LNE +L  ILG  F+  + SI+ P  +    ++L+    ++Q  + +          ++ + +  K S+++   L+ WL   + C V + W+DLGN FWPR+ K  SC N   +SCS P GM C       +  LRW C +
Sbjct:   44 LKEDPDPVLD----PKERDLNETELRAILGSHFEQNFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNK--RSCSVPEGMVCKPAKSSHLTVLRWRCVQ 197          
BLAST of noggin-like protein 6 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 72.7886 bits (177), Expect = 7.328e-14
Identity = 51/160 (31.87%), Postives = 79/160 (49.38%), Query Frame = -2
Query:  730 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKY--NKLSYDPRLEQFIDKV----------NLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYE 1173
            L E  DP+L     PK   LNE +L  ILG  F+  + SI+ P  +    ++L+    ++Q  + +          ++ + +  K S+++   L+ WL   + C V + W+DLGN FWPR+ K  SC N   +SCS P GM C       +  LRW C +
Sbjct:   44 LKEDPDPVLD----PKERDLNETELRAILGSHFEQNFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNK--RSCSVPEGMVCKPAKSSHLTVLRWRCVQ 197          
BLAST of noggin-like protein 6 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 72.7886 bits (177), Expect = 7.328e-14
Identity = 51/160 (31.87%), Postives = 79/160 (49.38%), Query Frame = -2
Query:  730 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKY--NKLSYDPRLEQFIDKV----------NLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYE 1173
            L E  DP+L     PK   LNE +L  ILG  F+  + SI+ P  +    ++L+    ++Q  + +          ++ + +  K S+++   L+ WL   + C V + W+DLGN FWPR+ K  SC N   +SCS P GM C       +  LRW C +
Sbjct:   44 LKEDPDPVLD----PKERDLNETELRAILGSHFEQNFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNK--RSCSVPEGMVCKPAKSSHLTVLRWRCVQ 197          
BLAST of noggin-like protein 6 vs. Ensembl Zebrafish
Match: nog1 (noggin 1 [Source:NCBI gene;Acc:30174])

HSP 1 Score: 62.003 bits (149), Expect = 3.166e-10
Identity = 51/161 (31.68%), Postives = 73/161 (45.34%), Query Frame = -2
Query:  736 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLRNGKI---------------SEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1173
            L E  DP+      P+   LNE +L   LGD FD  + S+  P     ++ + +  L++   ++NL  +    I               S++++  L+ WL   S C V Y W DLG+ FWPRF +  SC     +SCS P GM C       I  LRW C
Sbjct:   39 LKEDPDPLYD----PREKDLNETELRSALGD-FDSRFLSVGPP----QDRYAGNEDLDEQELQLNLAGMMPKDIKNLDFDAPWGKKRKASKKLKRRLQMWLWSYSFCPVLYAWNDLGSRFWPRFVRAGSCYTK--RSCSVPEGMVCKPAKSTHITLLRWRC 188          
BLAST of noggin-like protein 6 vs. Ensembl Xenopus
Match: nog4 (noggin 4 [Source:NCBI gene;Acc:733455])

HSP 1 Score: 82.0333 bits (201), Expect = 1.425e-16
Identity = 42/135 (31.11%), Postives = 65/135 (48.15%), Query Frame = -2
Query:  733 GDKFDPFWTSISRPVMEKYNKLS------------YDPRLEQFIDKVNLTNLR-----NGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCY 1086
            G  FDPFW S+ +P     + LS            Y  +L Q    ++  +L+     +   S  ++  ++ WLV ++SCQ+   W DLG +FWPR+ +   C + +  +CSWPPGM C       I  L W C+
Sbjct:   82 GSSFDPFWMSVEQPADNDTSLLSTLSQDLYDGASRYRKKLAQEAQALDFGSLQLPRELSANSSLHVQNEIRQWLVQRASCQLTSTWVDLGTVFWPRWVRHTDC-DGANTACSWPPGMACRQAQLTQIKLLAWHCW 215          
BLAST of noggin-like protein 6 vs. Ensembl Xenopus
Match: acad10 (acyl-CoA dehydrogenase family member 10 [Source:Xenbase;Acc:XB-GENE-967980])

HSP 1 Score: 71.2478 bits (173), Expect = 4.088e-13
Identity = 47/141 (33.33%), Postives = 65/141 (46.10%), Query Frame = -2
Query:  736 PKYHSLNERKLIKILGDKFDPFWTSISRP------VMEKYNKLSYDPRLEQFIDKVNLTNLRNG---KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1131
            PK   L+ER L K LG  FDP + S+  P        +   K+     +   + K++L+    G   ++ ++       WL   + C V Y W+DLG  FWPRF K   C   S KSCS+P GM C         +LRW C
Sbjct:   54 PKEQDLDERTLRKKLGSNFDPNFMSVVLPNSVNMSTQDSLTKMKTLGSVPLELKKLDLSETPYGGRIRMGKKARRKFLQWLWAYTYCPVMYTWKDLGVRFWPRFIKEGHCF--SEKSCSFPEGMYCKPIKSVTKTFLRWYC 192          
BLAST of noggin-like protein 6 vs. Ensembl Xenopus
Match: nog (noggin [Source:NCBI gene;Acc:493191])

HSP 1 Score: 63.929 bits (154), Expect = 1.054e-10
Identity = 50/164 (30.49%), Postives = 70/164 (42.68%), Query Frame = -2
Query:  721 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRP----------VMEKYNKLSYDPRLEQFIDKVNLTNLRNGK---ISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQ 1173
            L E  DPI      PK   LNE  L  ++   FDP + +I+ P           ++   +      +   I  +       GK   +S+++   L+ WL  ++ C V Y W DLG  FWPR+ K  SC   S +SCS P GM C       +  LRW C    Q
Sbjct:   45 LIEHPDPIYD----PKEKDLNETLLRTLMVGHFDPNFMAINLPEERLGVEDLGELDLLLRQKPSGAMPAEIKGLEFYEGLQGKKHRLSKKLRRKLQMWLWSQTFCPVLYTWNDLGTRFWPRYVKVGSCY--SKRSCSVPEGMVCKAAKSMHLTILRWRCQRRVQ 202          
BLAST of noggin-like protein 6 vs. Ensembl Mouse
Match: Nog (noggin [Source:MGI Symbol;Acc:MGI:104327])

HSP 1 Score: 67.0106 bits (162), Expect = 9.388e-12
Identity = 52/168 (30.95%), Postives = 68/168 (40.48%), Query Frame = -2
Query:  736 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLR-NGKISEEMETL---------------------LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1173
            L E  DPI      PK   LNE  L  +LG  +DP + + S P              E   +   L   R +G +  E++ L                     L+ WL  ++ C V Y W DLG+ FWPR+ K  SC   S +SCS P GM C       +  LRW C
Sbjct:   46 LIEHPDPIFD----PKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCF--SKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 6 vs. UniProt/SwissProt
Match: sp|Q9W740|NOGG2_DANRE (Noggin-2 OS=Danio rerio OX=7955 GN=nog2 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.178e-13
Identity = 47/137 (34.31%), Postives = 66/137 (48.18%), Query Frame = -2
Query:  736 PKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFID--KVNLTNLRNG---KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1131
            P+   L+E+ L+K LG  FD  + SI  P     +     PRL    +  K++LT    G   K+ ++       WL   + C V Y W+DLG  FWPR+ K  +C   S +SCS+P GM C         +LRW C
Sbjct:   52 PREQDLSEKTLLKKLGSNFDANFMSIHLPAQLNASAPPELPRLPMPAELKKLDLTETPYGRRVKVGKKARRKFLQWLWMYTHCPVLYTWKDLGLRFWPRYIKEGNCF--SERSCSFPEGMSCKPVKAVTKTFLRWYC 186          
BLAST of noggin-like protein 6 vs. UniProt/SwissProt
Match: sp|Q9YHV3|NOGG3_DANRE (Noggin-3 OS=Danio rerio OX=7955 GN=nog3 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.438e-12
Identity = 51/160 (31.87%), Postives = 79/160 (49.38%), Query Frame = -2
Query:  730 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKY--NKLSYDPRLEQFIDKV----------NLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYE 1173
            L E  DP+L     PK   LNE +L  ILG  F+  + SI+ P  +    ++L+    ++Q  + +          ++ + +  K S+++   L+ WL   + C V + W+DLGN FWPR+ K  SC N   +SCS P GM C       +  LRW C +
Sbjct:   44 LKEDPDPVLD----PKERDLNETELRAILGSHFEQNFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNK--RSCSVPEGMVCKPPKSSHLTVLRWRCVQ 197          
BLAST of noggin-like protein 6 vs. UniProt/SwissProt
Match: sp|O93525|NOGG_CHICK (Noggin OS=Gallus gallus OX=9031 GN=NOG PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.491e-11
Identity = 50/162 (30.86%), Postives = 72/162 (44.44%), Query Frame = -2
Query:  736 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPV----------------MEKYNKLSYDPRLEQFIDKVNLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1173
            L E  DPI      PK   LNE  L  ++G  FDP + ++S P                       +  + +  +F D   L   +  ++S+++   L+ WL  ++ C V Y W DLG+ FWPR+ K  SC   S +SCS P GM C       +  LRW C
Sbjct:   45 LIEHPDPIFD----PKEKDLNETLLRSLMGGHFDPNFMAMSLPEDRLGVDDLAELDLLLRQRPSGAMPGEIKGLEFYD--GLQPGKKHRLSKKLRRKLQMWLWSQTFCPVLYTWNDLGSRFWPRYVKVGSCY--SKRSCSVPEGMVCKPAKSVHLTILRWRC 198          
BLAST of noggin-like protein 6 vs. UniProt/SwissProt
Match: sp|Q9YHT8|NOGG_TAKRU (Noggin OS=Takifugu rubripes OX=31033 GN=nog PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.954e-11
Identity = 47/146 (32.19%), Postives = 70/146 (47.95%), Query Frame = -2
Query:  730 PKYHSLNERKLIKILGDKFDPFWTSISRPV---------MEKYNKLSYDPRLEQFIDKVNLTNLRNGKISEEMETL---LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYE 1131
            PK   LNE +L  +LGD FD  + S+  P          ++ ++   +   L + I  V+    + GK  +  + L   L+ WL   S C + + W DLG+ FWPRF +  SC+  S +SCS P GM C       +  LRW C +
Sbjct:   55 PKERDLNETELKSVLGD-FDSRFLSVLPPAEDGHAGNDELDDFDAQRWGGALPKEIRAVDFDAPQLGKKHKPSKKLKRRLQQWLWAYSFCPLAHAWTDLGSRFWPRFVRAGSCL--SKRSCSVPEGMTCKPATSTHLTILRWRCVQ 197          
BLAST of noggin-like protein 6 vs. UniProt/SwissProt
Match: sp|Q13253|NOGG_HUMAN (Noggin OS=Homo sapiens OX=9606 GN=NOG PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.149e-11
Identity = 52/168 (30.95%), Postives = 68/168 (40.48%), Query Frame = -2
Query:  736 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLR-NGKISEEMETL---------------------LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1173
            L E  DPI      PK   LNE  L  +LG  +DP + + S P              E   +   L   R +G +  E++ L                     L+ WL  ++ C V Y W DLG+ FWPR+ K  SC   S +SCS P GM C       +  LRW C
Sbjct:   46 LIEHPDPIFD----PKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCF--SKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 6 vs. TrEMBL
Match: C1JAC6 (Noggin-like protein 6 OS=Schmidtea mediterranea OX=79327 GN=nlg6 PE=2 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 271/273 (99.27%), Postives = 271/273 (99.27%), Query Frame = -2
Query:  502 MIRMQAVTISMILLATLTGIRGGCFVETNDSNGNSGVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK 1320
            MIRMQAVTISMILLATLTGIRGGCFVETNDSNGNSGVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTN RNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYES QPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK
Sbjct:    1 MIRMQAVTISMILLATLTGIRGGCFVETNDSNGNSGVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNFRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESIQPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK 273          
BLAST of noggin-like protein 6 vs. TrEMBL
Match: C1JAC4 (Noggin-like protein 4 OS=Schmidtea mediterranea OX=79327 GN=nlg4 PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 1.959e-78
Identity = 122/274 (44.53%), Postives = 186/274 (67.88%), Query Frame = -2
Query:  502 MIRMQAVTISMILLATLTGIRGGCFVETNDSNGNSGVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKY-NKLSYDPRLEQFIDKVNLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK 1320
            MI + AV  S ++L+             ++S  +S +       ++V+VL E IDPIL  DL+P+ HSL+E +L+KILGD+FD FWTS++ P    Y  ++SYDP+LE F+D +N+T +R   IS EM+ L+++WLV+K++C++ Y WEDLGNLFWPRF K+  C+NT+ +SCSWPPGMKC L G   I++LRW+C+ES +P+ H  +     L++ N K   ++ V   W+  +RK+ LKRLI++TS+W+ G+ CEWRI  +++ + CEC+C+
Sbjct:    1 MIPILAVISSYLVLSFSAPCLSQYIAAFSESEIDSRIQDINTKGLKVKVLSEKIDPILFNDLMPESHSLHEGRLMKILGDRFDSFWTSVNTPHNLGYETEVSYDPKLEIFLDSLNITEIRGQPISFEMKRLIQNWLVNKATCKISYYWEDLGNLFWPRFIKKTICVNTNSESCSWPPGMKCGLSGPMKIHHLRWTCFESEEPLYHQRRKRANNLHKANNKKQKKRQVLSFWSPDKRKKQLKRLIRQTSLWKKGFQCEWRISDLSVSSTCECACR 274          
BLAST of noggin-like protein 6 vs. TrEMBL
Match: C1JAC8 (Noggin-like protein 8 OS=Schmidtea mediterranea OX=79327 GN=nlg8 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.628e-34
Identity = 85/252 (33.73%), Postives = 131/252 (51.98%), Query Frame = -2
Query:  505 GVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSY----DPRLEQFIDKVNLTNLRNGK-----ISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEK------RRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSC 1215
              N+     + +++LG+ ID  +  +L PK  S N ++L ++L +K D  WTSI  P   K    +Y    + +L    D +NLT   +G      + E +  + ++WL+ K++C + YIWEDLG LFWP++ +R  C+N   +SCSWPPGMKC   G   ++ L W+C E     + N +  R    +  R+    +   R   EK       R + +KRLIK TS+  NGY C+W +    I + C CSC
Sbjct:   60 STNNDKYTKVNMRILGKNIDQTVLNNLRPKMSSKNLKRLKRLLHEKRDTAWTSIDPPKTLKERGDNYRDMVESKLSVAADALNLT-FHDGTGTQYVLPEHVLRMFRNWLLKKATCVMDYIWEDLGPLFWPQWIRRGICVNNLAQSCSWPPGMKCRASGSRALHILYWACEEDVNLREFNRRKQRESRERNKRRWTKTRRRRRYPNEKTFNNQENRNKRIKRLIKMTSLASNGYYCKWDVHKYLINDKCSCSC 310          
BLAST of noggin-like protein 6 vs. TrEMBL
Match: A0A5K4FDM2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.077e-33
Identity = 87/252 (34.52%), Postives = 128/252 (50.79%), Query Frame = -2
Query:  502 IRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSY------------DPRLEQFIDKVNLTNLR----NG-----KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENR--KLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK 1188
            + V+VLGE ID      L P     + RKL +ILG      W SI  P+  + + +              D  L   +D++N T  R    +G     K++ +   ++K WL+ +++C ++YIWEDLG LFWPR+ KR  C+NT   SCSWPPGM+C   G   +  LRW C   S        N RR  +Q N   +L+     H+ + E+RR + ++RLI+K S+  NGY CEW      + + C C C+
Sbjct:   69 VDVRVLGERIDSKALLQLRPSSTIDSIRKLRRILGSDLQNDWMSIESPLNSQSSSIKSTRSTLSPNIPKPDNYLLNIVDELNFTVFRPVNNDGLIYPIKMTIDQVNIMKTWLLQRATCAMEYIWEDLGPLFWPRWIKRGVCVNT--HSCSWPPGMRCRSSGSRSLKLLRWVCKNDS---GKEASNRRRREFQTNYLGRLNRDTNSHQTYVEERRTKRVRRLIRKLSLTANGYHCEWNRYEYMVSDHCTCGCE 315          
BLAST of noggin-like protein 6 vs. TrEMBL
Match: A0A5B8LE37 (Putative bone morphogenetic protein antagonist OS=Schistosoma japonicum OX=6182 GN=NOG PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.502e-31
Identity = 85/252 (33.73%), Postives = 128/252 (50.79%), Query Frame = -2
Query:  502 IRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKY------------NKLSYDPRLEQFIDKVNLTNLR----NG-----KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENR--KLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK 1188
            + V+VLGE ID      L P   + + RKL +ILG      W SI  P+  +             N    D  L   ++++N T  R    +G     K++ +   ++K WL+ +++C ++YIWEDLG LFWPR+ +R  C+NT   SCSWPPGM+C   G   +  LRW C   S      + N RR  +Q N   +L      ++ + E+RR + ++RLI+K S+  NGY CEW      + + C C C+
Sbjct:  197 VDVRVLGERIDSKALLQLRPSSTAASIRKLRRILGTDLQNEWMSIETPLNSQSSSSKSTRSTLSPNIPKPDSHLLNAVEELNFTVFRPVTDDGLIYPIKMTIDQVNIMKTWLLQRATCAIEYIWEDLGPLFWPRWIRRGVCVNT--HSCSWPPGMRCRSSGSRALKLLRWVCKNDS---DKESSNRRRREFQTNSLGRLSRDVNTYQTFMEERRSKRVRRLIRKLSLTANGYHCEWSRYEYMVNDHCTCGCE 443          
BLAST of noggin-like protein 6 vs. Ensembl Cavefish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 73.9442 bits (180), Expect = 1.745e-14
Identity = 54/153 (35.29%), Postives = 69/153 (45.10%), Query Frame = -2
Query:  736 IRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLRNG--KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1188
            + V  L E  DP L     PK   LNE +L   LG  FD  + ++S P     +     P      D   L     G  K S++M   L+ WL   + C V Y W+DLG+ FWPR+ K  SC   S +SCS P GM C       +  LRW C
Sbjct:   26 LPVMDLLEDPDPALD----PKDRDLNETELRARLGAHFDAHFMAVSAPGAADTDASRLRPPGPMPRDIRTLDFELPGWKKPSKKMRRRLQLWLWSYTFCPVVYAWQDLGSRFWPRYVKVGSC--ASKRSCSVPEGMVCSPAKSAHLTLLRWYC 172          
BLAST of noggin-like protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000051007.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000650.1:142689:143405:-1 gene:ENSAMXG00000039724.1 transcript:ENSAMXT00000051007.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 3.000e-7
Identity = 24/65 (36.92%), Postives = 35/65 (53.85%), Query Frame = -2
Query:  736 LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 930
            L+++  +++ C V   W DLG  FWPR+ +  SC  +  +SCS P GM C       +  LRW C
Sbjct:  119 LREFERERALCPVVQTWSDLGARFWPRYVRMGSC--SRERSCSVPAGMLCTPAASTHVTLLRWRC 181          
BLAST of noggin-like protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009391.1 (pep scaffold:Pmarinus_7.0:GL476782:173121:173762:-1 gene:ENSPMAG00000008500.1 transcript:ENSPMAT00000009391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.209e-19
Identity = 48/151 (31.79%), Postives = 67/151 (44.37%), Query Frame = -2
Query:  730 LPKYHSLNERKLIKILGDKFDPFWTSISRP-----------VMEKYNKLSYDPR-LEQFIDKVNLTNLRNG----KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYE 1134
             PK   L   +L  ILG  FDPFW S+ RP           +  + + ++   R L      +N T L +       +E     +  WL+ K+ C V   W DLG++FWPR+ +R+ C  +    CSWP GM C       I  L W CY 
Sbjct:   23 FPKQRDLKSARLHNILGSSFDPFWMSVKRPSSSSTTGDIGALATRSSAVTAAGRKLHAAARALNFTVLTDSGAAVAATEATAAFMTRWLLQKAECGVASSWHDLGSVFWPRWVRRSHCEESGGGGCSWPAGMSCAPAQSTHIKILAWHCYA 173          
BLAST of noggin-like protein 6 vs. Ensembl Sea Lamprey
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 77.7962 bits (190), Expect = 2.811e-16
Identity = 54/159 (33.96%), Postives = 76/159 (47.80%), Query Frame = -2
Query:  736 VQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRL-------EQFIDKVNLTNLRNG---KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1182
            ++ L E  DP    +L PK   L+E+ L + LG  FDP + ++S P  +   + +   RL          I +++L  L +G   KI +     +  WL   + C V Y W+DLG  FWPRF K  SC N   +SCS+P GM C          LRW C
Sbjct:   43 IKDLIENPDP----ELDPKEQDLDEKLLRRKLGASFDPEFMAVSLPKGDASGQQTRGGRLLKPSGSMPNEIKRLDLGVLPHGQKIKIGKRARRKILQWLWSYTFCPVLYTWKDLGERFWPRFVKEGSCYNG--RSCSFPEGMACKPFKSASKTLLRWHC 195          
BLAST of noggin-like protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011420.1 (pep scaffold:Pmarinus_7.0:GL487123:1955:2662:1 gene:ENSPMAG00000010393.1 transcript:ENSPMAT00000011420.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 3.230e-12
Identity = 45/159 (28.30%), Postives = 68/159 (42.77%), Query Frame = -2
Query:  736 DLLPKYHSLNERKLIKILGDKFDPFWTSISRP-VMEKYNKLSYDP---------------RLEQFIDKVNLTNL--------RNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1140
            +L PK   L+ER L ++LG  FDP + S++ P  +    K + +P                +   I  ++            R G +  +    ++ +L   + C V Y W+DLG  FWPR+ +  SC   S +SCS P GM C          LRW C
Sbjct:   53 ELDPKTKDLDERVLRRLLGSHFDPTFMSVAAPGEVRGLAKNASEPGEQHGRGAAAARRERAMPSEIRDMDFARAAWPDPRGSRAGALGRKARRKMQLFLWAYTQCPVAYAWKDLGGRFWPRYVREGSC--QSGRSCSIPAGMSCKAQRSTSKAILRWYC 209          
BLAST of noggin-like protein 6 vs. Ensembl Sea Lamprey
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 62.7734 bits (151), Expect = 4.243e-11
Identity = 52/170 (30.59%), Postives = 72/170 (42.35%), Query Frame = -2
Query:  736 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEK-----------------YNKLSYDPR----LEQFIDKVNLTNLRNG---KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1173
            L E  DP    +L PK   L+ER L+K LG  FD  + SI+ P  E+                        P+    +   I +++LT    G   K+ +        WL   ++C V Y W++L   FWPR+ K  SC   S +SCS P GM C         +LRW C
Sbjct:   43 LVEDPDP----ELDPKAKDLDERALLKKLGSNFDHNFMSIATPESERQPGGESTTTTTTTTTAAVTAADRKPKPTGPIPSDIKRLDLTETLYGQKLKLGKRARRKFLQWLWAHTACPVVYSWKELNVRFWPRYIKEGSCY--SARSCSVPEGMVCKPVKFSNKTFLRWHC 206          
BLAST of noggin-like protein 6 vs. Ensembl Nematostella
Match: EDO36981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH37])

HSP 1 Score: 61.6178 bits (148), Expect = 1.445e-11
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = -2
Query:  730 ISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYE 954
            +S EME  +  WL+ + +C V Y W D+G  FWPRF KRA+C +   K CS  P  +C          LRW C +
Sbjct:    1 LSREMERFMMGWLLQRENCPVVYSWRDMGPHFWPRFVKRATCKS---KQCSIDPSTQCEPSNSRYFNILRWHCMD 72          
BLAST of noggin-like protein 6 vs. Ensembl Nematostella
Match: EDO36952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH36])

HSP 1 Score: 49.6766 bits (117), Expect = 2.191e-7
Identity = 27/65 (41.54%), Postives = 34/65 (52.31%), Query Frame = -2
Query:  736 LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 930
            L+ WL + SSC V   W+D G L WPR+     C   S  +CS+P GMKC       +  LRW C
Sbjct:   28 LQLWLWELSSCPVYQKWKDQGQLIWPRYRNIGRCSRKS--TCSYPGGMKCKRSKTKRVALLRWFC 90          
BLAST of noggin-like protein 6 vs. Ensembl Medaka
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 80.4925 bits (197), Expect = 1.531e-16
Identity = 50/139 (35.97%), Postives = 67/139 (48.20%), Query Frame = -2
Query:  736 PKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLE----QFIDKVNLTNLRNGK---ISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSC 1131
            P+   L ER L K LG  FDP + SIS P+    +   Y  +L+      I K++LT    GK   + ++       WL   + C V Y W+DLG  FWPR+ K   C   S +SCS+P GM C         +LRW C
Sbjct:   53 PREQDLAERTLRKKLGSNFDPNFMSISSPLQVNLSASDYQVKLQGPMPNEIKKLDLTETPYGKRVKVGKKARRKFLQWLWTYTHCPVVYTWKDLGVRFWPRYIKEGKCF--SERSCSFPEGMSCKPAKSINKIFLRWYC 189          
BLAST of noggin-like protein 6 vs. Ensembl Medaka
Match: nog1 (noggin 1 [Source:NCBI gene;Acc:30174])

HSP 1 Score: 72.4034 bits (176), Expect = 9.770e-14
Identity = 59/163 (36.20%), Postives = 79/163 (48.47%), Query Frame = -2
Query:  730 LGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQF------------IDKVNLTNLRNGKISEEMETL---LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYE 1173
            L E  DP+      PK    NE +L  ILGD FD  + S+S PV  K+   + +  L+ F            I  V+  +L++GK  +  + L   L+ WL   S C V Y W DLGN FWPRF +  SC+  S +SCS P GM C       +  LRW C +
Sbjct:   50 LKEDPDPVYD----PKERDFNETELKSILGD-FDSRFLSVSPPVEVKH---AANDELDDFALQRAGGIMPKEIRAVDF-DLQSGKKHKPSKKLKRRLQQWLWAYSFCPVLYSWTDLGNRFWPRFVRVGSCL--SKRSCSVPEGMVCKPASSTHLTTLRWRCVQ 201          
BLAST of noggin-like protein 6 vs. Planmine SMEST
Match: SMESG000017268.1 (SMESG000017268.1)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 263/263 (100.00%), Postives = 263/263 (100.00%), Query Frame = -2
Query:  502 MILLATLTGIRGGCFVETNDSNGNSGVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK 1290
            MILLATLTGIRGGCFVETNDSNGNSGVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK
Sbjct:    1 MILLATLTGIRGGCFVETNDSNGNSGVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSYDPRLEQFIDKVNLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK 263          
BLAST of noggin-like protein 6 vs. Planmine SMEST
Match: SMESG000008387.1 (SMESG000008387.1)

HSP 1 Score: 144.05 bits (362), Expect = 1.198e-37
Identity = 85/252 (33.73%), Postives = 131/252 (51.98%), Query Frame = -2
Query:  505 GVNSPGRIPIRVQVLGETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKLSY----DPRLEQFIDKVNLTNLRNGK-----ISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEK------RRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSC 1215
              N+     + +++LG+ ID  +  +L PK  S N ++L ++L +K D  WTSI  P   K    +Y    + +L    D +NLT   +G      + E +  + ++WL+ K++C + YIWEDLG LFWP++ +R  C+N   +SCSWPPGMKC   G   ++ L W+C E     + N +  R    +  R+    +   R   EK       R + +KRLIK TS+  NGY C+W +    I + C CSC
Sbjct:   59 STNNDKYTKVNMRILGKNIDQTVLNNLRPKMSSKNLKRLKRLLHEKRDTAWTSIDPPKTLKERGDNYRDMVESKLSVAADALNLT-FHDGTGTQYVLPEHVLRMFRNWLLKKATCVMDYIWEDLGPLFWPQWIRRGICVNNLAQSCSWPPGMKCRASGSRALHILYWACEEDVNLREFNRRKQRESRERNKRRWTKTRRRRRYPNEKTFNNQENRNKRIKRLIKMTSLASNGYYCKWDVHKYLINDKCSCSC 309          
BLAST of noggin-like protein 6 vs. Planmine SMEST
Match: SMESG000016086.1 (SMESG000016086.1)

HSP 1 Score: 112.079 bits (279), Expect = 1.215e-26
Identity = 70/249 (28.11%), Postives = 121/249 (48.59%), Query Frame = -2
Query:  502 VQVLGETIDPILTKDLLPKYHSLNERKLIKILGD-KFDPFWTSISRPVMEK----YNKLSYDPRLEQFIDKVNLTNLRNG----KISEEMETLLKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQ----------PIQHNNQNPRRPL--YQE-NRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSCK 1182
            ++++G+ I      +  P     N +KL K+      D  W SI++P + +      +++    L + +  +N T + +     +I E M+ L + WL++ SSCQ+ ++WEDLG +FWP + +R  C  TS KSCSWP GM C   G   ++ LRW C + +            I+   Q  ++ +  YQ+  R+  +    + L  E + K+   R+ +  S   +GY C+W +    I + C C CK
Sbjct:   67 IKLIGDNISANFDSNTKPNLQQRNPKKLEKLFWKYHLDTQWLSINKPDVLRGLMPVEQINARQELMKAVGNLNFTFVDSVGAMLEIPENMQNLFRKWLIEYSSCQMNFVWEDLGEMFWPSWIRRGLC--TSSKSCSWPSGMACKHSGSRTLHLLRWVCLKDTNGTEAKKLQNFKIKLKTQKMKKQMLYYQKRRRRFPDSTRSNNLSKEVQSKKKATRITRLLSRASDGYFCQWSMLKYYINDKCSCQCK 313          
BLAST of noggin-like protein 6 vs. Planmine SMEST
Match: SMESG000007405.1 (SMESG000007405.1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.406e-22
Identity = 71/243 (29.22%), Postives = 116/243 (47.74%), Query Frame = -2
Query:  505 IDPILTKDLLPKYHSLNERKLIKIL-GDKFDPFWTSISRPV-----MEKYNKLSYDPRLEQFIDKVNLT--NLRNGKISEEMETL--LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNN-----QNPRRPLYQENRKLHNRK---------PVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSC 1161
             + I+  + +P      ++KL KIL  D     W ++++P      +   NK+  D RL   I   N    N R  K++   + L  +K WL ++SSCQ++YIW +L   FWPR+ K+  C+  S+ SCSWPPGM C       +  L++ C E  + I+++      Q  R    +   K++NRK            R+ T++ ++   K LI     + NG+ C+W      +  +C CSC
Sbjct:   28 FNEIIVTNFIPNLSPSIDKKLKKILDSDHLFDNWLALTKPAEIYIPLNGTNKI--DSRLRNLIKMKNFVFKNKRGEKMNLTSDILDSIKLWLEEESSCQMEYIWHELEPSFWPRWIKKGLCV--SLTSCSWPPGMSCKAKKTKNLDLLQFRCEEDPKKIKYDADERAMQQLRLTRQKRQYKIYNRKRGVFQGRSNNSRRVVTKREKEVRTKMLIFSLREYMNGFYCKWVKTLYYVNELCSCSC 266          
BLAST of noggin-like protein 6 vs. Planmine SMEST
Match: SMESG000034704.1 (SMESG000034704.1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.699e-22
Identity = 72/242 (29.75%), Postives = 116/242 (47.93%), Query Frame = -2
Query:  505 IDPILTKDLLPKYHSLNERKLIKIL-GDKFDPFWTSISRPVMEKYNKLS----YDPRLEQFIDKVNLT--NLRNGKISEEMETL--LKDWLVDKSSCQVKYIWEDLGNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQPIQHNN-----QNPRRPLYQENRKLHNRK---------PVHRLWTEKRRKQHLKRLIKKTSVWRNGYMCEWRIKAVNIENICECSC 1161
             + I+  + +P      ++KL KIL  D     W ++++P  E Y  L+     D RL   I   N    N R  K++   + L  +K WL ++SSCQ++YIW +L   FWPR+ K+  C+  S+ SCSWPPGM C       +  L++ C E  + I+++      Q  R    +   K++NRK            R+ T++ ++   K LI     + NG+ C+W      +  +C CSC
Sbjct:   49 FNEIIVTNFIPNLSPSIDKKLKKILDSDHLFGNWLALTKPA-EIYIPLNGTNKIDSRLRNLIKMKNFVFKNKRGEKMNLTSDILDSIKLWLEEESSCQMEYIWHELEPSFWPRWIKKGLCV--SLTSCSWPPGMSCKAKKTKNLDLLQFRCEEDPKKIKYDADERAMQQLRLTRQKRQYKIYNRKRGVFQGRSNNSRRVVTKREKEVRTKMLIFSLREYMNGFYCKWVKTLYYVNELCSCSC 287          
The following BLAST results are available for this feature:
BLAST of noggin-like protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NOG1.280e-1130.95noggin [Source:HGNC Symbol;Acc:HGNC:7866][more]
back to top
BLAST of noggin-like protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nog22.886e-1434.31noggin 2 [Source:NCBI gene;Acc:30185][more]
nog37.123e-1431.88noggin 3 [Source:NCBI gene;Acc:30173][more]
nog37.328e-1431.88noggin 3 [Source:NCBI gene;Acc:30173][more]
nog37.328e-1431.88noggin 3 [Source:NCBI gene;Acc:30173][more]
nog13.166e-1031.68noggin 1 [Source:NCBI gene;Acc:30174][more]
back to top
BLAST of noggin-like protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nog41.425e-1631.11noggin 4 [Source:NCBI gene;Acc:733455][more]
acad104.088e-1333.33acyl-CoA dehydrogenase family member 10 [Source:Xe... [more]
nog1.054e-1030.49noggin [Source:NCBI gene;Acc:493191][more]
back to top
BLAST of noggin-like protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nog9.388e-1230.95noggin [Source:MGI Symbol;Acc:MGI:104327][more]
back to top
BLAST of noggin-like protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W740|NOGG2_DANRE2.178e-1334.31Noggin-2 OS=Danio rerio OX=7955 GN=nog2 PE=2 SV=1[more]
sp|Q9YHV3|NOGG3_DANRE1.438e-1231.88Noggin-3 OS=Danio rerio OX=7955 GN=nog3 PE=1 SV=1[more]
sp|O93525|NOGG_CHICK2.491e-1130.86Noggin OS=Gallus gallus OX=9031 GN=NOG PE=2 SV=1[more]
sp|Q9YHT8|NOGG_TAKRU3.954e-1132.19Noggin OS=Takifugu rubripes OX=31033 GN=nog PE=3 S... [more]
sp|Q13253|NOGG_HUMAN6.149e-1130.95Noggin OS=Homo sapiens OX=9606 GN=NOG PE=1 SV=1[more]
back to top
BLAST of noggin-like protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1JAC60.000e+099.27Noggin-like protein 6 OS=Schmidtea mediterranea OX... [more]
C1JAC41.959e-7844.53Noggin-like protein 4 OS=Schmidtea mediterranea OX... [more]
C1JAC84.628e-3433.73Noggin-like protein 8 OS=Schmidtea mediterranea OX... [more]
A0A5K4FDM21.077e-3334.52Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5B8LE371.502e-3133.73Putative bone morphogenetic protein antagonist OS=... [more]
back to top
BLAST of noggin-like protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nog31.745e-1435.29noggin 3 [Source:NCBI gene;Acc:30173][more]
ENSAMXT00000051007.13.000e-736.92pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of noggin-like protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009391.11.209e-1931.79pep scaffold:Pmarinus_7.0:GL476782:173121:173762:-... [more]
nog32.811e-1633.96noggin 3 [Source:NCBI gene;Acc:30173][more]
ENSPMAT00000011420.13.230e-1228.30pep scaffold:Pmarinus_7.0:GL487123:1955:2662:1 gen... [more]
nog24.243e-1130.59noggin 2 [Source:NCBI gene;Acc:30185][more]
back to top
BLAST of noggin-like protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO369811.445e-1140.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369522.191e-741.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of noggin-like protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nog21.531e-1635.97noggin 2 [Source:NCBI gene;Acc:30185][more]
nog19.770e-1436.20noggin 1 [Source:NCBI gene;Acc:30174][more]
back to top
BLAST of noggin-like protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017268.10.000e+0100.00SMESG000017268.1[more]
SMESG000008387.11.198e-3733.73SMESG000008387.1[more]
SMESG000016086.11.215e-2628.11SMESG000016086.1[more]
SMESG000007405.12.406e-2229.22SMESG000007405.1[more]
SMESG000034704.12.699e-2229.75SMESG000034704.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022274
GenBankACO06231.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022274 ID=SMED30022274|Name=noggin-like protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=2926bp
TGTTGGATTTGCGCGATTGACTAAATTTCTAAATTATATTTCTATTTTCC
AACTGGAATTCAAAGAAATCCCGAAAACATGCTTAGAAACGGGAAAGCAA
CATGTCCACCTTCCAAATGTTCCCCTTCAACATGTCCCTTCCATTGAAAA
AGGTCGGTATATTGCACCAATTGAATATTTTAATATTCCCGTTTATCTTT
ATATTTCCTTTTTGAAGTACATTTCTCCTCCGTTGAATAGCATGCAGCCT
TGTGCTTTCTCAATGTCCCCGAACCTGCCCCCCTCCCTCCACCAAATAAA
TAATTGCATATATAGCAGTTCACAAATGAAAGTATGAAGTCCGTGACGAC
AAATGCTATGGAGATAAATACAATTATTTTACAAAAGTAGAAATTCAACA
AAAAAATTGCAAAATGTCAGGCGAAAATCCATAAAATATACATAAATATT
TATTAAAAGCAATACTGATGTTTGATGAATGAAGCTGAAGAATTGGATCT
ATTTGCAGGAGCATTCACAAATGTTCTCAATGTTGACGGCCTTGATTCTC
CATTCGCACATGTATCCGTTCCTCCAGACGCTCGTTTTCTTTATCAAGCG
CTTCAAGTGTTGTTTTCTTCTTTTTTCCGTCCAGAGCCGATGAACCGGTT
TCCTGTTATGCAATTTCCTATTTTCCTGATAGAGAGGCCTCCTTGGGTTT
TGATTGTTATGCTGGATTGGCTGGCTTGATTCATAGCACGACCAACGCAA
ATAGTAGATCATGTGTTTCCCTCCGAGATGGCATTTCATACCTGGAGGCC
AGGAGCAAGATTTTACGCTTGTATTGATGCATGAAGCCCTTTTGAAAAAT
CTAGGCCAAAACAAATTTCCGAGGTCCTCCCAAATGTATTTCACTTGGCA
AGATGATTTATCCACCAGCCAGTCTTTTAATAATGTTTCCATTTCTTCGG
AAATTTTCCCATTTCTTAAATTGGTCAAATTTACTTTGTCAATGAATTGT
TCTAGCCTTGGATCGTAGGACAATTTGTTATACTTTTCCATTACCGGCCT
ACTGATAGATGTCCAGAACGGATCAAACTTGTCCCCCAGGATCTTTATTA
ATTTCCTTTCATTTAAACTATGATACTTTGGCAATAGATCTTTGGTCAAA
ATGGGATCGATTGTCTCCCCAAGTACCTGAACTCTAATAGGAATCCTTCC
AGGAGAGTTGACGCCTGAGTTTCCATTGCTATCATTAGTCTCTACAAAGC
AGCCTCCCCTAATTCCCGTCAATGTTGCCAGCAAGATCATAGAAATAGTC
ACAGCCTGCATACGAATCATTGTAAAAATGTTTATTGGAAATACAAAAGT
AATTTCTGACTAGATTTAAAAGAGAATTCCAGCGCGTCGGTAATAAAGCA
AAAGCCAGCCAATCAAAATATTCTTACGTAACTCCCTATGATATTTAGTC
CGCGTTACACGCATGCCGAATCTCCATTGTTCCGTTAGCTTGATGTCGAC
TAGAGATAGAATAGAAGTTCTGTTTTGTAATCTTTTGTTTGAAATTATCG
TCTTTCTGTTTCCATTGAATAATTCTTCTGCTTGCCAGGGAACTTTCTTT
GATTTCAAAACTTCGACTTAACTCAATCTGATGCAAATAATTGAATTTGT
TTCGTAATATCTCAGATACAATCTTAATGATTTGTAGGAGCTTCGGATCT
ACCTGACTTGTATGATACAATTGGTTTCCATACGGAGATTATTTGTATTA
CGTCATTTGGTGAGGATATGGTCATGAGGTCATGAGGCCATGAGGCCATC
ATGGTGTCGTAATAACCATTATTGTCTCCAATATCTACTGGAGCCTCGCT
AAATTTATGGAAACTGTGCCTGGATTTTGTTGAGAAGACGGACTTCAATA
TACATAATAAATAAACGTAATAAAGGTGATAAAGGGAGGGGGGGTAGTTT
AATAAATTTAATTTAATTGTTTCATTATTTTGGAATTTCAAATATACAAC
CTTAATACAAACCTCACAACTGCCGGTCATTCATTATAGTGTTGACCCCC
CCCCTTCTGGGTAGCTGGATTAGGGCTACCCCAAACTTTGTGACCTTGAT
GTGATAAATATAAACCAATCGAGAGTTAGACAAATCTTATAAGTCAATTT
TCTGAATCTCCTAACATTTCAGACAGAATCTTTGACCCTAGCAAAACTTG
CAAAATTCTTTCTTTGTTGACCACGATCTTTATTAAAGCCGGTATAACGT
AAAAAGGCTCATTAGTAAAGAAAAGCTTCTCGGTTCAAAACTGGGAGGGG
GTCAAAATGGTTAATAAAAAATGTCCATATGTTGAGGAACTGCTGTCCGT
TTATGCTAGCAACATCCTTGTGAGCTTGGGTACCAAATACGGCTGGGATG
TGCCAATGGACGTGGGAAAGAGGTAAATATACAAAATATGAATAAAAAAG
TCAATGAAAAATATGAAAATTCGAAAAATCAATAATTTTGGGGAGGGGCT
ATGAAAAATTGAATATAATATTCTAATTTTAGGTCAATGGAAGTCCCCGA
GGCAATGAAATTCAAAAATTACAAATGAAATAATTAATTATAAATTTGAT
GATGACATTAATCCCTTCATCAGAAAGCATGATCACCGAGTTCGACAGGT
AGGGCTGTTACCTTTTCAATAAGAAATCCGGGGGAGGGGGAATCGCTGCG
GTAGCTCCAAGGAGGTTCAGAAATAATGGGGTAACAACTTATGAAAAAAG
AGGATAATTTGATGACCTTGCTAATGTGGCCGAAGGCCATGGACAAGACA
ATTGGTTACAACGAAATGATTTGAGTTGAAATTGTTTACTGTGGAATTGA
ATATTTATTGTTTCATTATTGACAAATAACCTTATAAAACGTGTCTGTGT
GTAAAGAAAAATAAATAATTATGAAC
back to top

protein sequence of SMED30022274-orf-1

>SMED30022274-orf-1 ID=SMED30022274-orf-1|Name=SMED30022274-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
VGFARLTKFLNYISIFQLEFKEIPKTCLETGKQHVHLPNVPLQHVPSIEK
GRYIAPIEYFNIPVYLYISFLKYISPPLNSMQPCAFSMSPNLPPSLHQIN
NCIYSSSQMKV*
back to top

protein sequence of SMED30022274-orf-2

>SMED30022274-orf-2 ID=SMED30022274-orf-2|Name=SMED30022274-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=274bp
MIRMQAVTISMILLATLTGIRGGCFVETNDSNGNSGVNSPGRIPIRVQVL
GETIDPILTKDLLPKYHSLNERKLIKILGDKFDPFWTSISRPVMEKYNKL
SYDPRLEQFIDKVNLTNLRNGKISEEMETLLKDWLVDKSSCQVKYIWEDL
GNLFWPRFFKRASCINTSVKSCSWPPGMKCHLGGKHMIYYLRWSCYESSQ
PIQHNNQNPRRPLYQENRKLHNRKPVHRLWTEKRRKQHLKRLIKKTSVWR
NGYMCEWRIKAVNIENICECSCK*
back to top
Aliases
The feature 'noggin-like protein 6' has the following synonyms
Synonym
nlg-6
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR029034Cystine-knot_cytokine